spacer

EBI Dbfetch

ID   CH466556; SV 1; linear; genomic DNA; CON; MUS; 21022780 BP.
XX
AC   CH466556;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009775581 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-21022780
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-21022780
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; b0ff4a4550f5820a1975638d952a6e33.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000219.
DR   Ensembl-Gn; ENSMUSG00000000093; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000094; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000120; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000982; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001123; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001440; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001441; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001444; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001510; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002058; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007877; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009185; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013418; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014351; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017221; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017344; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017404; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017421; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018160; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018167; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018168; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018381; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018547; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018659; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018666; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018841; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018844; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018930; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019122; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020485; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020492; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020495; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020516; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020696; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020702; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020704; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020707; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020709; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020829; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020857; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020870; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020875; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020882; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023723; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033983; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035042; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035373; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035385; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038366; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038517; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038615; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038811; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038909; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038967; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038994; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039084; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041958; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045140; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046719; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046755; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048616; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048895; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049612; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051232; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051748; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056008; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056158; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056648; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058756; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069744; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000072620; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078763; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078771; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000081906; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091228; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000098375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000095; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001008; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001479; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001480; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001484; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008021; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009329; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017365; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017384; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017548; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017561; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017572; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017839; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018544; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018842; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018988; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020794; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021033; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021040; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021045; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021050; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021240; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035938; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036088; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036649; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038886; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041301; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041685; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052566; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052919; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059026; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070832; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072566; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079702; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090541; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092735; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100532; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103139; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104933; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107479; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107565; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107629; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107657; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107658; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107708; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107709; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107712; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107714; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107859; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107861; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108189; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108268; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108269; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108294; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118784; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122067; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124072; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141169; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143280; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169695; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170799; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173938; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178611; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182502; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000183742; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..21022780
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            675..4671
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /note="gene_id=mCG10805.1"
FT   mRNA            join(675..1130,1221..1432,1526..1580,1666..1826,1946..2029,
FT                   2259..2433,2552..2751,2879..4671)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT11955"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT11955.1 created
FT                   on 27-AUG-2002"
FT   mRNA            join(677..1130,1221..1370,2994..3077)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT172617"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172617.0 created
FT                   on 27-AUG-2002"
FT   mRNA            join(943..1130,1221..1432,1526..1580,1666..1749,2369..2433,
FT                   2552..2734)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT172619"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172619.0 created
FT                   on 27-AUG-2002"
FT   CDS             join(1019..1130,1221..1370,2994..3031)
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_b"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172617.0
FT                   protein_id=mCP95537.0 isoform=CRA_b"
FT                   /protein_id="EDL15561.1"
FT                   /translation="MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLS
FT                   QIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKALGLAMHIPFCL"
FT   CDS             join(1019..1130,1221..1432,1526..1580,1666..1826,
FT                   1946..2029,2259..2433,2552..2751,2879..2971)
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_d"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT11955.1
FT                   protein_id=mCP13465.1 isoform=CRA_d"
FT                   /protein_id="EDL15563.1"
FT                   /translation="MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLS
FT                   QIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIL
FT                   VGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKISDRTPSALA
FT                   ILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHV
FT                   YLEGTLLKPNMVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEAS
FT                   LNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEMNGLAAQ
FT                   GRYEGSGDGGAAAQSLYIANHAY"
FT   CDS             join(1019..1130,1221..1432,1526..1580,1666..1749,
FT                   2369..2433,2552..2557)
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_e"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172619.0
FT                   protein_id=mCP95536.0 isoform=CRA_e"
FT                   /protein_id="EDL15564.1"
FT                   /translation="MPHSYPALSAEQKKELSDIALRIVTPGKGILAADESVGSMAKRLS
FT                   QIGVENTEENRRLYRQVLFSADDRVKKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIL
FT                   VGIKVDKGVVPLAGTDGETTTQGLDGLLERCAQYKKDGADFAKWRCVLKITQKRSPWQL
FT                   SLPCVVLCPQLSQG"
FT   mRNA            join(1400..1432,1526..1580,1666..1721,3081..3375)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT172616"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172616.0 created
FT                   on 27-AUG-2002"
FT   mRNA            join(1666..1826,1946..2029,2259..2433,2552..2751,
FT                   4415..4568)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT172618"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172618.0 created
FT                   on 27-AUG-2002"
FT   CDS             join(2331..2433,2552..2751,4415..4426)
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_c"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172618.0
FT                   protein_id=mCP95535.0 isoform=CRA_c"
FT                   /protein_id="EDL15562.1"
FT                   /translation="MVTPGHACPIKYSPEEIAMATVTALRRTVPPAVPGVTFLSGGQSE
FT                   EEASLNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEFYL
FT                   "
FT   CDS             3202..3363
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_a"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172616.0
FT                   protein_id=mCP95538.0 isoform=CRA_a"
FT                   /protein_id="EDL15560.1"
FT                   /translation="MWTFFLSPPALTVTLDGIVCPWALLANFLSWDQGDVNSSPDSCSL
FT                   CSEYIANK"
FT   gene            5064..19627
FT                   /gene="Pigs"
FT                   /locus_tag="mCG_10822"
FT                   /note="gene_id=mCG10822.1"
FT   mRNA            join(5064..5125,5349..5488,5592..5703,9568..9657,
FT                   10285..10376,12045..12252,13306..13448,14407..14521,
FT                   15961..16106,16627..16727,17843..18053,18352..19627)
FT                   /gene="Pigs"
FT                   /locus_tag="mCG_10822"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class S"
FT                   /note="gene_id=mCG10822.1 transcript_id=mCT11972.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(5092..5125,5349..5488,5592..5703,9568..9657,
FT                   10285..10376,12045..12252,13306..13448,14407..14521,
FT                   15961..16106,16627..16727,17843..18053,18352..18627)
FT                   /codon_start=1
FT                   /gene="Pigs"
FT                   /locus_tag="mCG_10822"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class S"
FT                   /note="gene_id=mCG10822.1 transcript_id=mCT11972.1
FT                   protein_id=mCP13486.2"
FT                   /db_xref="GOA:Q3V307"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="MGI:MGI:2687325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V307"
FT                   /protein_id="EDL15565.1"
FT                   /translation="MAAAGAAATDLEVVRGKRSALFFAAVAILLGLPLWWKTTETYRAP
FT                   LPYSDISGLNALLLRLMVPVTVVFTRDSVPLDDQEKLPFTVVHEREIPLKYKMKIKCRF
FT                   QKAYRRALEHEEEALSLGSVHEAEAMLAEPEKQAEGSLTVYVISEHSSLLPQDMMSYIG
FT                   PERTAVVRGLIHREAFNIIGRRIVQVAQAMSLTEDVLAAALADHLPEDKWSSDKRRPLK
FT                   SSLGYEITFSLLNPDPKSHDVHWDIEGAVQRFVQPFLNRLSVAGNFSVDSQILYYAMLG
FT                   VNPRFDPASSSYSLAMHSLPHVINPVESRLGSSAASLYPVLHFLLYVPELAHSPLYIQD
FT                   KDGAPVATNAFHSPRWGGIMVYNVDPKIYNASELPVRVEVDMVRVMEVFLAQLRLLFGI
FT                   AQPQVPPKCLLSGPKSEGLMTWELDRLLWARSVENLATATTTLTSLAQLLGKISNIVIK
FT                   DDVASEVYRAVAAVQKAAKALALGHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQ
FT                   KFAIYIPLFLPMAVPILLSLVKIFQETRKSWKKPEKID"
FT   gene            20131..25776
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /note="gene_id=mCG10814.1"
FT   mRNA            join(20131..20404,23836..23949,24415..24517,24705..24877,
FT                   25149..25776)
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /product="unc-119 homolog (C. elegans), transcript variant
FT                   mCT11964"
FT                   /note="gene_id=mCG10814.1 transcript_id=mCT11964.1 created
FT                   on 22-JUL-2002"
FT   mRNA            join(20150..20404,23836..23949,24415..24517,24705..24835,
FT                   25149..25776)
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /product="unc-119 homolog (C. elegans), transcript variant
FT                   mCT170947"
FT                   /note="gene_id=mCG10814.1 transcript_id=mCT170947.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(20185..20404,23836..23949,24415..24517,24705..24877,
FT                   25149..25261)
FT                   /codon_start=1
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /product="unc-119 homolog (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG10814.1 transcript_id=mCT11964.1
FT                   protein_id=mCP13419.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V299"
FT                   /db_xref="InterPro:IPR008015"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="MGI:MGI:1328357"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V299"
FT                   /protein_id="EDL15566.1"
FT                   /translation="MKVKKGGGGTGSGAEPVPGASNRSAEPTREPGAEAESGSESEPEP
FT                   GPGPRLGPLQGKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFE
FT                   IKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIE
FT                   RHYFRNQLLKSFDFHFGFCIPSSKNTCEHIYDFPPLSEELISEMIRHPYETQSDSFYFV
FT                   DDRLVMHNKADYSYSGTP"
FT   CDS             join(20185..20404,23836..23949,24415..24517,24705..24835,
FT                   25149..25261)
FT                   /codon_start=1
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /product="unc-119 homolog (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG10814.1 transcript_id=mCT170947.0
FT                   protein_id=mCP93865.0 isoform=CRA_b"
FT                   /protein_id="EDL15567.1"
FT                   /translation="MKVKKGGGGTGSGAEPVPGASNRSAEPTREPGAEAESGSESEPEP
FT                   GPGPRLGPLQGKQPIGPEDVLGLQRITGDYLCSPEENIYKIDFVRFKIRDMDSGTVLFE
FT                   IKKPPVSERLPINRRDLDPNAGRFVRYQFTPAFLRLRQVGATVEFTVGDKPVNNFRMIE
FT                   RHYFRNQLLKSFDFHFGFCIPSSKNTFSEMIRHPYETQSDSFYFVDDRLVMHNKADYSY
FT                   SGTP"
FT   gene            complement(34906..63176)
FT                   /gene="Foxn1"
FT                   /locus_tag="mCG_10812"
FT                   /note="gene_id=mCG10812.1"
FT   mRNA            complement(join(34906..35688,37395..37886,38044..38251,
FT                   42559..42655,43485..43615,45325..45438,47575..48036,
FT                   48434..48585,63113..63176))
FT                   /gene="Foxn1"
FT                   /locus_tag="mCG_10812"
FT                   /product="forkhead box N1"
FT                   /note="gene_id=mCG10812.1 transcript_id=mCT11962.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(35369..35688,37395..37886,38044..38251,
FT                   42559..42655,43485..43615,45325..45438,47575..48036,
FT                   48434..48556))
FT                   /codon_start=1
FT                   /gene="Foxn1"
FT                   /locus_tag="mCG_10812"
FT                   /product="forkhead box N1"
FT                   /note="gene_id=mCG10812.1 transcript_id=mCT11962.0
FT                   protein_id=mCP13399.1"
FT                   /db_xref="GOA:Q5SYK1"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018122"
FT                   /db_xref="MGI:MGI:102949"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SYK1"
FT                   /protein_id="EDL15568.1"
FT                   /translation="MVSLLPPQSDVTLPGSTRLEGEPQGDLMQAPGLPDSPAPQNKHAN
FT                   FSCSSFVPDGPPERTPSLPPHSPSIASPDPEQIQGHCTAGPGPGSFRLSPSEKYPGFGF
FT                   EEGPAGSPGRFLKGNHMPFHPYKRHFHEDIFSEAQTAMALDGHSFKTQGALEAFEEIPV
FT                   DMGDAEAFLPSFPAEAWCNKLPYPSQEHNQILQGSEVKVKPQALDSGPGMYCYQPPLQH
FT                   MYCSSQPAFHQYSPGGGSYPVPYLGSPHYPYQRIAPQANAEGHQPLFPKPIYSYSILIF
FT                   MALKNSKTGSLPVSEIYNFMTEHFPYFKTAPDGWKNSVRHNLSLNKCFEKVENKSGSSS
FT                   RKGCLWALNPSKIDKMQEELQKWKRKDPIAVRKSMAKPEELDSLIGDKREKLGSPLLGC
FT                   PPPGLAGPGPIRPMAPSAGLSQPLHPMHPAPGPMPGKNPLQDLLGGHAPSCYGQTYPHL
FT                   SPSLAPSGHQQPLFPQPDGHLELQAQPGTPQDSPLPAHTPPSHGAKLMAEPSSARTMHD
FT                   TLLPDGDLGTDLDAINPSLTDFDFQGNLWEQLKDDSLALDPLVLVTSSPTSSSMLPPPP
FT                   AAHCFPPGPCLAETGNEAGELAPPGSGGSGALGDMHLSTLYSAFVELESTPSSAAAGPA
FT                   VYLSPGSKPLALA"
FT   gene            <71102..82275
FT                   /locus_tag="mCG_146185"
FT                   /note="gene_id=mCG146185.0"
FT   mRNA            join(<71102..71123,71235..71414,71795..71856,73297..73394,
FT                   79010..82275)
FT                   /locus_tag="mCG_146185"
FT                   /product="mCG146185"
FT                   /note="gene_id=mCG146185.0 transcript_id=mCT186288.0
FT                   created on 14-JUL-2003"
FT   gene            complement(73893..98817)
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /note="gene_id=mCG10810.2"
FT   mRNA            complement(join(73893..74473,74909..75046,75650..75811,
FT                   76702..76823,77094..77182,77362..77580,79690..79812,
FT                   79932..80103,80996..81195,81289..81425,83428..83556,
FT                   98684..98803))
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /product="solute carrier family 13 (sodium-dependent
FT                   dicarboxylate transporter), member 2, transcript variant
FT                   mCT11960"
FT                   /note="gene_id=mCG10810.2 transcript_id=mCT11960.1 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(73924..74473,74909..75046,75650..75811,
FT                   76702..76823,77090..77182,77362..77580,79690..79812,
FT                   79932..79989,83448..83556,98684..98817))
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /product="solute carrier family 13 (sodium-dependent
FT                   dicarboxylate transporter), member 2, transcript variant
FT                   mCT170946"
FT                   /note="gene_id=mCG10810.2 transcript_id=mCT170946.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(74306..74473,74909..75046,75650..75811,
FT                   76702..76823,77094..77182,77362..77580,79690..79812,
FT                   79932..80103,80996..81195,81289..81425,83428..83556,
FT                   98684..98785))
FT                   /codon_start=1
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /product="solute carrier family 13 (sodium-dependent
FT                   dicarboxylate transporter), member 2, isoform CRA_a"
FT                   /note="gene_id=mCG10810.2 transcript_id=mCT11960.1
FT                   protein_id=mCP13501.2 isoform=CRA_a"
FT                   /protein_id="EDL15570.1"
FT                   /translation="MATCWQALWAYRSYLIVLCLPIFLLPLPLIVQTKEAYCAYSIILM
FT                   ALLWCTEALPLAVTALFPIILFPLMGIMEASKVCLEYFKDTNILFVGGLMVAIAVEHWN
FT                   LHKRIALGVLLIIGVRPALLLLGFMLVTAFLSMWISNTATTAMMLPIGYAVLEQLQGSQ
FT                   KDVEEGNSNPSFELQEASPQKEETKLDNGQAVSVSSEPRAQKTKEHHRFSQGLSLCICY
FT                   SASIGGIATLTGTTPNLVLQGQVNSIFPENSNVVNFASWFGFAFPTMVILLLLAWLWLQ
FT                   VLFLGVNFRKNFGFGEGEEERKQAAFQVIKTQHRLLGPMSFAEKAVTFLFVLLVVLWFT
FT                   REPGFFPGWGDTAFANKKGQSMVSDGTVAIFISLIMFIIPSKIPGLTEDPKKPGKLKAP
FT                   PAILTWKTVNDKMPWNILILLGGGFALAKGSEESGLSKWLGDKLTPLQHVPPSATVLIL
FT                   SLLVAIFTECTSNVATTTLFLPILASMAQAICLHPLYVMLPCTLAASLAFMLPVATPPN
FT                   AIVFSFGGLKVSDMARAGFLLNIIGVLTITLSINSWSIPIFKLDTFPTWAYSNTSQCLL
FT                   NPPNSTVPGH"
FT   CDS             complement(join(76763..76823,77090..77182,77362..77580,
FT                   79690..79812,79932..79989,83448..83556,98684..98785))
FT                   /codon_start=1
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /product="solute carrier family 13 (sodium-dependent
FT                   dicarboxylate transporter), member 2, isoform CRA_b"
FT                   /note="gene_id=mCG10810.2 transcript_id=mCT170946.0
FT                   protein_id=mCP93864.0 isoform=CRA_b"
FT                   /protein_id="EDL15571.1"
FT                   /translation="MATCWQALWAYRSYLIVLCLPIFLLPLPLIVQTKEAYCAYSIILM
FT                   ALLWCTEALPLAVTALFPIILFPLMGIATLTGTTPNLVLQGQVNSIFPENSNVVNFASW
FT                   FGFAFPTMVILLLLAWLWLQVLFLGVNFRKNFGFGEGEEERKQAAFQVIKTQHRLLGPM
FT                   SFAEKAVTFLFVLLVVLWFTREPGFFPGWGDTAFANKKGQSMVSDGTVAIFISLIMFII
FT                   PSKIPGLTEDPSKKTREAEGSSCHPHLEDSER"
FT   CDS             <80944..81603
FT                   /codon_start=1
FT                   /locus_tag="mCG_146185"
FT                   /product="mCG146185"
FT                   /note="gene_id=mCG146185.0 transcript_id=mCT186288.0
FT                   protein_id=mCP107516.0"
FT                   /protein_id="EDL15569.1"
FT                   /translation="VFPSMEGLRIESVSCLLPSLVSSFWGLASWSSKEGLLLPSSTSFC
FT                   EPCSCSRTAYPMGSIMAVVAVLLIHMERKAVTNMKPRSSLEPNRQTHCHSSCLPDIGCP
FT                   FVPPTWLARTHRAGRTPMIRSTPRAMRLCRFQCSTAMATIRPPTNNMLVSLKYSKQTWG
FT                   RAGMCLRLWGLLLIPPSLWGTVMTSLQIGIPLGPQNQMEMAFGPPTVDRSQVACSS"
FT   gene            142287..148555
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /note="gene_id=mCG1602.1"
FT   mRNA            join(142287..142617,142963..143815,145237..145320,
FT                   147307..147463,147983..148555)
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /product="DNA segment, Chr 11, ERATO Doi 18, expressed,
FT                   transcript variant mCT8427"
FT                   /note="gene_id=mCG1602.1 transcript_id=mCT8427.1 created on
FT                   04-MAR-2003"
FT   mRNA            join(142362..142617,145237..145320,147307..147463,
FT                   147983..148234)
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /product="DNA segment, Chr 11, ERATO Doi 18, expressed,
FT                   transcript variant mCT180864"
FT                   /note="gene_id=mCG1602.1 transcript_id=mCT180864.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(142390..142617,142963..143815,145237..145320,
FT                   147307..147463,147983..148040)
FT                   /codon_start=1
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /product="DNA segment, Chr 11, ERATO Doi 18, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1602.1 transcript_id=mCT8427.1
FT                   protein_id=mCP13499.2 isoform=CRA_b"
FT                   /protein_id="EDL15573.1"
FT                   /translation="MEGRVSSVGSPHSFLNAPVLFRGPVEPLVFLANFALVLQGPLTTQ
FT                   YLWHRFSTELGYNGTRHRENCGNQSADPLMKEVETLTSHWTLYMNVGGFLVGLFWSTLL
FT                   GAWSDRVGRRPLLVLASLGLLLQAVVSIFVVQLELHVGFFVLGRALCALLGDFNGLLAA
FT                   SFASVADVSSNHSRTFRMALLEACIGVAGTLASLLGGHWLRAQGYANPFWLALALLIVM
FT                   ALYAAFCFGETVKEPKSTRLFTLRHHRSIARLYVVPAPEKSRMHLALYSLAIFVVVTVH
FT                   FGAQDILTLYELSAPLCWDSKLIGYGSAAQHLPYLTSLLGLRLLQFCLADTWVAEIGLA
FT                   FNILGMVVFAFATITPLMFTGYGLLFLSLVTTPVIRAKLSKLVSESEQGALFSAVACVN
FT                   SLAMLMASGIFNSIYPATLNFMKGFPFLLGAGLLFIPAILIGVLEKVNPHPEFQQFPQS
FT                   P"
FT   CDS             join(142390..142617,145237..145305)
FT                   /codon_start=1
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /product="DNA segment, Chr 11, ERATO Doi 18, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1602.1 transcript_id=mCT180864.0
FT                   protein_id=mCP103786.0 isoform=CRA_a"
FT                   /db_xref="MGI:MGI:1098733"
FT                   /db_xref="UniProtKB/TrEMBL:F6QD87"
FT                   /protein_id="EDL15572.1"
FT                   /translation="MEGRVSSVGSPHSFLNAPVLFRGPVEPLVFLANFALVLQGPLTTQ
FT                   YLWHRFSTELGYNGTRHRENCGNQSADPLMKGTDCSSCHWSRRLSSGPSFPSW"
FT   gene            complement(149905..174213)
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /note="gene_id=mCG1598.2"
FT   mRNA            complement(join(149905..151644,151819..151940,
FT                   159767..159956,160044..160146,163833..164068,
FT                   164174..164265,164526..164738,167177..167795,
FT                   173598..174213))
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /product="RIKEN cDNA A830091I15, transcript variant
FT                   mCT8425"
FT                   /note="gene_id=mCG1598.2 transcript_id=mCT8425.2 created on
FT                   01-OCT-2002"
FT   mRNA            complement(join(151497..151644,151819..151940,
FT                   159767..159956,160044..160266,163833..164068,
FT                   164174..164265,164526..164738,167177..167795,
FT                   173598..>174067))
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /product="RIKEN cDNA A830091I15, transcript variant
FT                   mCT191005"
FT                   /note="gene_id=mCG1598.2 transcript_id=mCT191005.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(151515..151644,151819..151940,
FT                   159767..159956,160044..160146,163833..164068,
FT                   164174..164265,164526..164738,167177..167795,
FT                   173598..174067))
FT                   /codon_start=1
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /product="RIKEN cDNA A830091I15, isoform CRA_b"
FT                   /note="gene_id=mCG1598.2 transcript_id=mCT8425.2
FT                   protein_id=mCP13437.2 isoform=CRA_b"
FT                   /protein_id="EDL15575.1"
FT                   /translation="MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAA
FT                   GGRGSREVSPGVGTEVQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVEEAWL
FT                   LPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARI
FT                   GLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPAL
FT                   LRHCALALANCALHGGQTVQRCMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNK
FT                   EVEREVEHSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQSLVLLLDSSRLE
FT                   AQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTTSALAKRALRLLGE
FT                   EVPRRILPCVASWKEAEVQTWLQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMK
FT                   SSITRKRFFRELTELKTFASYATCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHR
FT                   VSEQQLLEDCGIRLGVHRTRILSAAREMLHSPLPCTGGKLSGDTPDVFISYRRNSGSQL
FT                   ASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVIAARNFVLVLSAGALDKCMQDHDC
FT                   KDWVHKEIVTALSCGKNIVPIIDGFEWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEK
FT                   IIRFLQGRPSQDSSAGSDTSLEGATPMGLP"
FT   CDS             complement(join(151515..151644,151819..151940,
FT                   159767..159956,160044..160266,163833..164068,
FT                   164174..164265,164526..164738,167177..167795,
FT                   173598..174067))
FT                   /codon_start=1
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /product="RIKEN cDNA A830091I15, isoform CRA_a"
FT                   /note="gene_id=mCG1598.2 transcript_id=mCT191005.0
FT                   protein_id=mCP111973.0 isoform=CRA_a"
FT                   /protein_id="EDL15574.1"
FT                   /translation="MVLTLLFSAYKLCRFFTMSGPRPGADRLTVPGPDRSGGASPWWAA
FT                   GGRGSREVSPGVGTEVQGALERSLPELQQALSELKQASAARAVGAGLAEVFQLVEEAWL
FT                   LPAVGREVAQGLCDAIRLDGGLDLLLRLLQAPELETRVQAARLLEQILVAENRDRVARI
FT                   GLGVILNLAKEREPVELARSVAGILEHMFKHSEETCQRLVAAGGLDAVLYWCRRTDPAL
FT                   LRHCALALANCALHGGQTVQRCMVEKRAAEWLFPLAFSKEDELLRLHACLAVAVLATNK
FT                   EVEREVEHSGTLALVEPLVASLDPGRFARCLVDASDTSQGRGPDDLQSLVLLLDSSRLE
FT                   AQCIGAFYLCAEAAIKSLQGKTKVFSDIGAIQSLKRLVSYSTNGTTSALAKRALRLLGE
FT                   EVPRRILPCVASWKEAEVQTWLQQIGFSQYCENFREQQVDGDLLLRLTDEELQTDLGMK
FT                   SSITRKRFFRELTELKTFASYATCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHR
FT                   VSEQQLLEDCGIRLGVHRTRILSAARGHFAQTGLRSLRRPSLHDDGPRDKQWGRATLTS
FT                   MSLSLAPEMLHSPLPCTGGKLSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDV
FT                   EKLEAGKFEDKLIQSVIAARNFVLVLSAGALDKCMQDHDCKDWVHKEIVTALSCGKNIV
FT                   PIIDGFEWPEPQALPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGRPSQDSSAGSDT
FT                   SLEGATPMGLP"
FT   gene            152495..218329
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /note="gene_id=mCG1603.2"
FT   mRNA            join(152495..152540,213053..213185,215443..215571,
FT                   216569..216654,217504..217607,217970..218329)
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), transcript variant mCT8429"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT8429.2 created on
FT                   22-JUL-2002"
FT   mRNA            join(152495..152540,213085..213185,215119..215347,
FT                   215443..215571,216569..216654,217504..217607,
FT                   217970..218329)
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), transcript variant mCT170953"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170953.0 created
FT                   on 22-JUL-2002"
FT   mRNA            join(152495..152540,213109..213185,215443..215571,
FT                   216569..216654,217504..217811)
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), transcript variant mCT170954"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170954.0 created
FT                   on 22-JUL-2002"
FT   gene            175895..178932
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /note="gene_id=mCG1595.1"
FT   mRNA            join(175895..176022,176112..176231,176310..176651,
FT                   176731..176870,177038..177194,177304..177456,
FT                   178183..178533,178747..178932)
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, transcript variant mCT8421"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT8421.1 created on
FT                   22-JUL-2002"
FT   mRNA            join(175896..175972,176112..176231,176310..176651,
FT                   176731..176777,176823..176870,177038..177194,
FT                   177304..177456,178183..178533,178747..178929)
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, transcript variant mCT170944"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170944.0 created
FT                   on 22-JUL-2002"
FT   mRNA            join(175900..176022,176112..176217,176310..176651,
FT                   176731..176870,177038..>177093)
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, transcript variant mCT170945"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170945.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(175959..176022,176112..176231,176310..176651,
FT                   176731..176870,177038..177194,177304..177456,
FT                   178183..178533,178747..178856)
FT                   /codon_start=1
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, isoform CRA_c"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT8421.1
FT                   protein_id=mCP13421.1 isoform=CRA_c"
FT                   /db_xref="GOA:P29788"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001212"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR020436"
FT                   /db_xref="MGI:MGI:98940"
FT                   /db_xref="UniProtKB/Swiss-Prot:P29788"
FT                   /protein_id="EDL15582.1"
FT                   /translation="MAPLRPFFILALVAWVSLADQESCKGRCTQGFMASKKCQCDELCT
FT                   YYQSCCADYMEQCKPQVTRGDVFTMPEDDYWSYDYVEEPKNNTNTGVQPENTSPPGDLN
FT                   PRTDGTLKPTAFLDPEEQPSTPAPKVEQQEEILRPDTTDQGTPEFPEEELCSGKPFDAF
FT                   TDLKNGSLFAFRGQYCYELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFK
FT                   GSQYWRFEDGVLDPGYPRNISEGFSGIPDNVDAAFALPAHRYSGRERVYFFKGKQYWEY
FT                   EFQQQPSQEECEGSSLSAVFEHFALLQRDSWENIFELLFWGRSSDGAREPQFISRNWHG
FT                   VPGKVDAAMAGRIYVTGSLSHSAQAKKQKSKRRSRKRYRSRRGRGHRRSQSSNSRRSSR
FT                   SIWFSLFSSEESGLGTYNNYDYDMDWLVPATCEPIQSVYFFSGDKYYRVNLRTRRVDSV
FT                   NPPYPRSIAQYWLGCPTSEK"
FT   CDS             join(176144..176231,176310..176651,176731..176777,
FT                   176823..176870,177038..177194,177304..177456,
FT                   178183..178533,178747..178856)
FT                   /codon_start=1
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, isoform CRA_a"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170944.0
FT                   protein_id=mCP93863.0 isoform=CRA_a"
FT                   /protein_id="EDL15580.1"
FT                   /translation="MASKKCQCDELCTYYQSCCADYMEQCKPQVTRGDVFTMPEDDYWS
FT                   YDYVEEPKNNTNTGVQPENTSPPGDLNPRTDGTLKPTAFLDPEEQPSTPAPKVEQQEEI
FT                   LRPDTTDQGTPEFPEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDETAVRPGYAAFT
FT                   RINCQGKTYLFKGSQYWRFEDGVLDPGYPRNISEGFSGIPDNVDAAFALPAHRYSGRER
FT                   VYFFKGKQYWEYEFQQQPSQEECEGSSLSAVFEHFALLQRDSWENIFELLFWGRSSDGA
FT                   REPQFISRNWHGVPGKVDAAMAGRIYVTGSLSHSAQAKKQKSKRRSRKRYRSRRGRGHR
FT                   RSQSSNSRRSSRSIWFSLFSSEESGLGTYNNYDYDMDWLVPATCEPIQSVYFFSGDKYY
FT                   RVNLRTRRVDSVNPPYPRSIAQYWLGCPTSEK"
FT   CDS             join(176333..176651,176731..176870,177038..>177093)
FT                   /codon_start=1
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, isoform CRA_b"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170945.0
FT                   protein_id=mCP93862.0 isoform=CRA_b"
FT                   /protein_id="EDL15581.1"
FT                   /translation="MPEDDYWSYDYVEEPKNNTNTGVQPENTSPPGDLNPRTDGTLKPT
FT                   AFLDPEEQPSTPAPKVEQQEEILRPDTTDQGTPEFPEEELCSGKPFDAFTDLKNGSLFA
FT                   FRGQYCYELDETAVRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDG
FT                   VLDPGYPR"
FT   mRNA            join(177064..177194,177304..177451,178277..178533,
FT                   178747..178866)
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, transcript variant mCT170943"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170943.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(177126..177194,177304..177451,178277..178446)
FT                   /codon_start=1
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, isoform CRA_d"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170943.0
FT                   protein_id=mCP93861.0 isoform=CRA_d"
FT                   /protein_id="EDL15583.1"
FT                   /translation="MLMQRSPFLPTVTVAGKGSTSSRGSSTGSTNFSSNPARRSAKAAL
FT                   CQPCLSTLPCFSGTAGRTFSNSSSGADPPYPTLPKPKNRSLSVEAESAIVHAEGVATDA
FT                   ARARTPVVHHVQSGSLCSPARRVG"
FT   gene            180099..181124
FT                   /gene="Og9x"
FT                   /locus_tag="mCG_1590"
FT                   /note="gene_id=mCG1590.1"
FT   mRNA            join(180099..180186,180348..180508,180632..181124)
FT                   /gene="Og9x"
FT                   /locus_tag="mCG_1590"
FT                   /product="OG9 homeobox gene"
FT                   /note="gene_id=mCG1590.1 transcript_id=mCT8416.1 created on
FT                   03-JAN-2003"
FT   CDS             join(180159..180186,180348..180508,180632..181015)
FT                   /codon_start=1
FT                   /gene="Og9x"
FT                   /locus_tag="mCG_1590"
FT                   /product="OG9 homeobox gene"
FT                   /note="gene_id=mCG1590.1 transcript_id=mCT8416.1
FT                   protein_id=mCP13408.0"
FT                   /protein_id="EDL15584.1"
FT                   /translation="MASPVEASPGCASGLGPHRRKRTTFSVGQLVELERVFAARPYPDI
FT                   STREHLAQVTHLPEAKIQVWFQNRRAKRIKDRKPGALNSRLELPPNSCSLPDTPQLPWD
FT                   PGTSSHPLHPTSSAQYTSACPPQTSCLGPILGPGQSWSGAKVAAPWGTSGASGIHSSLE
FT                   QIVPQTSLGNLSDLIYTSAIVTNVDHF"
FT   gene            complement(183632..188738)
FT                   /gene="AI316787"
FT                   /locus_tag="mCG_1604"
FT                   /note="gene_id=mCG1604.1"
FT   mRNA            complement(join(183632..184414,184928..185040,
FT                   185262..185304,186334..186423,186957..187030,
FT                   188506..188738))
FT                   /gene="AI316787"
FT                   /locus_tag="mCG_1604"
FT                   /product="expressed sequence AI316787"
FT                   /note="gene_id=mCG1604.1 transcript_id=mCT8430.1 created on
FT                   01-OCT-2002"
FT   CDS             complement(join(184319..184414,184928..185040,
FT                   185262..185304,186334..186423,186957..187030,
FT                   188506..188716))
FT                   /codon_start=1
FT                   /gene="AI316787"
FT                   /locus_tag="mCG_1604"
FT                   /product="expressed sequence AI316787"
FT                   /note="gene_id=mCG1604.1 transcript_id=mCT8430.1
FT                   protein_id=mCP13393.1"
FT                   /db_xref="GOA:B2RV69"
FT                   /db_xref="InterPro:IPR021013"
FT                   /db_xref="MGI:MGI:2144113"
FT                   /db_xref="UniProtKB/TrEMBL:B2RV69"
FT                   /protein_id="EDL15585.1"
FT                   /translation="MASSLLAGERLVRALGPGGELEREQLPRKLRAQLEAALGKKHAGS
FT                   DNATGPRRLVSFRLIRDLHQHLRERNSRLYLHELLEGSDIYFPEIVKPPRNPELVARLE
FT                   KIKIQLANEEYKRITRNVTCQDAQCGGTLSDLGKQVRSVKALVVTIFNFIITVAAAFVC
FT                   TYLGSQYVFTEMASRVLAALIVASVVGLAELYVMVRAMEGELGEL"
FT   gene            188855..198978
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /note="gene_id=mCG1592.2"
FT   mRNA            join(188855..189081,190529..190610,191697..191794,
FT                   193428..193524,194162..194237,194434..194541,
FT                   194682..194818,195562..195588,195789..195914,
FT                   197761..197840,198403..198978)
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /product="polymerase (DNA-directed), delta interacting
FT                   protein 2, transcript variant mCT8418"
FT                   /note="gene_id=mCG1592.2 transcript_id=mCT8418.2 created on
FT                   22-JUL-2002"
FT   CDS             join(188921..189081,190529..190610,191697..191794,
FT                   193428..193524,194162..194237,194434..194541,
FT                   194682..194818,195562..195588,195789..195914,
FT                   197761..197840,198403..198517)
FT                   /codon_start=1
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /product="polymerase (DNA-directed), delta interacting
FT                   protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG1592.2 transcript_id=mCT8418.2
FT                   protein_id=mCP13413.1 isoform=CRA_a"
FT                   /protein_id="EDL15586.1"
FT                   /translation="MAGCVARRALAVGSRWWSRSLATTRGSRPLCAVGGAGGLPPVATA
FT                   TTRRHLSSRNRAEGKVLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYD
FT                   RDVASATPEKAENPAGHGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDD
FT                   SRALYAIPGLDYVSHEDILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQE
FT                   KNHPWLELSDVHRETTENIRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRE
FT                   RHWRIFSLSGTLETVRGRGVVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPD
FT                   GSHFDVRIPPFSLESNKDEKTPPSGLHW"
FT   mRNA            join(193502..193524,194162..194237,194434..194541,
FT                   194682..194818,195771..195833)
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /product="polymerase (DNA-directed), delta interacting
FT                   protein 2, transcript variant mCT170948"
FT                   /note="gene_id=mCG1592.2 transcript_id=mCT170948.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(194205..194237,194434..194541,194682..194744)
FT                   /codon_start=1
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /product="polymerase (DNA-directed), delta interacting
FT                   protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG1592.2 transcript_id=mCT170948.0
FT                   protein_id=mCP93866.0 isoform=CRA_b"
FT                   /protein_id="EDL15587.1"
FT                   /translation="MMTAGRSMLSQGWTMSAMKTSSPTPPRIRFPFNTSSLKDFFCMTR
FT                   QKHLLLWLEKRCGPGKRRITRG"
FT   gene            complement(199515..212809)
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /note="gene_id=mCG1605.1"
FT   mRNA            complement(join(199515..202150,204135..204330,
FT                   204860..204912,204999..205088,205679..205848,
FT                   206637..206956,212682..212809))
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), transcript variant mCT8431"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT8431.1 created on
FT                   22-JUL-2002"
FT   mRNA            complement(join(200279..200418,206716..206956,
FT                   212695..212742))
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), transcript variant mCT170955"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT170955.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(200398..200418,206716..206841))
FT                   /codon_start=1
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), isoform CRA_c"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT170955.0
FT                   protein_id=mCP93873.0 isoform=CRA_c"
FT                   /protein_id="EDL15590.1"
FT                   /translation="MSGDTCLCPASGAKPKISGFKGGGLGNKYVQLNVGGSLYYTTIIS
FT                   CIP"
FT   mRNA            complement(join(200938..202150,204135..204330,
FT                   204860..204912,204999..205088,205679..205848,
FT                   206637..206956,212695..>212718))
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), transcript variant mCT191054"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT191054.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(201914..202150,204135..204330,
FT                   204860..204912,204999..205088,205679..205848,
FT                   206637..>206949))
FT                   /codon_start=1
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), isoform CRA_a"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT191054.0
FT                   protein_id=mCP112006.0 isoform=CRA_a"
FT                   /protein_id="EDL15588.1"
FT                   /translation="EYEALASEGHSLVITSTTAEPSKPTSCRVVIYLQREMSGDTCLCP
FT                   ASGAKPKISGFKGGGLGNKYVQLNVGGSLYYTTVRALTRHDTMLKAMFSGRMEVLTDKE
FT                   GWILIDRCGKHFGTILNYLRDDTITLPQSRQEIQELMAEAKYYLIQGLVSTCQTALQDK
FT                   KDSYQPVCNIPIITSLREEDRLIESSTKPVVKLLYNRSNNKYSYTSNSDDHLLKNIELF
FT                   DKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKLAEVCCTSIVYATEKKQTKVEFPEAR
FT                   IYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEDTFELRDRVRRIHVKRYSTYD
FT                   DRQLGHQSTHRD"
FT   CDS             complement(join(201914..202150,204135..204330,
FT                   204860..204912,204999..205088,205679..205848,
FT                   206637..206841))
FT                   /codon_start=1
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), isoform CRA_b"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT8431.1
FT                   protein_id=mCP13390.1 isoform=CRA_b"
FT                   /protein_id="EDL15589.1"
FT                   /translation="MSGDTCLCPASGAKPKISGFKGGGLGNKYVQLNVGGSLYYTTVRA
FT                   LTRHDTMLKAMFSGRMEVLTDKEGWILIDRCGKHFGTILNYLRDDTITLPQSRQEIQEL
FT                   MAEAKYYLIQGLVSTCQTALQDKKDSYQPVCNIPIITSLREEDRLIESSTKPVVKLLYN
FT                   RSNNKYSYTSNSDDHLLKNIELFDKLSLRFNGRVLFIKDVIGDEICCWSFYGQGRKLAE
FT                   VCCTSIVYATEKKQTKVEFPEARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSE
FT                   DEDTFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD"
FT   mRNA            join(213003..213185,216622..216654,217504..217607,
FT                   217970..218326)
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), transcript variant mCT170952"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170952.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(215445..215571,216569..216654,217504..217607,
FT                   217970..218051)
FT                   /codon_start=1
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170953.0
FT                   protein_id=mCP93872.0 isoform=CRA_a"
FT                   /protein_id="EDL15576.1"
FT                   /translation="MAKDILGEAGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIG
FT                   QFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKTQL
FT                   ERYRVEYEALCKVEAEQNEFIDQFIFQK"
FT   CDS             join(215445..215571,216569..216654,217504..217607,
FT                   217970..218051)
FT                   /codon_start=1
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT8429.2
FT                   protein_id=mCP13366.1 isoform=CRA_a"
FT                   /protein_id="EDL15579.1"
FT                   /translation="MAKDILGEAGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIG
FT                   QFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKTQL
FT                   ERYRVEYEALCKVEAEQNEFIDQFIFQK"
FT   CDS             join(215445..215571,216569..216654,217504..217611)
FT                   /codon_start=1
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), isoform CRA_b"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170954.0
FT                   protein_id=mCP93870.0 isoform=CRA_b"
FT                   /protein_id="EDL15577.1"
FT                   /translation="MAKDILGEAGLHFDELNKLRVLDPEVTQQTVELKEECKDFVDKIG
FT                   QFQKIVGGLIELVDQLAKEAENEKMKAIGARNLLKSIAKQREAQQQQLQALIAEKKTQL
FT                   ER"
FT   CDS             join(216649..216654,217504..217607,217970..218051)
FT                   /codon_start=1
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), isoform CRA_c"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170952.0
FT                   protein_id=mCP93871.0 isoform=CRA_c"
FT                   /protein_id="EDL15578.1"
FT                   /translation="MKAIGARNLLKSIAKQREAQQQQLQALIAEKKTQLERYRVEYEAL
FT                   CKVEAEQNEFIDQFIFQK"
FT   gene            complement(218426..227343)
FT                   /locus_tag="mCG_1594"
FT                   /note="gene_id=mCG1594.1"
FT   mRNA            complement(join(218426..219405,220095..220239,
FT                   227137..227343))
FT                   /locus_tag="mCG_1594"
FT                   /product="mCG1594"
FT                   /note="gene_id=mCG1594.1 transcript_id=mCT8420.1 created on
FT                   03-JAN-2003"
FT   CDS             complement(join(219146..219405,220095..220239,
FT                   227137..227262))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1594"
FT                   /product="mCG1594"
FT                   /note="gene_id=mCG1594.1 transcript_id=mCT8420.1
FT                   protein_id=mCP13428.1"
FT                   /protein_id="EDL15591.1"
FT                   /translation="MGALAARRCVEWLLGLYFVSHIPITLFIDLQAVLPPELYPQEFSN
FT                   LLRWYSKEFKDPLMQEPPVWFKSFLLCELVFQLPFFPIAAYAFFKGSCRWIRIPAIIYA
FT                   AHTITTLIPILYTLLFEDFSKAVAFKGQRPESFRERLTLVGVYAPYLIIPLILLLFMLR
FT                   NPYYKYEEKRKKK"
FT   gene            complement(244797..373538)
FT                   /gene="Nlk"
FT                   /locus_tag="mCG_1601"
FT                   /note="gene_id=mCG1601.1"
FT   mRNA            complement(join(244797..245582,248078..248171,
FT                   248840..249038,251448..251534,259935..260036,
FT                   263481..263690,265917..266002,267495..267601,
FT                   294887..294942,303189..303318,372856..373538))
FT                   /gene="Nlk"
FT                   /locus_tag="mCG_1601"
FT                   /product="nemo like kinase"
FT                   /note="gene_id=mCG1601.1 transcript_id=mCT8428.1 created on
FT                   22-JUL-2002"
FT   CDS             complement(join(245528..245582,248078..248171,
FT                   248840..249038,251448..251534,259935..260036,
FT                   263481..263690,265917..266002,267495..267601,
FT                   294887..294942,303189..303318,372856..373277))
FT                   /codon_start=1
FT                   /gene="Nlk"
FT                   /locus_tag="mCG_1601"
FT                   /product="nemo like kinase"
FT                   /note="gene_id=mCG1601.1 transcript_id=mCT8428.1
FT                   protein_id=mCP13497.1"
FT                   /protein_id="EDL15592.1"
FT                   /translation="MAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGS
FT                   AAAVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAA
FT                   AAATVKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQN
FT                   LVSCKRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQ
FT                   PLSSDHVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDE
FT                   SRHMTQEVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDL
FT                   ITDLLGTPSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFD
FT                   PSKRISAKDALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKN
FT                   LSSVRQVKEIIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE"
FT   gene            complement(385955..386921)
FT                   /pseudo
FT                   /locus_tag="mCG_54303"
FT                   /note="gene_id=mCG54303.2"
FT   mRNA            complement(join(385955..386366,386534..386921))
FT                   /pseudo
FT                   /locus_tag="mCG_54303"
FT                   /note="gene_id=mCG54303.2 transcript_id=mCT54486.2 created
FT                   on 01-OCT-2002"
FT   gene            complement(427662..428867)
FT                   /gene="1810009O10Rik"
FT                   /locus_tag="mCG_48761"
FT                   /note="gene_id=mCG48761.2"
FT   mRNA            complement(427662..428867)
FT                   /gene="1810009O10Rik"
FT                   /locus_tag="mCG_48761"
FT                   /product="RIKEN cDNA 1810009O10"
FT                   /note="gene_id=mCG48761.2 transcript_id=mCT48944.2 created
FT                   on 27-AUG-2002"
FT   CDS             complement(428065..428817)
FT                   /codon_start=1
FT                   /gene="1810009O10Rik"
FT                   /locus_tag="mCG_48761"
FT                   /product="RIKEN cDNA 1810009O10"
FT                   /note="gene_id=mCG48761.2 transcript_id=mCT48944.2
FT                   protein_id=mCP34768.1"
FT                   /protein_id="EDL15593.1"
FT                   /translation="MEAVRPDSCESGPAAPRAEERPAPEARVHFRVTRFIMEAGVKLGM
FT                   QSIPIATACTIYHKFFCEINLDAYDLYLVAMSSIYLAGKVEEQHLRTRDIINVSHRYFN
FT                   PGSEPLELDSRFWELRDSIVQCELLMLRVLRFQVSFQHPHKYLLHYLISLKNWLNRYSW
FT                   QRTPISVTAWALLRDSYHGGLCLRFQAQHLAVAVLYLALQVYGVEVPAEGEAEKPWWQV
FT                   FSDDLTKPIIDNIVSDLIQIYTMDTEIP"
FT   gene            503507..516367
FT                   /locus_tag="mCG_51870"
FT                   /note="gene_id=mCG51870.1"
FT   mRNA            join(503507..503532,512914..513054,514986..515078,
FT                   516019..516367)
FT                   /locus_tag="mCG_51870"
FT                   /product="mCG51870"
FT                   /note="gene_id=mCG51870.1 transcript_id=mCT52053.1 created
FT                   on 27-AUG-2002"
FT   CDS             join(512929..513054,514986..515078,516019..516036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51870"
FT                   /product="mCG51870"
FT                   /note="gene_id=mCG51870.1 transcript_id=mCT52053.1
FT                   protein_id=mCP34766.2"
FT                   /protein_id="EDL15594.1"
FT                   /translation="MAPLPGAELVQTPLQLYRYLLRCCRQLPTKGIQEHYKHAVRQSFQ
FT                   VHSDEDNSERIQQIIKRAIEDADWIMNKYRKQN"
FT   gene            522035..523319
FT                   /locus_tag="mCG_1032048"
FT                   /note="gene_id=mCG1032048.1"
FT   mRNA            join(522035..522497,522725..522762,523021..523319)
FT                   /locus_tag="mCG_1032048"
FT                   /product="mCG1032048"
FT                   /note="gene_id=mCG1032048.1 transcript_id=mCT149752.1
FT                   created on 01-OCT-2002"
FT   CDS             join(522263..522497,522725..522753)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032048"
FT                   /product="mCG1032048"
FT                   /note="gene_id=mCG1032048.1 transcript_id=mCT149752.1
FT                   protein_id=mCP85338.1"
FT                   /protein_id="EDL15595.1"
FT                   /translation="MRQLDLLRAGEKRRERAGKPERGVGSLGESGRFLYSGDRWRFGGS
FT                   EVISLKVKNPPFSLFFFFCLFVFRDRVSLYSPGCQPGLQIKF"
FT   gene            complement(553600..554053)
FT                   /pseudo
FT                   /locus_tag="mCG_66850"
FT                   /note="gene_id=mCG66850.2"
FT   mRNA            complement(553600..554053)
FT                   /pseudo
FT                   /locus_tag="mCG_66850"
FT                   /note="gene_id=mCG66850.2 transcript_id=mCT67033.2 created
FT                   on 01-OCT-2002"
FT   gene            597728..637417
FT                   /gene="Nos2"
FT                   /locus_tag="mCG_1599"
FT                   /note="gene_id=mCG1599.2"
FT   mRNA            join(597728..597865,599092..599247,605444..605513,
FT                   606621..606740,608450..608598,612222..612384,
FT                   613273..613364,614431..614572,614670..614809,
FT                   616849..617023,617118..617219,621530..621724,
FT                   622102..622184,622509..622653,622739..622843,
FT                   624717..624766,625083..625257,625953..626085,
FT                   626484..626562,626826..627007,627965..628128,
FT                   629673..629880,631765..631852,632210..632331,
FT                   633366..633514,634280..634474,636524..636651,
FT                   637034..637417)
FT                   /gene="Nos2"
FT                   /locus_tag="mCG_1599"
FT                   /product="nitric oxide synthase 2, inducible, macrophage"
FT                   /note="gene_id=mCG1599.2 transcript_id=mCT8426.2 created on
FT                   25-NOV-2002"
FT   CDS             join(599138..599247,605444..605513,606621..606740,
FT                   608450..608598,612222..612384,613273..613364,
FT                   614431..614572,614670..614809,616849..617023,
FT                   617118..617219,621530..621724,622102..622184,
FT                   622509..622653,622739..622843,624717..624766,
FT                   625083..625257,625953..626085,626484..626562,
FT                   626826..627007,627965..628128,629673..629880,
FT                   631765..631852,632210..632331,633366..633514,
FT                   634280..634474,636524..636622)
FT                   /codon_start=1
FT                   /gene="Nos2"
FT                   /locus_tag="mCG_1599"
FT                   /product="nitric oxide synthase 2, inducible, macrophage"
FT                   /note="gene_id=mCG1599.2 transcript_id=mCT8426.2
FT                   protein_id=mCP13443.2"
FT                   /protein_id="EDL15596.1"
FT                   /translation="MACPWKFLFKVKSYQSDLKEEKDINNNVKKTPCAVLSPTIQDDPK
FT                   SHQNGSPQLLTGTAQNVPESLDKLHVTSTRPQYVRIKNWGSGEILHDTLHHKATSDFTC
FT                   KSKSCLGSIMNPKSLTRGPRDKPTPLEELLPHAIEFINQYYGSFKEAKIEEHLARLEAV
FT                   TKEIETTGTYQLTLDELIFATKMAWRNAPRCIGRIQWSNLQVFDARNCSTAQEMFQHIC
FT                   RHILYATNNGNIRSAITVFPQRSDGKHDFRLWNSQLIRYAGYQMPDGTIRGDAATLEFT
FT                   QLCIDLGWKPRYGRFDVLPLVLQADGQDPEVFEIPPDLVLEVTMEHPKYEWFQELGLKW
FT                   YALPAVANMLLEVGGLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHT
FT                   LASLWKDRAVTEINVAVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWL
FT                   VPPVSGSITPVFHQEMLNYVLSPFYYYQIEPWKTHIWQNEKLRPRRREIRFRVLVKVVF
FT                   FASMLMRKVMASRVRATVLFATETGKSEALARDLATLFSYAFNTKVVCMDQYKASTLEE
FT                   EQLLLVVTSTFGNGDCPSNGQTLKKSLFMLRELNHTFRYAVFGLGSSMYPQFCAFAHDI
FT                   DQKLSHLGASQLAPTGEGDELSGQEDAFRSWAVQTFRAACETFDVRSKHHIQIPKRFTS
FT                   NATWEPQQYRLIQSPEPLDLNRALSSIHAKNVFTMRLKSQQNLQSEKSSRTTLLVQLTF
FT                   EGSRGPSYLPGEHLGIFPGNQTALVQGILERVVDCPTPHQTVCLEVLDESGSYWVKDKR
FT                   LPPCSLSQALTYFLDITTPPTQLQLHKLARFATDETDRQRLEALCQPSEYNDWKFSNNP
FT                   TFLEVLEEFPSLHVPAAFLLSQLPILKPRYYSISSSQDHTPSEVHLTVAVVTYRTRDGQ
FT                   GPLHHGVCSTWIRNLKPQDPVPCFVRSVSGFQLPEDPSQPCILIGPGTGIAPFRSFWQQ
FT                   RLHDSQHKGLKGGRMSLVFGCRHPEEDHLYQEEMQEMVRKRVLFQVHTGYSRLPGKPKV
FT                   YVQDILQKQLANEVLSVLHGEQGHLYICGDVRMARDVATTLKKLVATKLNLSEEQVEDY
FT                   FFQLKSQKRYHEDIFGAVFSYGAKKGSALEEPKATRL"
FT   gene            complement(640540..662437)
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /note="gene_id=mCG1597.2"
FT   mRNA            complement(join(640540..640887,643328..643415,
FT                   643559..643647,644438..644479))
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, transcript
FT                   variant mCT170950"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170950.0 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(640551..641102,643253..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,648878..648988,650549..650750,
FT                   654174..654262,662339..662430))
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, transcript
FT                   variant mCT170949"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170949.0 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(640551..641102,643253..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,647275..647367,648878..648988,
FT                   650549..650750,654174..654262,662339..662392))
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, transcript
FT                   variant mCT8423"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT8423.2 created on
FT                   22-JUL-2002"
FT   CDS             complement(join(640837..640887,643328..643415,
FT                   643559..643593))
FT                   /codon_start=1
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170950.0
FT                   protein_id=mCP93869.0 isoform=CRA_a"
FT                   /protein_id="EDL15597.1"
FT                   /translation="MISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQPWHH
FT                   QKRSSLIGIPGR"
FT   mRNA            complement(join(640932..641102,643396..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,648878..648988,650549..650750,
FT                   654174..654262,662339..662437))
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, transcript
FT                   variant mCT170951"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170951.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(640956..641102,643253..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,648878..648988,650549..650750,
FT                   654174..654262,662339..662377))
FT                   /codon_start=1
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170949.0
FT                   protein_id=mCP93868.0 isoform=CRA_d"
FT                   /db_xref="GOA:O08573"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:109496"
FT                   /db_xref="PDB:2D6K"
FT                   /db_xref="PDB:2D6L"
FT                   /db_xref="PDB:2D6M"
FT                   /db_xref="PDB:2D6N"
FT                   /db_xref="PDB:2D6O"
FT                   /db_xref="PDB:2D6P"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08573"
FT                   /protein_id="EDL15600.1"
FT                   /translation="MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFV
FT                   VNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLV
FT                   QRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTT
FT                   IHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFH
FT                   INLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEG
FT                   HCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT"
FT   CDS             complement(join(640956..641102,643253..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,647275..647367,648878..648988,
FT                   650549..650750,654174..654262,662339..662377))
FT                   /codon_start=1
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT8423.2
FT                   protein_id=mCP13441.2 isoform=CRA_c"
FT                   /db_xref="GOA:G3X9T7"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:109496"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9T7"
FT                   /protein_id="EDL15599.1"
FT                   /translation="MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFV
FT                   VNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLV
FT                   QRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQNSAAPVQHVFSTVQFS
FT                   QPVQFPRTPKGRKQKTQNFRPAHQAPMAQTTIHMVHSTPGQMFSTPGIPPVVYPTPAYT
FT                   IPFYTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQI
FT                   NNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTL
FT                   EVAGDIQLTHVQT"
FT   CDS             complement(join(641086..641102,643396..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,648878..648988,650549..650750,
FT                   654174..654262,662339..662377))
FT                   /codon_start=1
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170951.0
FT                   protein_id=mCP93867.0 isoform=CRA_b"
FT                   /protein_id="EDL15598.1"
FT                   /translation="MALFSAQSPYINPIIPFTGPIQGGLQEGLQVTLQGTTKSFAQRFV
FT                   VNFQNSFNGNDIAFHFNPRFEEGGYVVCNTKQNGQWGPEERKMQMPFQKGMPFELCFLV
FT                   QRSEFKVMVNKKFFVQYQHRVPYHLVDTIAVSGCLKLSFITFQTQNFRPAHQAPMAQTT
FT                   IHMVHSTPGQMFSTPGIPPVVYPTPAYTIPFYTPIPNGLYPSKSIMISGNVLPDATRFH
FT                   INLRCVDHM"
FT   gene            complement(692355..>824292)
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /note="gene_id=mCG1593.2"
FT   mRNA            complement(join(692355..693819,697118..697251,
FT                   697911..698046,698238..698369,698943..699076,
FT                   702801..702897,704975..705357,706033..706081,
FT                   706788..706842,710977..711142,714254..714360,
FT                   714446..714507,715911..715994,718642..718702,
FT                   722606..723033,725062..725209,752111..752251,
FT                   823937..824236))
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /product="kinase suppressor of ras 1, transcript variant
FT                   mCT8419"
FT                   /note="gene_id=mCG1593.2 transcript_id=mCT8419.1 created on
FT                   01-APR-2003"
FT   CDS             complement(join(693741..693819,697118..697251,
FT                   697911..698046,698238..698369,698943..699076,
FT                   702801..702897,704975..705357,706033..706081,
FT                   706788..706842,710977..711142,714254..714360,
FT                   714446..714507,715911..715942))
FT                   /codon_start=1
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /product="kinase suppressor of ras 1, isoform CRA_b"
FT                   /note="gene_id=mCG1593.2 transcript_id=mCT8419.1
FT                   protein_id=mCP13375.1 isoform=CRA_b"
FT                   /protein_id="EDL15602.1"
FT                   /translation="MIFGVKCKHCRLKCHNKCTKEAPACRITFLPLARLRRTESVPSDI
FT                   NNPVDRAAEPHFGTLPKALTKKEHPPAMNLDSSSNPSSTTSSTPSSPAPFLTSSNPSSA
FT                   TTPPNPSPGQRDSRFSFPDISACSQAAPLSSTADSTRLDDQPKTDVLGVHEAEAEEPEA
FT                   GKSEAEDDEEDEVDDLPSSRRPWRGPISRKASQTSVYLQEWDIPFEQVELGEPIGQGRW
FT                   GRVHRGRWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHLA
FT                   IITSFCKGRTLHSFVRDPKTSLDINKTRQIAQEIIKGMGYLHAKGIVHKDLKSKNVFYD
FT                   NGKVVITDFGLFGISGVVREERRENQLKLSHDWLCYLAPEIVREMIPGRDEDQLPFSKA
FT                   ADVYAFGTVWYELQARDWPFKHQPAEALIWQIGSGEGVRRVLASVSLGKEVGEILSACW
FT                   AFDLQERPSFSLLMDMLERLPKLNRRLSHPGHFWKSADINSSKVMPRFERFGLGTLESG
FT                   NPKM"
FT   mRNA            complement(join(704265..705357,706033..706081,
FT                   706788..706842,710977..711142,714254..714360,
FT                   714446..714507,715911..715994,718642..718702,
FT                   722606..723033,725062..725209,752111..752251,
FT                   823937..>824292))
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /product="kinase suppressor of ras 1, transcript variant
FT                   mCT190998"
FT                   /note="gene_id=mCG1593.2 transcript_id=mCT190998.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(704971..705357,706033..706081,
FT                   706788..706842,710977..711142,714254..714360,
FT                   714446..714507,715911..715994,718642..718702,
FT                   722606..>722855))
FT                   /codon_start=1
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /product="kinase suppressor of ras 1, isoform CRA_a"
FT                   /note="gene_id=mCG1593.2 transcript_id=mCT190998.0
FT                   protein_id=mCP111972.0 isoform=CRA_a"
FT                   /protein_id="EDL15601.1"
FT                   /translation="GPLGLLYPLAHQRPADPPGPAQLHHAPYHTPATTARQAEATKDTP
FT                   TAKPQGLPAAPQLPHTHTEQVPRVPAGKPNRRRHPDEVKLPHGSPQLVRRDIGLSVTHR
FT                   FSTKSWLSQVCNVCQKSMIFGVKCKHCRLKCHNKCTKEAPACRITFLPLARLRRTESVP
FT                   SDINNPVDRAAEPHFGTLPKALTKKEHPPAMNLDSSSNPSSTTSSTPSSPAPFLTSSNP
FT                   SSATTPPNPSPGQRDSRFSFPDISACSQAAPLSSTADSTRLDDQPKTDVLGVHEAEAEE
FT                   PEAGKSEAEDDEEDEVDDLPSSRRPWRGPISRKASQTSVYLQEWDIPFEQVELGEPIGQ
FT                   GRWGRVHRGRWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPP
FT                   HLAIITR"
FT   gene            complement(917915..933202)
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /note="gene_id=mCG1589.2"
FT   mRNA            complement(join(917915..918990,919216..919323,
FT                   920123..920236,920512..920684,922991..923091,
FT                   924698..924829,926919..927187,929509..929677,
FT                   932881..933202))
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /product="WD repeat and SOCS box-containing 1, transcript
FT                   variant mCT8415"
FT                   /note="gene_id=mCG1589.2 transcript_id=mCT8415.1 created on
FT                   30-JUL-2002"
FT   mRNA            complement(join(917915..918990,919216..919323,
FT                   920123..920236,920512..920684,921928..922103,
FT                   922991..923091,924698..924829,926919..927187,
FT                   929509..929677,932881..933191))
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /product="WD repeat and SOCS box-containing 1, transcript
FT                   variant mCT171268"
FT                   /note="gene_id=mCG1589.2 transcript_id=mCT171268.0 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(918831..918990,919216..919323,
FT                   920123..920236,920512..920684,922991..923091,
FT                   924698..924829,926919..927187,929509..929677,
FT                   932881..932920))
FT                   /codon_start=1
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /product="WD repeat and SOCS box-containing 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1589.2 transcript_id=mCT8415.1
FT                   protein_id=mCP13496.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TFQ2"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1926139"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TFQ2"
FT                   /protein_id="EDL15604.1"
FT                   /translation="MASFPPRVNEKEIVRSRTIGELLAPAAPFDKKCGGENWTVAFAPD
FT                   GSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPPEHVI
FT                   DCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLL
FT                   LNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYSCAF
FT                   SPDCSMLCSVGASKAVFLWNMDKYTMIRKLEGHHHDVVACDFSPDGALLATASYDTRVY
FT                   VWDPHNGDLLMEFGHLFPSPTPIFAGGANDRWVRAVSFSHDGLHVASLADDKMVRFWRI
FT                   DEDCPVQVAPLSNGLCCAFSTDGSVLAAGTHDGSVYFWATPRQVPSLQHICRMSIRRVM
FT                   STQEVQKLPVPSKILAFLSYRG"
FT   CDS             complement(join(922080..922103,922991..923091,
FT                   924698..924829,926919..927187,929509..929677,
FT                   932881..932920))
FT                   /codon_start=1
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /product="WD repeat and SOCS box-containing 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1589.2 transcript_id=mCT171268.0
FT                   protein_id=mCP94187.0 isoform=CRA_a"
FT                   /protein_id="EDL15603.1"
FT                   /translation="MASFPPRVNEKEIVRSRTIGELLAPAAPFDKKCGGENWTVAFAPD
FT                   GSYFAWSQGYRIVKLVPWSQCRKNFLLHGSKNVTNSSCLKLARQNSNGGQKNKPPEHVI
FT                   DCGDIVWSLAFGSSVPEKQSRCVNIEWHRFRFGQDQLLLATGLNNGRIKIWDVYTGKLL
FT                   LNLVDHIEMVRDLTFAPDGSLLLVSASRDKTLRVWDLKDDGNMVKVLRAHQNWVYSCAF
FT                   SPDCSMLCSVGASKAVVAAILV"
FT   gene            complement(1048018..1128831)
FT                   /pseudo
FT                   /locus_tag="mCG_1600"
FT                   /note="gene_id=mCG1600.1"
FT   mRNA            complement(join(1048018..1048921,1128536..1128831))
FT                   /pseudo
FT                   /locus_tag="mCG_1600"
FT                   /note="gene_id=mCG1600.1 transcript_id=mCT8424.1 created on
FT                   01-OCT-2002"
FT   gene            1060730..1258831
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /note="gene_id=mCG119763.1"
FT   mRNA            join(1060730..1061280,1063617..1063700,1067171..1067361,
FT                   1072800..1072906,1085363..1085430,1085651..1085726,
FT                   1086343..1086500,1088445..1088618,1089004..1089126,
FT                   1089633..1089707,1095501..1095632,1102462..1102596,
FT                   1105527..1105640,1111788..1111867,1113633..1113756,
FT                   1115630..1115791,1117791..1118040,1118572..1118645,
FT                   1118834..1118917,1120712..1121152,1121543..1121682,
FT                   1121967..1122089,1122659..1122742,1123749..1123865,
FT                   1124427..1124608,1125068..1125279,1131037..1131198,
FT                   1131333..1131436,1136007..1136142,1140469..1140531,
FT                   1145953..1146111,1147009..1147106,1148671..1148817,
FT                   1150565..1150711,1153009..1153119,1212821..1213253,
FT                   1214011..1214351,1217548..1217750,1222572..1222765,
FT                   1223490..1223630,1224189..1224468,1224886..1225100,
FT                   1225692..1225753,1225892..1226006,1228212..1228352,
FT                   1231089..1231215,1232699..1232830,1233917..1234052,
FT                   1236623..1236780,1242042..1242164,1242636..1242769,
FT                   1243142..1243242,1245872..1246037,1246346..1246392,
FT                   1247453..1247669,1255476..1258830)
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /product="neurofibromatosis 1, transcript variant
FT                   mCT120940"
FT                   /note="gene_id=mCG119763.1 transcript_id=mCT120940.1
FT                   created on 01-OCT-2002"
FT   mRNA            join(<1061135..1061280,1063617..1063700,1067171..1067361,
FT                   1072800..1072906,1085363..1085430,1085651..1085726,
FT                   1086343..1086500,1088445..1088618,1089004..1089126,
FT                   1089633..1089707,1095501..1095632,1102462..1102596,
FT                   1105527..1105640,1111788..1111867,1113633..1113756,
FT                   1115630..1115791,1117791..1118040,1118572..1118645,
FT                   1118834..1118917,1120712..1121152,1121543..1121682,
FT                   1121967..1122089,1122659..1122742,1123749..1123865,
FT                   1124427..1124608,1125068..1125279,1131037..1131198,
FT                   1131333..1131436,1136007..1136142,1140469..1140531,
FT                   1145953..1146111,1147009..1147106,1148671..1148817,
FT                   1150565..1150711,1153009..1153119,1212821..1213253,
FT                   1214011..1214351,1217548..1217750,1222572..1222765,
FT                   1223490..1223630,1224189..1224468,1224886..1225100,
FT                   1225692..1225753,1225892..1226006,1226626..1226727,
FT                   1228212..1228352,1231089..1231215,1232699..1232830,
FT                   1233917..1234052,1236623..1236780,1242042..1242164,
FT                   1242639..1242769,1243142..1243242,1245872..1246014,
FT                   1246346..1246392,1247453..1247669,1255476..1258831)
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /product="neurofibromatosis 1, transcript variant
FT                   mCT191009"
FT                   /note="gene_id=mCG119763.1 transcript_id=mCT191009.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1061137..1061280,1063617..1063700,1067171..1067361,
FT                   1072800..1072906,1085363..1085430,1085651..1085726,
FT                   1086343..1086500,1088445..1088618,1089004..1089126,
FT                   1089633..1089707,1095501..1095632,1102462..1102596,
FT                   1105527..1105640,1111788..1111867,1113633..1113756,
FT                   1115630..1115791,1117791..1118040,1118572..1118645,
FT                   1118834..1118917,1120712..1121152,1121543..1121682,
FT                   1121967..1122089,1122659..1122742,1123749..1123865,
FT                   1124427..1124608,1125068..1125279,1131037..1131198,
FT                   1131333..1131436,1136007..1136142,1140469..1140531,
FT                   1145953..1146111,1147009..1147106,1148671..1148817,
FT                   1150565..1150711,1153009..1153119,1212821..1213253,
FT                   1214011..1214351,1217548..1217750,1222572..1222765,
FT                   1223490..1223630,1224189..1224468,1224886..1225100,
FT                   1225692..1225753,1225892..1226006,1226626..1226727,
FT                   1228212..1228352,1231089..1231215,1232699..1232830,
FT                   1233917..1234052,1236623..1236780,1242042..1242164,
FT                   1242639..1242769,1243142..1243242,1245872..1246014,
FT                   1246346..1246392,1247453..1247669,1255476..1255618)
FT                   /codon_start=1
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /product="neurofibromatosis 1, isoform CRA_a"
FT                   /note="gene_id=mCG119763.1 transcript_id=mCT191009.0
FT                   protein_id=mCP111962.0 isoform=CRA_a"
FT                   /protein_id="EDL15605.1"
FT                   /translation="LPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTTILKNV
FT                   NNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHFLHTC
FT                   REGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELLQYI
FT                   NVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQTDM
FT                   AECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDESNINKKLFLD
FT                   SLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP
FT                   SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIIT
FT                   NSALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFK
FT                   EKPTDLETRSYKCLLLSMVKLIHADPKLLLCNPRKQGPETQSSTAELITGLVQLVPQSH
FT                   MPEVAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEI
FT                   LKWLREILICRNKFLLKNKQADRSSCHSLYLYGVGCEMSATGNTTQMSVDHDEFLRACT
FT                   PGASLRKGRGNSSMDSTAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRH
FT                   LCEEADIRCGVDEVSVHNFLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTA
FT                   GNIEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDLSD
FT                   TDSLQEWINMTGFLCALGGVCLQQRSSSGLATYSPPMGAVSERKGSMISVMSSEGNIDS
FT                   PVSRFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQ
FT                   GQVLLSDSNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVH
FT                   AIQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDIKCLTR
FT                   DLDQASMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDENA
FT                   QTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLT
FT                   KILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVL
FT                   VTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLD
FT                   PLLRVIITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPSQL
FT                   RSVCHCLYQATCHSLLNKATVKERKENKKSVVSQRFPQNSIGAVGSAMFLRFINPAIVS
FT                   PYEAGILDKKPPPRIERGLKLMSKVLQSIANHVLFTKEEHMRPFNDFVKSNFDLARRFF
FT                   LDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDK
FT                   MATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAG
FT                   TSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKT
FT                   DFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKGSKRLIFIDCPGKL
FT                   AEHIEHEQQKLPAATLALEEDLKVFHNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLG
FT                   QSVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECEAIVQSIIHIRTRWEL
FT                   SQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQL
FT                   LETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSIELKHLCLEYMTP
FT                   WLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWGSLGQITDLLDVV
FT                   LDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKIIDKTCLSPTPTL
FT                   EQHLMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTFLVATGPLSLRASTHGLLIN
FT                   IIHSLCTCSQLHFSEETKQVLRLSLTEFSLPKFYLLFGISKVKSAAVIAFRSSYRDRSF
FT                   SPGSYERETFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQRFAFQYNPSLQP
FT                   RALVVFGCISKRVSHGQIKQIIRILSKALESCLKGPDTYNSQVLIESTVIALTKLQPLL
FT                   NKDSPLHKALFWVAVAVLQLDEVNLYSAGTALLEQNLHTLDSLRIFNDKSPEEVFMAIR
FT                   NPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGYRHPSPAIVARTVRILHTLLTLVNKH
FT                   RNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGD
FT                   PSYRTLKETQPWSSPKGSEGYLAATYPAVGQTSPRARKSMSLDMGQPSQANTKKLLGTR
FT                   KSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYEMETQRIPSSQQHPHLRKVSVSE
FT                   SNVLLDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRILYEYLAEASVVFPKVFPVVHN
FT                   LLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQYQTSYLQSFGFNGLWRFAGPF
FT                   SKQTQIPDYAELIVKFLDALIDTYLPGIDEETSEESLLTPTSPYPPALQSQLSITANLN
FT                   LSNSMTSLATSQHSPGLDKENVELSPTAGHCNSGRTRHGSASQVQKQRSAGSFKRNSIK
FT                   KIV"
FT   CDS             join(1061278..1061280,1063617..1063700,1067171..1067361,
FT                   1072800..1072906,1085363..1085430,1085651..1085726,
FT                   1086343..1086500,1088445..1088618,1089004..1089126,
FT                   1089633..1089707,1095501..1095632,1102462..1102596,
FT                   1105527..1105640,1111788..1111867,1113633..1113756,
FT                   1115630..1115791,1117791..1118040,1118572..1118645,
FT                   1118834..1118917,1120712..1121152,1121543..1121682,
FT                   1121967..1122089,1122659..1122742,1123749..1123865,
FT                   1124427..1124608,1125068..1125279,1131037..1131198,
FT                   1131333..1131436,1136007..1136142,1140469..1140531,
FT                   1145953..1146111,1147009..1147106,1148671..1148817,
FT                   1150565..1150711,1153009..1153119,1212821..1213253,
FT                   1214011..1214351,1217548..1217750,1222572..1222765,
FT                   1223490..1223630,1224189..1224468,1224886..1225100,
FT                   1225692..1225753,1225892..1226006,1228212..1228352,
FT                   1231089..1231215,1232699..1232830,1233917..1234052,
FT                   1236623..1236780,1242042..1242164,1242636..1242769,
FT                   1243142..1243242,1245872..1246037,1246346..1246392,
FT                   1247453..1247507)
FT                   /codon_start=1
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /product="neurofibromatosis 1, isoform CRA_b"
FT                   /note="gene_id=mCG119763.1 transcript_id=mCT120940.1
FT                   protein_id=mCP85382.1 isoform=CRA_b"
FT                   /protein_id="EDL15606.1"
FT                   /translation="MRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQ
FT                   LLPEICHFLHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDN
FT                   VDVHDIELLQYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDE
FT                   FTKLYQIPQTDMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVV
FT                   DESNINKKLFLDSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQS
FT                   MVVDLKNLLFNPSKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFH
FT                   YVLVNSLHRIITNSALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSL
FT                   TFKEKVTSLKFKEKPTDLETRSYKCLLLSMVKLIHADPKLLLCNPRKQGPETQSSTAEL
FT                   ITGLVQLVPQSHMPEVAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKK
FT                   LTSHQMLSSTEILKWLREILICRNKFLLKNKQADRSSCHSLYLYGVGCEMSATGNTTQM
FT                   SVDHDEFLRACTPGASLRKGRGNSSMDSTAGCSGTPPICRQAQTKLEVALYMFLWNPDT
FT                   EAVLVAMSCFRHLCEEADIRCGVDEVSVHNFLPNYNTFMEFASVSNMMSTGRAALQKRV
FT                   MALLRRIEHPTAGNIEAWEDTHAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMS
FT                   HVSGGGSIDLSDTDSLQEWINMTGFLCALGGVCLQQRSSSGLATYSPPMGAVSERKGSM
FT                   ISVMSSEGNIDSPVSRFMDRLLSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNK
FT                   LKNTISKFFDSQGQVLLSDSNTQFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNL
FT                   VRYVRVLGNMVHAIQIKTKLCQLVEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSN
FT                   QAADDDIKCLTRDLDQASMEAVVSLLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNL
FT                   LNDCSEVEDENAQTGGRKRGMSRRLASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHKD
FT                   LQTRATFMEVLTKILQQGTEFDTLAETVLADRFERLVELVTMMGDQGELPIAMALANVV
FT                   PCSQWDELARVLVTLFDSRHLLYQLLWNMFSKEVELADSMQTLFRGNSLASKIMTFCFK
FT                   VYGATYLQKLLDPLLRVIITSSDWQHVSFEVDPTRLEPSESLEENQRNLLQMTEKFFHA
FT                   IISSSSEFPSQLRSVCHCLYQATCHSLLNKATVKERKENKKSVVSQRFPQNSIGAVGSA
FT                   MFLRFINPAIVSPYEAGILDKKPPPRIERGLKLMSKVLQSIANHVLFTKEEHMRPFNDF
FT                   VKSNFDLARRFFLDIASDCPTSDAVNHSLSFISDGNVLALHRLLWNNQEKIGQYLSSNR
FT                   DHKAVGRRPFDKMATLLAYLGPPEHKPVADTHWSSLNLTSSKFEEFMTRHQVHEKEEFK
FT                   ALKTLSIFYQAGTSKAGNPIFYYVARRFKTGQINGDLLIYHVLLTLKPYYAKPYEIVVD
FT                   LTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVYIYNCNSWVREYTKYHERLLTGLKGS
FT                   KRLIFIDCPGKLAEHIEHEQQKLPAATLALEEDLKVFHNALKLAHKDTKVSIKVGSTAV
FT                   QVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQFTLTIANQGTPLTFMHQECEAIV
FT                   QSIIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIALLNLGSSDPSLRSAAYNLLCAL
FT                   TCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAANEPHLTLEFLEECISGFSKSSI
FT                   ELKHLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKLITMTINEKQMYPSIQAKIWG
FT                   SLGQITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVALASGNVKLVSSKVIGRMCKI
FT                   IDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAAHLPYLFHVVTFLVATGPL
FT                   SLRASTHGLLINIIHSLCTCSQLHFSEETKQVLRLSLTEFSLPKFYLLFGISKVKSAAV
FT                   IAFRSSYRDRSFSPGSYERETFALTSLETVTEALLEIMEACMRDIPTCKWLDQWTELAQ
FT                   RFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSKDSPLHKALFWVAVAVLQLDE
FT                   VNLYSAGTALLEQNLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNF
FT                   NFALVGHLLKGYRHPSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTV
FT                   SEEVRSRCSLKHRKSLLLTDISMENVPMDTYPIHHGDPSYRTLKETQPWSSPKGSEGYL
FT                   AATYPAVGQTSPRARKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGI
FT                   TTPPKMRRVAETDYEMAETQRIPSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLT
FT                   VLATLVKYTTDEFDQRILYEYLAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNLLNP
FT                   IHGIVQSVVYHEESPPQYQTSYLQSKYIYQERVLVLMAYGGLQDPFQSKHKSLTMLSSL
FT                   LNFLMP"
FT   gene            complement(1158978..1161266)
FT                   /locus_tag="mCG_1032050"
FT                   /note="gene_id=mCG1032050.1"
FT   mRNA            complement(join(1158978..1159648,1160620..1160800,
FT                   1160874..1160954,1161182..1161266))
FT                   /locus_tag="mCG_1032050"
FT                   /product="mCG1032050"
FT                   /note="gene_id=mCG1032050.1 transcript_id=mCT149754.1
FT                   created on 01-OCT-2002"
FT   CDS             complement(1159178..1159636)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032050"
FT                   /product="mCG1032050"
FT                   /note="gene_id=mCG1032050.1 transcript_id=mCT149754.1
FT                   protein_id=mCP85356.1"
FT                   /protein_id="EDL15607.1"
FT                   /translation="MTKHSFTVTLLLMCAHIMGTISTTIAATAATTITNTTSNSTKNLS
FT                   LGMTTTTTTTTTTTTTTSNSTRNPSPGMLSSSPRSPQAISRPSLNPGTKPSELISKSTW
FT                   QGNRSSSPCINTTAGTVAGGSTALRPVFNTHSLFLCSIFTLLYILRQK"
FT   gene            complement(1178570..1181216)
FT                   /gene="Omg"
FT                   /locus_tag="mCG_19069"
FT                   /note="gene_id=mCG19069.2"
FT   mRNA            complement(join(1178570..1180245,1181121..1181216))
FT                   /gene="Omg"
FT                   /locus_tag="mCG_19069"
FT                   /product="oligodendrocyte myelin glycoprotein"
FT                   /note="gene_id=mCG19069.2 transcript_id=mCT17422.2 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(1178917..1180245,1181121..1181123))
FT                   /codon_start=1
FT                   /gene="Omg"
FT                   /locus_tag="mCG_19069"
FT                   /product="oligodendrocyte myelin glycoprotein"
FT                   /note="gene_id=mCG19069.2 transcript_id=mCT17422.2
FT                   protein_id=mCP13488.1"
FT                   /db_xref="GOA:G3XA53"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="MGI:MGI:106586"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA53"
FT                   /protein_id="EDL15608.1"
FT                   /translation="MALMEYQILKMSSCLFILLFLTPGILCICPLQCTCTERHRHVDCS
FT                   GRNLTTLPPGLQENIIHLNLSYNHFTDLHNQLTPYTNLRTLDISNNRLESLPAQLPRSL
FT                   WNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNKLWT
FT                   VPTNMPSKLHIVDLSNNSLTQILPGTLINLTNLTHLYLHNNKFTFIPEQSFDQLLQLQE
FT                   ITLHNNRWSCDHKQNITYLLKWVMETKAHVIGTPCSKQVSSLKEQSMYPTPPGFTSSLF
FT                   TMSEMQTVDTINSLSMVTQPKVTKTPKQYRGKETTFGVTLSKDTTFSSTDRAVVAYPED
FT                   TPTEMTNSHEAAAATLTIHLQDGMSSNASLTSATKSPPSPVTLSIARGMPNNFSEMPRQ
FT                   STTLNLRREETTANGNTRPPSAASAWKVNASLLLMLNAVVMLAG"
FT   gene            complement(1192241..1207807)
FT                   /locus_tag="mCG_119756"
FT                   /note="gene_id=mCG119756.1"
FT   mRNA            complement(join(1192241..1193980,1200830..1200953,
FT                   1204800..1205020,1207587..1207778))
FT                   /locus_tag="mCG_119756"
FT                   /product="mCG119756, transcript variant mCT172621"
FT                   /note="gene_id=mCG119756.1 transcript_id=mCT172621.0
FT                   created on 27-AUG-2002"
FT   CDS             complement(1192631..1193965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119756"
FT                   /product="mCG119756, isoform CRA_b"
FT                   /note="gene_id=mCG119756.1 transcript_id=mCT172621.0
FT                   protein_id=mCP95540.0 isoform=CRA_b"
FT                   /protein_id="EDL15610.1"
FT                   /translation="MEFKYLVFIVLCQYLDNTFFSETEAITTEQQSLSTLITPSLYVTT
FT                   DSQNTAGNALSQTTRFKNISSGQQASPAQITPEQATPAVYVSSSPLTYNITRQAESAVN
FT                   NSLPQTSPSGFTLTNQPSPSTYNSTGQPPKHLVYTSTQQPPSPAPTSSGKPEVESTHNQ
FT                   PTKSTPTIYLQRDTPPPPPPPLTSEPPSGKGTAHKNNHNAIAAILIGTIIISMLVAILM
FT                   IILWKYLRKPVLNDQNWAGRSPFADGETPEMCMDNIRESEASTKRASVVSLMTWKPSKS
FT                   TLLADDLEVKLFESSEHINDTSNLKTDNVEVQINGLSEDSADGSTVGTAVSSDDADLAL
FT                   PPPLLDLDENLPNKPTVTVVSPLPNDSINPQPSPDGLNQVCEEQHSKIQEPFPPPPDSF
FT                   NVPLSAGDFINNQESAHEAQCQEFSTPDLHPDLTDSLPPPPTELL"
FT   mRNA            complement(join(1203781..1205020,1207587..1207807))
FT                   /locus_tag="mCG_119756"
FT                   /product="mCG119756, transcript variant mCT120933"
FT                   /note="gene_id=mCG119756.1 transcript_id=mCT120933.1
FT                   created on 27-AUG-2002"
FT   CDS             complement(1204329..1205000)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119756"
FT                   /product="mCG119756, isoform CRA_a"
FT                   /note="gene_id=mCG119756.1 transcript_id=mCT120933.1
FT                   protein_id=mCP85321.1 isoform=CRA_a"
FT                   /db_xref="GOA:P20934"
FT                   /db_xref="InterPro:IPR008608"
FT                   /db_xref="MGI:MGI:95458"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20934"
FT                   /protein_id="EDL15609.1"
FT                   /translation="MEHKGQYLHLVFLMTTVWASSSSGTRPNYTHLWASSVTASGSSNQ
FT                   NGSSRHPSDNNTNLVTPAVGHKVSATDKPASSPPVPLASTSTLKSSTPHAFRNSSPTAE
FT                   IKSQGETFKKEVCEENTSNTAMLICLIVIAVLFLICTFLFLSTVVLANKVSSLKRSKQV
FT                   GKRQPRSNGDFLASSGLWTAESDTWKRAKELTGSNLLLQSPGVLTAARERKHEEGTEKL
FT                   N"
FT   gene            1268432..1370336
FT                   /gene="Rab11fip4"
FT                   /locus_tag="mCG_19056"
FT                   /note="gene_id=mCG19056.2"
FT   mRNA            join(1268432..1268656,1296842..1296929,1297680..1297768,
FT                   1357952..1358175,1360505..1360699,1361385..1361519,
FT                   1361763..1361798,1362190..1362289,1362548..1362651,
FT                   1363714..1363854,1366757..1366838,1367600..1367737,
FT                   1367814..1367969,1368898..1369041,1369865..1370336)
FT                   /gene="Rab11fip4"
FT                   /locus_tag="mCG_19056"
FT                   /product="RAB11 family interacting protein 4 (class II)"
FT                   /note="gene_id=mCG19056.2 transcript_id=mCT17408.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(1268498..1268656,1296842..1296929,1297680..1297768,
FT                   1357952..1358175,1360505..1360699,1361385..1361519,
FT                   1361763..1361798,1362190..1362289,1362548..1362651,
FT                   1363714..1363854,1366757..1366838,1367600..1367737,
FT                   1367814..1367969,1368898..1369041,1369865..1369981)
FT                   /codon_start=1
FT                   /gene="Rab11fip4"
FT                   /locus_tag="mCG_19056"
FT                   /product="RAB11 family interacting protein 4 (class II)"
FT                   /note="gene_id=mCG19056.2 transcript_id=mCT17408.2
FT                   protein_id=mCP13432.2"
FT                   /protein_id="EDL15611.1"
FT                   /translation="MAGGAGWAGAPAALLRSVRRLREVFEVCGRDPDGFLRVERVAALG
FT                   LRFGQGEEVEKLVKCLDPNDLGRINFKDFCRGVFAMKGCEELLKDVLSVESAGTLPCSP
FT                   DIPDCVEQGSDFSGSTDGEQLPREPDFFQEDEEEAMTLALPEGPQELDMDSPMESSQGP
FT                   EGSVKGCGEEKEPELGGLFLPEDKCLVLTPSVTTSDLSTHSTASLISNEEQFEDYGEGD
FT                   DVDCAPSSPCPDDETRTNVYSDLGSSVSSSAGQTPRKMRHAYNSELLDVYCSQCCKKIN
FT                   LLNDLEARLKNLKANSPNRKISSTAFGRQLMHNSNFSSSNGSTEDLFRDSIDSCDNDIT
FT                   EKVSFLEKKVTELENDSLTSGGLKSKLKQENMQLVHRVHELEEMVKDQETTAEQALEEE
FT                   ARRHREVYCKLEREKSTELELLNTRVQQLEEENTDLRTTVARLKSQTEKLDEERQRMSD
FT                   RLEDTSLRLKDEMDLYKRMMDKLRQNRLEFQKEREATQELIEDLRRELEHLQMYKLDCE
FT                   RPGRGRSSSGLGEFNARAREVELEHEVKRLKQENHKLRDQNDDLNGQILSLSLYEAKNL
FT                   FATQTKAQSLAAEIDTASRDELMEALKEQEEINFRLRQYMDKIILAILDHNPSILEIKH
FT                   "
FT   gene            complement(1284292..>1300364)
FT                   /locus_tag="mCG_145247"
FT                   /note="gene_id=mCG145247.0"
FT   mRNA            complement(join(1284292..1286152,1293048..1293109,
FT                   1300101..>1300364))
FT                   /locus_tag="mCG_145247"
FT                   /product="mCG145247"
FT                   /note="gene_id=mCG145247.0 transcript_id=mCT184671.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1285104..>1285505)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145247"
FT                   /product="mCG145247"
FT                   /note="gene_id=mCG145247.0 transcript_id=mCT184671.0
FT                   protein_id=mCP105663.0"
FT                   /protein_id="EDL15612.1"
FT                   /translation="STSMRPRELTGIVVGFTPPSTRVTCPNPSQTVLPTGDQASQHMSL
FT                   WEPVSFKPAQGRFPETYLSCNGFSNQALLELPRRYLKPMKKAKIKLAHPSIHHACPETM
FT                   RATSLVLSMKQAVPRKVEPLATVSRSLKV"
FT   gene            complement(1347536..>1352251)
FT                   /locus_tag="mCG_145957"
FT                   /note="gene_id=mCG145957.0"
FT   mRNA            complement(join(1347536..1347712,1351497..1351643,
FT                   1352217..>1352251))
FT                   /locus_tag="mCG_145957"
FT                   /product="mCG145957"
FT                   /note="gene_id=mCG145957.0 transcript_id=mCT186065.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(1347595..1347712,1351497..>1351600))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145957"
FT                   /product="mCG145957"
FT                   /note="gene_id=mCG145957.0 transcript_id=mCT186065.0
FT                   protein_id=mCP107512.0"
FT                   /protein_id="EDL15613.1"
FT                   /translation="LTSPGAANPAIHTLTGCLSVAAWCQSKVKGGIKLSCSVQGWQLRI
FT                   QQSLAESSPRKIHRRGGEPAFNSAPVEV"
FT   gene            1574718..1576024
FT                   /pseudo
FT                   /locus_tag="mCG_49134"
FT                   /note="gene_id=mCG49134.2"
FT   mRNA            1574718..1576024
FT                   /pseudo
FT                   /locus_tag="mCG_49134"
FT                   /note="gene_id=mCG49134.2 transcript_id=mCT49317.2 created
FT                   on 11-NOV-2002"
FT   gene            complement(1612131..1640598)
FT                   /gene="Utp6"
FT                   /locus_tag="mCG_19061"
FT                   /note="gene_id=mCG19061.1"
FT   mRNA            complement(join(1612131..1614304,1615868..1615940,
FT                   1619089..1619155,1620073..1620182,1620322..1620402,
FT                   1621426..1621605,1623974..1624051,1624401..1624480,
FT                   1627086..1627270,1628965..1629046,1629794..1629875,
FT                   1631772..1631849,1633806..1633924,1634932..1634995,
FT                   1635536..1635583,1636981..1637073,1637304..1637345,
FT                   1638942..1639026,1640413..1640598))
FT                   /gene="Utp6"
FT                   /locus_tag="mCG_19061"
FT                   /product="UTP6, small subunit (SSU) processome component,
FT                   homolog (yeast)"
FT                   /note="gene_id=mCG19061.1 transcript_id=mCT17412.2 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(1614150..1614304,1615868..1615940,
FT                   1619089..1619155,1620073..1620182,1620322..1620402,
FT                   1621426..1621605,1623974..1624051,1624401..1624480,
FT                   1627086..1627270,1628965..1629046,1629794..1629875,
FT                   1631772..1631849,1633806..1633924,1634932..1634995,
FT                   1635536..1635583,1636981..1637073,1637304..1637345,
FT                   1638942..1639026,1640413..1640504))
FT                   /codon_start=1
FT                   /gene="Utp6"
FT                   /locus_tag="mCG_19061"
FT                   /product="UTP6, small subunit (SSU) processome component,
FT                   homolog (yeast)"
FT                   /note="gene_id=mCG19061.1 transcript_id=mCT17412.2
FT                   protein_id=mCP13478.2"
FT                   /protein_id="EDL15614.1"
FT                   /translation="MAEIIQERIEDRIPELEQLERIGLFSHAEIKAIIKKASDLEYKIH
FT                   RRTLLKEDFINYVQYEINLLELIQRRRARIKYSFKKDEIEYSMVHRVQGVFGRASAKWK
FT                   DDVQLWLSYIVFCKKWGTKTHLSKIFSAMLAIHSNKPALWIMAAKWEMEDRLSSESARQ
FT                   LFLRALRFHPECPKLYQEYFRMELMHAEKLRKEKQEFEKAAMDMGDFDHPEEILKGELA
FT                   RIIYKNSISKIKGAEFHVSLLAIAQLFDFAKDLQKEIYDDLQALHTDDPLTWDYVARRE
FT                   LEIESQPGEEQPVSKQAKAVEMGRREERCCAVYEEAVKALPTEAMWKCYITFCLERFSK
FT                   KTSSVPLRGQRLERTMLAFRKAHELKLLSEVQYKQWIDLLLRQDLFKEALQVAEAGTEL
FT                   FKDSVTMWQTKLQVLIDSKSPDVEMRFEEAFAHLKPQVCLPLWISWAEWSESAKSQEDT
FT                   EAIFKKAIIAVTGASSVTLKEKYLDWAYRSGGYKKARAVFKSLQESRPFSVEFFRKMMQ
FT                   FEKEQEPCKMVNLREYYERALREFGTSDSDLWMDYIKEELNHPFGKPENCGQIYWRAMK
FT                   MLQGQSAELFVAKHAMHQAGH"
FT   gene            <1671300..1714743
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /note="gene_id=mCG19060.3"
FT   mRNA            join(<1671300..1671793,1673811..1673857,1673939..1674003,
FT                   1679678..1679746,1688134..1688183,1691179..1691264,
FT                   1693985..1694216,1695764..1695857,1700300..1700405,
FT                   1702713..1702890,1705531..1705622,1705789..1705932,
FT                   1706418..1706575,1709769..1709967,1710628..1710707,
FT                   1712466..1714743)
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   transcript variant mCT191056"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT191056.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1671301..1671793,1673811..1673857,1673939..1674003,
FT                   1679678..1679746,1688134..1688183,1691179..1691264,
FT                   1693985..1694216,1695764..1695857,1700300..1700405,
FT                   1702713..1702890,1705531..1705622,1705789..1705932,
FT                   1706418..1706575,1709769..1709967,1710628..1710707,
FT                   1712466..1712811)
FT                   /codon_start=1
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT191056.0
FT                   protein_id=mCP112009.0 isoform=CRA_c"
FT                   /protein_id="EDL15617.1"
FT                   /translation="RSGAGLGGDTFFFSSLLPSSPPPFPSPLLPSLLLPPSVRWSLLGR
FT                   AVGVAGALTLRGRPAGSWRGEEAGTAMAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVA
FT                   AAASGGKSGGGGCGGGGSYSASSSSAAAAAAAAGAAVLPVKKPKMEHVQADHELFLQAF
FT                   EKPTQIYRFLRTRNLIAPIFLHRTLTYMSHRNSRTSIKRKTFKVDDMLSKVEKMKGEQE
FT                   SHSLSAHLQLTFTGFFHKNDKPSQNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPT
FT                   GKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMIN
FT                   GETNENIDVSEELPARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECP
FT                   ISKKRATWETILDGKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPVAKPLATRNSESL
FT                   HQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEA
FT                   RDDLHCPWCTLNCRKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNP
FT                   QDIHRQPGFAFSRNGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHN
FT                   RLYFHSDTCLPLRPQEMEVDSEDEKDPEWLREKTITQIEEFSDVNEGEKEVMKLWNLHV
FT                   MKHGFIADNQMNHACMLFVENYGQKIIKKNLCRNFMLHLVSMHDFNLISIMSIDKAVTK
FT                   LREMQQKLEKGESATPSNEEIAEEQNGTANGFSETNSKEKALETDGVSGVPKQSKKQKL
FT                   "
FT   mRNA            join(1671431..1671793,1673811..1673857,1673939..1674003,
FT                   1679678..1679746,1688134..1688183,1691179..1691264,
FT                   1693985..1694216,1695764..1695857,1700300..1700405,
FT                   1702713..1702890,1705531..1705622,1705789..1705932,
FT                   1706418..1706575,1709769..1709913,1710628..1710707,
FT                   1712466..1714742)
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   transcript variant mCT17413"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT17413.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(1671431..1671793,1673811..1673857,1673939..1674003,
FT                   1688134..1688183,1691179..1691264,1693985..1694216,
FT                   1695764..1695857,1700300..1700405,1702713..1702890,
FT                   1705531..1705709,1706362..1706575,1709769..1709967,
FT                   1710628..1710707,1712466..1712808)
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   transcript variant mCT173979"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT173979.0 created
FT                   on 03-OCT-2002"
FT   CDS             join(1671514..1671793,1673811..1673857,1673939..1674003,
FT                   1688134..1688183,1691179..1691264,1693985..1694216,
FT                   1695764..1695857,1700300..1700405,1702713..1702890,
FT                   1705531..1705709,1706362..1706442)
FT                   /codon_start=1
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT173979.0
FT                   protein_id=mCP96898.0 isoform=CRA_a"
FT                   /protein_id="EDL15615.1"
FT                   /translation="MAPQKHGGGGGGGSGPSAGSGGGGFGGSAAAVAAAASGGKSGGGG
FT                   CGGGGSYSASSSSAAAAAAAAGAAVLPVKKPKMEHVQADHELFLQAFEKPTQIYRFLRT
FT                   RNLIAPIFLHRTLTYMSHRNSRTSIKSLSAHLQLTFTGFFHKNDKPSQNSENEQNSVTL
FT                   EVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQTKPGNFPSLAVSSNEFEPSNSH
FT                   MVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEELPARRKRNREDGEKTFVAQMTVF
FT                   DKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILDGKRLPPFETFSQGPTLQFTLRW
FT                   TGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQTIAVKETLTTELQTRKEKDNSN
FT                   ESRQKLRIFYQVNATDWPTKVIGLKNVSLELYFTSEYFSMDYLYLLFLKTLFCFCFLYS
FT                   IIQKVLG"
FT   CDS             join(1673969..1674003,1679678..1679746,1688134..1688183,
FT                   1691179..1691264,1693985..1694216,1695764..1695857,
FT                   1700300..1700405,1702713..1702890,1705531..1705622,
FT                   1705789..1705932,1706418..1706575,1709769..1709913,
FT                   1710628..1710707,1712466..1712811)
FT                   /codon_start=1
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT17413.2
FT                   protein_id=mCP13450.2 isoform=CRA_b"
FT                   /protein_id="EDL15616.1"
FT                   /translation="MSHRNSRTSIKRKTFKVDDMLSKVEKMKGEQESHSLSAHLQLTFT
FT                   GFFHKNDKPSQNSENEQNSVTLEVLLVKVCHKKRKDVSCPIRQVPTGKKQVPLNPDLNQ
FT                   TKPGNFPSLAVSSNEFEPSNSHMVKSYSLLFRVTRPGRREFNGMINGETNENIDVSEEL
FT                   PARRKRNREDGEKTFVAQMTVFDKNRRLQLLDGEYEVAMQEMEECPISKKRATWETILD
FT                   GKRLPPFETFSQGPTLQFTLRWTGETNDKSTAPVAKPLATRNSESLHQENKPGSVKPAQ
FT                   TIAVKETLTTELQTRKEKDNSNESRQKLRIFYQFLYNNNTRQQTEARDDLHCPWCTLNC
FT                   RKLYSLLKHLKLCHSRFIFNYVYHPKGARIDVSINECYDGSYAGNPQDIHRQPGFAFSR
FT                   NGPVKRTPITHILVCRPKRTKASMSEFLESEDGEVEQQRTYSSGHNRLYFHSDTCLPLR
FT                   PQEMEQIEEFSDVNEGEKEVMKLWNLHVMKHGFIADNQMNHACMLFVENYGQKIIKKNL
FT                   CRNFMLHLVSMHDFNLISIMSIDKAVTKLREMQQKLEKGESATPSNEEIAEEQNGTANG
FT                   FSETNSKEKALETDGVSGVPKQSKKQKL"
FT   gene            complement(1699101..>1710489)
FT                   /locus_tag="mCG_145253"
FT                   /note="gene_id=mCG145253.0"
FT   mRNA            complement(join(1699101..1699293,1701304..1702286,
FT                   1703094..1703547,1710191..>1710489))
FT                   /locus_tag="mCG_145253"
FT                   /product="mCG145253"
FT                   /note="gene_id=mCG145253.0 transcript_id=mCT184677.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1701423..>1701641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145253"
FT                   /product="mCG145253"
FT                   /note="gene_id=mCG145253.0 transcript_id=mCT184677.0
FT                   protein_id=mCP105669.0"
FT                   /protein_id="EDL15618.1"
FT                   /translation="HTPLIPALKWQLGKSRLPGLPGPQRNLSQPTTNPHTRTQNEKSCQ
FT                   NLIFLSGYLFGYQFFLLFTIHYLKVAV"
FT   gene            complement(1727197..1761599)
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /note="gene_id=mCG19064.1"
FT   mRNA            complement(join(1727197..1728428,1729283..1729395,
FT                   1737104..1737275,1738483..1738705,1739891..1740068,
FT                   1740789..1740876,1744883..1745090,1761427..1761599))
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, transcript
FT                   variant mCT17417"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT17417.3 created
FT                   on 20-FEB-2003"
FT   mRNA            complement(join(1727215..1728428,1729283..1729393,
FT                   1737139..1737275,1738483..1738705,1739891..1740068,
FT                   1740789..1740876,1744883..1745090,1761427..>1761598))
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, transcript
FT                   variant mCT191064"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT191064.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(1727215..1728428,1737143..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..1761581))
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, transcript
FT                   variant mCT180679"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT180679.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(join(1728172..1728428,1729283..1729395,
FT                   1737104..1737275,1738483..1738705,1739891..1740068,
FT                   1740789..1740876,1744883..1745090,1761427..1761555))
FT                   /codon_start=1
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, isoform CRA_a"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT17417.3
FT                   protein_id=mCP13466.3 isoform=CRA_a"
FT                   /protein_id="EDL15619.1"
FT                   /translation="MKGAMEPEPEVLLQEARENVEAAQSYRRELGQRLQGLREAQRQIK
FT                   ESASQTRDVLKQHFSDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIEHGVN
FT                   TADDLVREGEIAILGGIEEESDKLWNFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSI
FT                   LNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTANH
FT                   FEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQTGHSTLVPHEWTTGF
FT                   EGYSLSSRRNIALRNDAESSGVLYSSAPTYFCGQTLTFRQVDWDMPGMPLAVVETVGQP
FT                   DRRDSIGVCAERQNGYESLQRDQAVCISTNGAVFVNGKEMTNQLPAVTSGSTVTFDIEA
FT                   VTLGTSNSHEGGNAKLRVTISSNNREVVFDWLLEQACGPLYFGCSFFYPGWKVLVF"
FT   CDS             complement(join(1728353..1728428,1737143..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..1761555))
FT                   /codon_start=1
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, isoform CRA_d"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT180679.0
FT                   protein_id=mCP103600.0 isoform=CRA_d"
FT                   /protein_id="EDL15622.1"
FT                   /translation="MKGAMEPEPEVLLQEARENVEAAQSYRRELGQRLQGLREAQRQIK
FT                   ESASQTRDVLKQHFSDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIEHGVN
FT                   TADDLVREGEIAILGGIEEESDKLWNFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSI
FT                   LNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTANH
FT                   FEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQTGHSTLVPHEWTTGF
FT                   EGYSLSSRRNIALRNDAESSGVLYSSAPTYFCGQTLTFRCSLCQWKRNDQSVACSYLWL
FT                   HCHI"
FT   CDS             complement(join(1729355..1729393,1737139..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..>1761597))
FT                   /codon_start=1
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, isoform CRA_c"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT191064.0
FT                   protein_id=mCP112012.0 isoform=CRA_c"
FT                   /protein_id="EDL15621.1"
FT                   /translation="GARRSRESGGPRDQMKGAMEPEPEVLLQEARENVEAAQSYRRELG
FT                   QRLQGLREAQRQIKESASQTRDVLKQHFSDLKGTLGKLLDERLVTLLQEVDTIEQETIK
FT                   PLDDCQKLIEHGVNTADDLVREGEIAILGGIEEESDKLWNFTKKASHIQLDSLPEVPLL
FT                   VDVPCLSAQLDDSILNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTA
FT                   QDYRLQFRKCTANHFEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQT
FT                   GHSTLVPHEWTTGFEGYSLSSRRNIALRNDAESSGVLYSSAPTYFCGQTLTFRQLKLWD
FT                   SQTEETV"
FT   mRNA            complement(join(1736786..1736988,1737143..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..1761579))
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, transcript
FT                   variant mCT180678"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT180678.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(join(1736859..1736988,1737143..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..1761555))
FT                   /codon_start=1
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, isoform CRA_b"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT180678.0
FT                   protein_id=mCP103601.0 isoform=CRA_b"
FT                   /protein_id="EDL15620.1"
FT                   /translation="MKGAMEPEPEVLLQEARENVEAAQSYRRELGQRLQGLREAQRQIK
FT                   ESASQTRDVLKQHFSDLKGTLGKLLDERLVTLLQEVDTIEQETIKPLDDCQKLIEHGVN
FT                   TADDLVREGEIAILGGIEEESDKLWNFTKKASHIQLDSLPEVPLLVDVPCLSAQLDDSI
FT                   LNIVKDHIFKHGTVASRPPVQIEELIEKPGGIIVRWCKVDDDFTAQDYRLQFRKCTANH
FT                   FEDVYVGSETEFIVLHIDPNVDYQFRVCARGDGRQEWSPWSVPQTGHSTLVPHEWTTGF
FT                   EGYSLSSRRNIALRNDAESSGVLYSSAPTYFCGQTLTFRVLLCNPGWLGAHKDQTGLKL
FT                   REVCLPLFQVLELKACLTTPGF"
FT   gene            1770349..1815496
FT                   /gene="C130052G03Rik"
FT                   /locus_tag="mCG_119750"
FT                   /note="gene_id=mCG119750.1"
FT   mRNA            join(1770349..1770783,1775102..1776969,1778900..1778996,
FT                   1781260..1781421,1782728..1782854,1784206..1784287,
FT                   1787200..1787384,1789119..1789273,1790000..1790159,
FT                   1790583..1790771,1792111..1792207,1793385..1793464,
FT                   1793711..1793850,1794792..1794942,1799601..1799777,
FT                   1804703..1804767,1807893..1808073,1811876..1812054,
FT                   1813137..1813978,1814701..1814859,1814965..1815496)
FT                   /gene="C130052G03Rik"
FT                   /locus_tag="mCG_119750"
FT                   /product="RIKEN cDNA C130052G03"
FT                   /note="gene_id=mCG119750.1 transcript_id=mCT120927.1
FT                   created on 03-OCT-2002"
FT   CDS             join(1770718..1770783,1775102..1776969,1778900..1778996,
FT                   1781260..1781421,1782728..1782854,1784206..1784287,
FT                   1787200..1787384,1789119..1789273,1790000..1790159,
FT                   1790583..1790771,1792111..1792207,1793385..1793464,
FT                   1793711..1793850,1794792..1794942,1799601..1799777,
FT                   1804703..1804767,1807893..1808073,1811876..1812054,
FT                   1813137..1813978,1814701..1814859,1814965..1815043)
FT                   /codon_start=1
FT                   /gene="C130052G03Rik"
FT                   /locus_tag="mCG_119750"
FT                   /product="RIKEN cDNA C130052G03"
FT                   /note="gene_id=mCG119750.1 transcript_id=mCT120927.1
FT                   protein_id=mCP85486.1"
FT                   /protein_id="EDL15623.1"
FT                   /translation="MVGVLSMAAAAAPLPVKDYEIEPCKKRRKDDDNSSCETITKYLSP
FT                   IGKTGDKVFSPPKPSNILHYFRKTSLTTEKPQSTKAYKIKPSPPLLVGNSKDCKTPLEV
FT                   FSNREFKRKRKRVSLSSQLNDIKIQDECPVEISNNDSKEDGGLSDCVESSASVSLYKEH
FT                   VEVLAESIEDSRNQPNTKSSKKKVNPKQCTTKSDDRILRKRKRSKVTGQSESVPLADEL
FT                   SLPEDGGKDSKLTKPSLAEENDSRTHATKRADLKESTITVSYEEFVKSHKAAKVEEIPD
FT                   PAVPACVPSGPGEAVKSGSEGELSGSCEPSPQLHLKTVTVLAQVHPTPPKKKGKIPPIF
FT                   LKQKQPELENSLSDPENEQPVQKRKSNVVIQEGQLELAVLEAWNSEASVPKCSMEERQQ
FT                   FMRAFRQPPPDTLKNGFKKPLEKQKDPSEKSVHEGDSSSEKIIENPNIQRVSSQGCLQS
FT                   HADRGSFPKEKSKKPNKKGKKTRTTAGGNREENIQKEKTAFSLKDEQDQNSLRRSVRQK
FT                   SEVLKSNALLNSENLVCEDTAHDSVQMSLCNRNKSRSSSTPTRDMVTHHRAEPGSSLEY
FT                   VSTRQPIRRSLRSCSTPATNALGGTESEDAQDTIPVKASTPKSARTSEKHNLYTAELII
FT                   VSSDSESPIRMKFTRISTPKKSKKSSKKSETTEEELTSQKKKANSTSKNISKAKELIEE
FT                   AKAFQIGGSKTEETVVPLRRSSRHQARSAKEKSPEIDDSVIVIDSSPTSIREPEKSQKK
FT                   LQNLNDVLGKKLNKSSKNVPGKMKIAPLFLAKRTKRAAIPVFDLDESSQDSSEQTQDCD
FT                   VQFKAKRDFLMSGLPDLLKRQIAKKAAALDVYNAVSTSFQRVVHVQQKDDEYWLWHLKP
FT                   PSCPLLTEFKELNTKVTDLSEYVVAFGEFSTLNPNPRSNPAAVMMRTRKDFTKEVRNLL
FT                   LEEIKCSNPEFSLEKYFPLLLKKRIEHQVLCEGHGKQASPQLQPDVSQKETKRKQVATG
FT                   NQKSKRKRQNEYSVSPEEMKGRSKDLDERISSSCTNLDPSRDSGTEDMLWTEKYQPQNS
FT                   NELIGNELAVKKLHSWLKDWKRRAELEERHNLKGKRDEKEEDLSDSTDFKGSSDDEENR
FT                   LCNTVLITGPTGVGKTAAVYACAQELGFKIFEVNASSQRSGRQILSQLKEATQSHQVDK
FT                   QGVNSQKPCFFNNYNIGKSPKKLNSPGKVVTSPRKLPPSSPKTSGQKRALLPKTLANYF
FT                   KVSSKSKSNDDVGALMGDDKDPTFSLVFDGCFEEINFSIPSLLNVASYLQVICLVENFR
FT                   TDFKDFVTLLTANACDIRKSILYLQFWIRSGGGILEERPLSHCRENSRNTLVCSEDGSD
FT                   ANINSKKPKRNRVALPRCDTGCAEALFGLKNIASPSQDLLSLLKHKITTKEEWQKLIQV
FT                   LTEFHVQNIDLLHSNLEVILPLPVHVVPDVRGAYGFPVTTQASAPASMGHLTRKQSKDQ
FT                   PLRKSQKRKQKKMVILDDSDLFDTGLDFSGELPSLSPAPSLSVEDNIRRDSNPEIKTQN
FT                   SGFKPHSVPQPPKTLAEKKCCMLVSHCLNSLSEFMENMSFIDALLTDPGEQNELGRSAF
FT                   HWTNGRVKSGLCDEFSLENRDRWAPQSAGELKATAEALSFTECSSTISKALESLNSCKQ
FT                   LERDPTNELTVCVSQRRHDACFRQSAANLDNADKRMAVIKSVFSSRSFLTLGNKQASII
FT                   DYLPTLRNICRTEKLKEQEKNKRRFLHYFEGIHLEIPEETITTLAADFP"
FT   gene            complement(1817347..1822799)
FT                   /gene="1110002N22Rik"
FT                   /locus_tag="mCG_19068"
FT                   /note="gene_id=mCG19068.2"
FT   mRNA            complement(join(1817347..1817951,1818590..1818739,
FT                   1820538..1820995,1822749..1822799))
FT                   /gene="1110002N22Rik"
FT                   /locus_tag="mCG_19068"
FT                   /product="RIKEN cDNA 1110002N22"
FT                   /note="gene_id=mCG19068.2 transcript_id=mCT17420.2 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(1817508..1817951,1818590..1818739,
FT                   1820538..1820995,1822749..1822791))
FT                   /codon_start=1
FT                   /gene="1110002N22Rik"
FT                   /locus_tag="mCG_19068"
FT                   /product="RIKEN cDNA 1110002N22"
FT                   /note="gene_id=mCG19068.2 transcript_id=mCT17420.2
FT                   protein_id=mCP13354.2"
FT                   /protein_id="EDL15624.1"
FT                   /translation="MAWRTNLACLIKAGGRRWFPVPEYSSLPPVLNNTCSVRKSTAPEK
FT                   RVASVAACDTDGKEPGNPLDRLFSLEQQASILQVLNTASDKELEAFRLLRGRKSVNIVE
FT                   HRKKFGPFQRLENLIDVPLIQYKTAVEVCNSILCPENRRRKKSQEKWLLRKFIKPGVEQ
FT                   ERLKAVKSIVSIVFGTRRIAWAHLDRRPTVLDWQQTECWKLTNKTYPTSFYLEEISSVI
FT                   SKIPKADLYILEKSGLSIQNTSLLPILLHFLITEAMLYALLNKTFAEDGQHRVLSINRN
FT                   AVGKHFDLMIGDTRTSGRELVKQFLSESVLKERPRVFFPQDLLVQYRQKVVKSSYRIEE
FT                   LYDSLLQAVAFYELVFGKDSELKC"
FT   gene            1834880..1860207
FT                   /gene="Centa2"
FT                   /locus_tag="mCG_19057"
FT                   /note="gene_id=mCG19057.1"
FT   mRNA            join(1834880..1835074,1835755..1835885,1837709..1837800,
FT                   1840927..1841006,1842912..1843024,1846437..1846583,
FT                   1851442..1851525,1854848..1854910,1856816..1856893,
FT                   1857806..1858034,1859156..1860207)
FT                   /gene="Centa2"
FT                   /locus_tag="mCG_19057"
FT                   /product="centaurin, alpha 2"
FT                   /note="gene_id=mCG19057.1 transcript_id=mCT17409.2 created
FT                   on 03-OCT-2002"
FT   CDS             join(1834981..1835074,1835755..1835885,1837709..1837800,
FT                   1840927..1841006,1842912..1843024,1846437..1846583,
FT                   1851442..1851525,1854848..1854910,1856816..1856893,
FT                   1857806..1858034,1859156..1859190)
FT                   /codon_start=1
FT                   /gene="Centa2"
FT                   /locus_tag="mCG_19057"
FT                   /product="centaurin, alpha 2"
FT                   /note="gene_id=mCG19057.1 transcript_id=mCT17409.2
FT                   protein_id=mCP13451.2"
FT                   /db_xref="GOA:Q5SSK2"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:2663075"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SSK2"
FT                   /protein_id="EDL15625.1"
FT                   /translation="MGDRERNKKRLLELLQAAGTGNGHCADCGAADPDWASYKLGIFIC
FT                   LHCSGVHRNFPDISKVKSVRLDFWDDSMVEFMTHHGNLNVKAKFEARVPAFYYVPQAND
FT                   CLVLKEQWIRAKYERQEFTAIDKAVSHPGNREGFLWKRGRDNAQFLRRRFVLLSREGLL
FT                   KYYTKEEGKAPKAVISIKDLNATFQTEKIGHPHGLQITYRKEGHTRNLFVYHDSGKEIV
FT                   DWFNALRAARLQYLKLAFPDLPESELVPLITRNYLKQGFMEKTGPKHREPFKKRWFALD
FT                   PQERRLLYYKNPLDAFELGQVFLGSNEQGYEVWEDLPKGIRGNRWKAGLTVITPERKFI
FT                   FTCPTEKEQREWLESLRGVLSSPLSPLHLLTTSAETGCGLG"
FT   gene            complement(1839625..>1858389)
FT                   /locus_tag="mCG_146186"
FT                   /note="gene_id=mCG146186.0"
FT   mRNA            complement(join(1839625..1840015,1857716..1857832,
FT                   1857916..>1858389))
FT                   /locus_tag="mCG_146186"
FT                   /product="mCG146186"
FT                   /note="gene_id=mCG146186.0 transcript_id=mCT186289.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(1839950..1840015,1857716..1857832,
FT                   1857916..>1858116))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146186"
FT                   /product="mCG146186"
FT                   /note="gene_id=mCG146186.0 transcript_id=mCT186289.0
FT                   protein_id=mCP107517.0"
FT                   /protein_id="EDL15626.1"
FT                   /translation="VRPLWDCSEGALFCPHPKEPPPIPHFSLRRWRGDKGLDKTPRRLS
FT                   SHSRCSFSVGQVKMNFRSGVMTKNLAQLKSILKMEGIESSEALGQKSPCSLASPKVKFG
FT                   KEVRGPKVRTEWPGHRSDLELYI"
FT   gene            1860259..1861344
FT                   /locus_tag="mCG_1032052"
FT                   /note="gene_id=mCG1032052.0"
FT   mRNA            join(1860259..1860376,1861087..1861344)
FT                   /locus_tag="mCG_1032052"
FT                   /product="mCG1032052"
FT                   /note="gene_id=mCG1032052.0 transcript_id=mCT149756.0
FT                   created on 31-MAR-2003"
FT   CDS             join(1860351..1860376,1861087..1861186)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032052"
FT                   /product="mCG1032052"
FT                   /note="gene_id=mCG1032052.0 transcript_id=mCT149756.0
FT                   protein_id=mCP85372.1"
FT                   /protein_id="EDL15627.1"
FT                   /translation="MPLIPVLGKPGWPRTQKSACLCLPSAGIKGVRHHARLMANF"
FT   gene            1864603..1880744
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /note="gene_id=mCG19055.2"
FT   mRNA            join(1864603..1864988,1870276..1870419,1874938..1875100,
FT                   1877925..1877999,1879552..1880743)
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /product="ring finger protein 135, transcript variant
FT                   mCT17407"
FT                   /note="gene_id=mCG19055.2 transcript_id=mCT17407.2 created
FT                   on 27-AUG-2002"
FT   mRNA            join(1864626..1864882,1879872..1880744)
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /product="ring finger protein 135, transcript variant
FT                   mCT172628"
FT                   /note="gene_id=mCG19055.2 transcript_id=mCT172628.0 created
FT                   on 27-AUG-2002"
FT   CDS             join(1864650..1864988,1870276..1870419,1874938..1875100,
FT                   1877925..1877999,1879552..1880084)
FT                   /codon_start=1
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /product="ring finger protein 135, isoform CRA_b"
FT                   /note="gene_id=mCG19055.2 transcript_id=mCT17407.2
FT                   protein_id=mCP13444.1 isoform=CRA_b"
FT                   /db_xref="GOA:B2RRA5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1919206"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRA5"
FT                   /protein_id="EDL15629.1"
FT                   /translation="MAAVCSGNAVPVWLSEDDLSCIICQGLLDQPTTLPCGHSFCLRCL
FT                   HDLWVSKRGAVDGCPWACPICRKGPLTKPKLHKNPLLQDLVDKYLQAAREVEAGSEPEP
FT                   APAPRSAPQVTVQKSTTNVIQELTDMVRQLVDDVKSLQTQRPNLGSGQDNAQGTPPTDS
FT                   SSEGEHSLDSPKLVTFSISQKKIQEILHNLEEIQEKLQGSVPGRAPPRERVQEMTSSLC
FT                   LLPDQRRPAPRKASHLSLWAISPTFDLRTLSYNLEVSNNSRRVTVSRGDLHTYHWSPQR
FT                   FSISQVFCSQALSSGQKYWEVDTRNCSHWAIGVASWGMKRDGMLGRTMDSWCIEWRGPG
FT                   QFSAWAKMKKTDLQSDLPEVVGVWLDLESGELAFYAVADHERLLYECEVSSSSPLHPAF
FT                   WLYGLSPGNYLEIKQLNT"
FT   CDS             join(1864844..1864882,1879872..1880084)
FT                   /codon_start=1
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /product="ring finger protein 135, isoform CRA_a"
FT                   /note="gene_id=mCG19055.2 transcript_id=mCT172628.0
FT                   protein_id=mCP95547.0 isoform=CRA_a"
FT                   /protein_id="EDL15628.1"
FT                   /translation="MSEGSLDKAQAAQMKKTDLQSDLPEVVGVWLDLESGELAFYAVAD
FT                   HERLLYECEVSSSSPLHPAFWLYGLSPGNYLEIKQLNT"
FT   gene            <1890077..1947800
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /note="gene_id=mCG19063.2"
FT   mRNA            join(<1890077..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1946733..1947800)
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, transcript
FT                   variant mCT17415"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT17415.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(1890085..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1938505..1938627,1946733..1947734)
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, transcript
FT                   variant mCT173980"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT173980.0 created
FT                   on 03-OCT-2002"
FT   mRNA            join(<1890110..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1936853..1936948,1946733..1947754)
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, transcript
FT                   variant mCT191063"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT191063.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1890227..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1936853..1936948,1946733..1946850)
FT                   /codon_start=1
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT191063.0
FT                   protein_id=mCP112011.0 isoform=CRA_c"
FT                   /protein_id="EDL15632.1"
FT                   /translation="GVRSMRAGRVRPLRASDMKKDVRILLVGEPRVGKTSLIMSLVSEE
FT                   FPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQLHQEISQANVICIVYAVNNK
FT                   HSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVE
FT                   CSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDNDGTLN
FT                   DAELNFFQRICFNTPLAPQALEDVKNVVRKHLSDGVADSGLTLRGFLFLHTLFIQRGRH
FT                   ETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTELNHHAYLFLQSTFDKHDLDRDCA
FT                   LSPDELKDLFQVFPYIPWGPDVNNTVCTNERGWITYQGFLSQWTLTTYLDVQRCLEYLG
FT                   YLGYSILTEQESQASAITVTRDKKIDLQKKQTQRNVFRCNVIGVKGCGKTGVLQSLLGR
FT                   NLMRQKKIRDDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAETICDVVCLVYDVTN
FT                   PKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEHSISPTDFCRKHKMPPPQAFTC
FT                   NTADAPSKDIFVKLTTMAMYPEDHYRGSLSRDMGSTDRIENLRKIWVFLKTALHVTQAD
FT                   LKSSTFWLRASFGATVFAVVGFAMYRALLKQR"
FT   CDS             join(<1890227..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1946733..1946850)
FT                   /codon_start=1
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT17415.2
FT                   protein_id=mCP13452.2 isoform=CRA_b"
FT                   /protein_id="EDL15631.1"
FT                   /translation="GVRSMRAGRVRPLRASDMKKDVRILLVGEPRVGKTSLIMSLVSEE
FT                   FPEEVPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQLHQEISQANVICIVYAVNNK
FT                   HSIDKVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVE
FT                   CSAKNLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDNDGTLN
FT                   DAELNFFQRICFNTPLAPQALEDVKNVVRKHLSDGVADSGLTLRGFLFLHTLFIQRGRH
FT                   ETTWTVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTELNHHAYLFLQSTFDKHDLDRDCA
FT                   LSPDELKDLFQVFPYIPWGPDVNNTVCTNERGWITYQGFLSQWTLTTYLDVQRCLEYLG
FT                   YLGYSILTEQESQASAITVTRDKKIDLQKKQTQRNVFRCNVIGVKGCGKTGVLQSLLGR
FT                   NLMRQKKIRDDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAETICDVVCLVYDVTN
FT                   PKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEHSISPTDFCRKHKMPPPQAFTC
FT                   NTADAPSKDIFVKLTTMAMYPHVTQADLKSSTFWLRASFGATVFAVVGFAMYRALLKQR
FT                   "
FT   CDS             join(1890239..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1938505..1938627,1946733..1946850)
FT                   /codon_start=1
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT173980.0
FT                   protein_id=mCP96899.0 isoform=CRA_a"
FT                   /protein_id="EDL15630.1"
FT                   /translation="MRAGRVRPLRASDMKKDVRILLVGEPRVGKTSLIMSLVSEEFPEE
FT                   VPPRAEEITIPADVTPERVPTHIVDYSEAEQSDEQLHQEISQANVICIVYAVNNKHSID
FT                   KVTSRWIPLINERTDKDSRLPLILVGNKSDLVEYSSMETILPIMNQYTEIETCVECSAK
FT                   NLKNISELFYYAQKAVLHPTGPLYCPEEKEMKPACIKALTRIFKISDQDNDGTLNDAEL
FT                   NFFQRICFNTPLAPQALEDVKNVVRKHLSDGVADSGLTLRGFLFLHTLFIQRGRHETTW
FT                   TVLRRFGYDDDLDLTPEYLFPLLKIPPDCTTELNHHAYLFLQSTFDKHDLDRDCALSPD
FT                   ELKDLFQVFPYIPWGPDVNNTVCTNERGWITYQGFLSQWTLTTYLDVQRCLEYLGYLGY
FT                   SILTEQESQASAITVTRDKKIDLQKKQTQRNVFRCNVIGVKGCGKTGVLQSLLGRNLMR
FT                   QKKIRDDHKSYYAINTVYVYGQEKYLLLHDISESEFLTEAETICDVVCLVYDVTNPKSF
FT                   EYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEHSISPTDFCRKHKMPPPQAFTCNTAD
FT                   APSKDIFVKLTTMAMYPHARLRCMCTCNRCTFCICQNFLNSDLLQSVKNKIFTAVLNRH
FT                   VTQADLKSSTFWLRASFGATVFAVVGFAMYRALLKQR"
FT   gene            <1981892..2036152
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /note="gene_id=mCG19052.2"
FT   mRNA            join(1981892..1982251,1983648..1983671,2000547..2000705,
FT                   2004348..2004584,2011933..2012081,2013171..2013283,
FT                   2019243..2019343,2028708..2028768,2035323..2036152)
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /product="rhomboid, veinlet-like 3 (Drosophila), transcript
FT                   variant mCT17332"
FT                   /note="gene_id=mCG19052.2 transcript_id=mCT17332.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(<1981892..1982251,1983648..1983671,2000547..2000705,
FT                   2004348..2004572,2011933..2012081,2013171..2013283,
FT                   2019243..2019343,2028708..2028768,2035323..2036152)
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /product="rhomboid, veinlet-like 3 (Drosophila), transcript
FT                   variant mCT191027"
FT                   /note="gene_id=mCG19052.2 transcript_id=mCT191027.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1982069..1982251,1983648..1983671,2000547..2000705,
FT                   2004348..2004572,2011933..2012081,2013171..2013283,
FT                   2019243..2019343,2028708..2028768,2035323..2035594)
FT                   /codon_start=1
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /product="rhomboid, veinlet-like 3 (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19052.2 transcript_id=mCT191027.0
FT                   protein_id=mCP111975.0 isoform=CRA_b"
FT                   /protein_id="EDL15634.1"
FT                   /translation="LLEQHGRGGAKLARRPGTSAAVWAMGEHPSPGPAVAACAEAERIE
FT                   ELEPEAEERLPAAPEDHWKVLFEKFDPGSTGYISTGKFRSLLESHSSKLDPHKKEVLLA
FT                   LADSHADGQICYQDFVNLMSNKRSNSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHV
FT                   AYETLPREIDRKWYYDSYTCCPPPWFMITITLLEVALFLYNGVLLDQFVLQVTHPRYLK
FT                   NSLVYHPQLRAQAWRYVTYIFMHAGVEQLGLNVALQLLVGVPLEMVHGATRIGLVYVAG
FT                   VVAGSLAVSVADMTAPVVGSSGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMS
FT                   MEFGRAVWLRFHPSAYPPCPHPSFVAHLGGVAVGITLGVVVLRNYEQRLQDQSLWWIFV
FT                   TMYTIFVLFAVFWNIFAYTLLDLKLPPAP"
FT   CDS             join(1982141..1982251,1983648..1983671,2000547..2000705,
FT                   2004348..2004584,2011933..2012081,2013171..2013283,
FT                   2019243..2019343,2028708..2028768,2035323..2035594)
FT                   /codon_start=1
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /product="rhomboid, veinlet-like 3 (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19052.2 transcript_id=mCT17332.2
FT                   protein_id=mCP13409.2 isoform=CRA_a"
FT                   /protein_id="EDL15633.1"
FT                   /translation="MGEHPSPGPAVAACAEAERIEELEPEAEERLPAAPEDHWKVLFEK
FT                   FDPGSTGYISTGKFRSLLESHSSKLDPHKKEVLLALADSHADGQICYQDFVNLMSNKRS
FT                   NSFRQAILQGNRRLSSKALLEEKGLSLSQRLIRHVAYETLPREIDRKWYYDSYTCCPPP
FT                   WFMITITLLEARTRVALFLYNGVLLDQFVLQVTHPRYLKNSLVYHPQLRAQAWRYVTYI
FT                   FMHAGVEQLGLNVALQLLVGVPLEMVHGATRIGLVYVAGVVAGSLAVSVADMTAPVVGS
FT                   SGGVYALVSAHLANIVMNWSGMKCQFKLLRMAVALICMSMEFGRAVWLRFHPSAYPPCP
FT                   HPSFVAHLGGVAVGITLGVVVLRNYEQRLQDQSLWWIFVTMYTIFVLFAVFWNIFAYTL
FT                   LDLKLPPAP"
FT   gene            complement(2042399..2059911)
FT                   /locus_tag="mCG_19053"
FT                   /note="gene_id=mCG19053.1"
FT   mRNA            complement(join(2042399..2045925,2046743..2046846,
FT                   2049969..2050105,2050435..2050499,2052238..2052357,
FT                   2055547..2055611,2055967..2056124,2057414..2057539,
FT                   2058710..2058790,2059749..2059911))
FT                   /locus_tag="mCG_19053"
FT                   /product="mCG19053"
FT                   /note="gene_id=mCG19053.1 transcript_id=mCT17333.2 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(2045719..2045925,2046743..2046846,
FT                   2049969..2050105,2050435..2050499,2052238..2052357,
FT                   2055547..2055611,2055967..2056124,2057414..2057539,
FT                   2058710..2058790,2059749..2059888))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19053"
FT                   /product="mCG19053"
FT                   /note="gene_id=mCG19053.1 transcript_id=mCT17333.2
FT                   protein_id=mCP13427.2"
FT                   /protein_id="EDL15635.1"
FT                   /translation="MLPSLQESLDGDEKELESSEEGGSAEERRLEPPPSSHYCLYSFRG
FT                   SRLTQNRGDSDDGRSGGINAETPSGDDFSLSLVDTNLPSEVEPELRSFIAKRLSKGAVF
FT                   EGLGNVASVELRIPGYRVGCYYCLFQQEKLLPEIAAMESEHNPSEYVVCFLGGSEKGLE
FT                   LYPFCEHTFRLELDKYIQGLKNNMNCEERSLGNDVKSYLNSWYEDVVCPIQRVVLLFQE
FT                   KLTFLLHAALSYTPVEFKESDEKTKRDINRFLSVASLQGLIHEGTMTSLCMAMTEEQHK
FT                   SVIIDCSGPQPQFHNAGSNRFCEDWMQAFLHGAEAGNPFLFRQVLENFKLKAIQDTNNL
FT                   KRFIRQAEMNHYALFKCYMFLKNCGSGDILLKIVKVEHEEMPEAKSVVAVLEEFMREAL
FT                   V"
FT   gene            <2065237..2078044
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /note="gene_id=mCG19062.3"
FT   mRNA            join(<2065237..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073308,2073742..2073899,2074991..2076190)
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, transcript variant
FT                   mCT191058"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT191058.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(2065248..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073308,2073742..2073899,2074991..2075083,
FT                   2076193..2076438,2077009..2077168,2077297..2078044)
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, transcript variant
FT                   mCT171271"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT171271.1 created
FT                   on 03-JAN-2003"
FT   mRNA            join(2065252..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073296,2073742..2073899,2076193..2076438,
FT                   2077009..2077168,2077297..2078044)
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, transcript variant
FT                   mCT17414"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT17414.0 created
FT                   on 03-JAN-2003"
FT   CDS             join(<2065353..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073308,2073742..2073899,2074991..2075152)
FT                   /codon_start=1
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, isoform CRA_b"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT191058.0
FT                   protein_id=mCP112010.0 isoform=CRA_b"
FT                   /protein_id="EDL15637.1"
FT                   /translation="GAVMGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHK
FT                   KLYTGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKT
FT                   QESQKKKQQDDSDEYDDDESAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGI
FT                   PPLMPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMP
FT                   GMPPGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTAAVPAPQPPVTKPLFPSAGQMG
FT                   TPVTSSSTASSNSESLSASSKALFPSTAQVRRKLQFKIVKMALQLNPLDPL"
FT   CDS             join(2065362..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073308,2073742..2073899,2074991..2075083,
FT                   2076193..2076438,2077009..2077168,2077297..2077457)
FT                   /codon_start=1
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, isoform CRA_c"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT171271.1
FT                   protein_id=mCP94190.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q9JMD0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1340045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JMD0"
FT                   /protein_id="EDL15638.1"
FT                   /translation="MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLY
FT                   TGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQES
FT                   QKKKQQDDSDEYDDDESAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPL
FT                   MPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMP
FT                   PGMPPPVPRPGIPPMTQAQAVSAPGILNRPPAPTAAVPAPQPPVTKPLFPSAGQMGTPV
FT                   TSSSTASSNSESLSASSKALFPSTAQAQAAVQGPVGTDFKPLNSTPAATTTEPPKPTFP
FT                   AYTQSTASTTSTTNSTAAKPAASITSKPATLTTTSATSKLIHPDEDISLEERRAQLPKY
FT                   QRNLPRPGQTPIGNPPVGPIGGMMPPQPGLPQQQAMRPPMPPHGQYGGHHQGMPGYLPG
FT                   AMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGGRY"
FT   CDS             join(2065362..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073296,2073742..2073899,2076193..2076438,
FT                   2077009..2077168,2077297..2077457)
FT                   /codon_start=1
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, isoform CRA_a"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT17414.0
FT                   protein_id=mCP13430.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JMD0"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1340045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JMD0"
FT                   /protein_id="EDL15636.1"
FT                   /translation="MGRKKKKQLKPWCWYCNRDFDDEKILIQHQKAKHFKCHICHKKLY
FT                   TGPGLAIHCMQVHKETIDAVPNAIPGRTDIELEIYGMEGIPEKDMDERRRLLEQKTQES
FT                   QKKKQQDDSDEYDDDESAASTSFQPQPVQPQQGYIPPMAQPGLPPVPGAPGMPPGIPPL
FT                   MPGVPPLMPGMPPVMPGMPPGLHHQRKYTQSFCGENIMMPMGGMMPPGPGIPPLMPGMP
FT                   PPVPRPGIPPMTQAQAVSAPGILNRPPAPTAAVPAPQPPVTKPLFPSAGQAQAAVQGPV
FT                   GTDFKPLNSTPAATTTEPPKPTFPAYTQSTASTTSTTNSTAAKPAASITSKPATLTTTS
FT                   ATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQTPIGNPPVGPIGGMMPPQPGLPQQQA
FT                   MRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGPPMVPPYQGGPPRPPMGMRPPVMSQGG
FT                   RY"
FT   gene            complement(2085254..2087791)
FT                   /locus_tag="mCG_1032001"
FT                   /note="gene_id=mCG1032001.1"
FT   mRNA            complement(join(2085254..2086182,2086214..2087791))
FT                   /locus_tag="mCG_1032001"
FT                   /product="mCG1032001"
FT                   /note="gene_id=mCG1032001.1 transcript_id=mCT149705.1
FT                   created on 28-MAR-2003"
FT   CDS             complement(2085877..2086065)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032001"
FT                   /product="mCG1032001"
FT                   /note="gene_id=mCG1032001.1 transcript_id=mCT149705.1
FT                   protein_id=mCP85524.1"
FT                   /protein_id="EDL15639.1"
FT                   /translation="MEIGNLNSDDNKCMNKCMTYLFFPFLLGVGGGHDSFTQPWLYWEL
FT                   RDPLASVSRVCATTPGI"
FT   gene            2110939..2155191
FT                   /locus_tag="mCG_19050"
FT                   /note="gene_id=mCG19050.1"
FT   mRNA            join(2110939..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127639,2128240..2128297,2138566..2138760,
FT                   2142918..2143062,2144933..2144993,2147336..2147398,
FT                   2152128..2152253,2152709..2152744,2152952..2153003,
FT                   2153778..2153920,2154036..2155191)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT17330"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT17330.2 created
FT                   on 04-MAR-2003"
FT   mRNA            join(2110965..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127639,2128240..2128297,2138566..2138760,
FT                   2142918..2143062,2144933..2144993,2147336..2147398,
FT                   2152128..2152744,2152952..2153003,2153778..2153920,
FT                   2154036..2154632)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT172626"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172626.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(2110990..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127639,2128240..2128297,2138566..2138760,
FT                   2142918..2143062,2144933..2144993,2147336..2147398,
FT                   2152128..2152253,2152709..2152744,2152952..2153003,
FT                   2153778..2153920)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_d"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT17330.2
FT                   protein_id=mCP13489.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q5BKQ9"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="MGI:MGI:1916327"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BKQ9"
FT                   /protein_id="EDL15643.1"
FT                   /translation="MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQV
FT                   KEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATG
FT                   QEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDK
FT                   ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEE
FT                   KDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAG
FT                   RQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIE
FT                   PFSRVQIEHISSLIKLSKADVERKLSQMILDKKFHGILDQGEGVLIIFDEPPVDKTYEA
FT                   ALETIQNMSKVVDSLYSKAKKLT"
FT   CDS             join(2110990..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127639,2128240..2128297,2138566..2138760,
FT                   2142918..2143062,2144933..2144993,2147336..2147398,
FT                   2152128..2152295)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_b"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172626.0
FT                   protein_id=mCP95544.0 isoform=CRA_b"
FT                   /protein_id="EDL15641.1"
FT                   /translation="MAAAAVVEFQRAQSLLSTDREASIDILHSIVKRDIQENDEEAVQV
FT                   KEQSILELGSLLAKTGQAAELGGLLKYVRPFLNSISKAKAARLVRSLLDLFLDMEAATG
FT                   QEVELCLECIEWAKSEKRTFLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDK
FT                   ALLVEVQLLESKTYHALSNLPKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEE
FT                   KDWKTAYSYFYEAFEGYDSIDSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAG
FT                   RQTEALKCVAQASKNRSLADFEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIE
FT                   PFSRVQVRTFLGALSTVLG"
FT   mRNA            join(2111010..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127625,2152966..2153003,2153778..2153920,
FT                   2154036..2154236)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT172625"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172625.1 created
FT                   on 04-MAR-2003"
FT   mRNA            join(2111015..2111080,2114031..2114132,2120577..2120701,
FT                   2120847..2120956,2127568..2127639,2128240..2128297,
FT                   2138566..>2138701)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT172627"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172627.0 created
FT                   on 04-MAR-2003"
FT   mRNA            join(2111041..2111080,2114031..2114132,2127568..2127639,
FT                   2128240..2128297,2138566..2138760,2142918..2143062,
FT                   2144933..2144993,2147336..2147398,2152128..2152421)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT180868"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT180868.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(2114052..2114132,2127568..2127639,2128240..2128297,
FT                   2138566..2138760,2142918..2143062,2144933..2144993,
FT                   2147336..2147398,2152128..2152295)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_e"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT180868.0
FT                   protein_id=mCP103790.0 isoform=CRA_e"
FT                   /protein_id="EDL15644.1"
FT                   /translation="MMRRQSRSKSRASLNWVLSWRRLDKLLVELCLECIEWAKSEKRTF
FT                   LRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSNL
FT                   PKARAALTSARTTANAIYCPPKLQATLDMQSGIIHAAEEKDWKTAYSYFYEAFEGYDSI
FT                   DSPKAITSLKYMLLCKIMLNTPEDVQALVSGKLALRYAGRQTEALKCVAQASKNRSLAD
FT                   FEKALTDYRAELRDDPIISTHLAKLYDNLLEQNLIRVIEPFSRVQVRTFLGALSTVLG"
FT   CDS             join(2120678..2120701,2127568..2127625,2152966..2152982)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_a"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172625.1
FT                   protein_id=mCP95545.1 isoform=CRA_a"
FT                   /protein_id="EDL15640.1"
FT                   /translation="MEAATGQEVELCLECIEWAKSEKRTFLQNYHR"
FT   CDS             join(2120873..2120956,2127568..2127639,2128240..2128297,
FT                   2138566..>2138701)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_c"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172627.0
FT                   protein_id=mCP95546.0 isoform=CRA_c"
FT                   /protein_id="EDL15642.1"
FT                   /translation="MLCFVSGDCQWSLESSLHQGHKLILVFEVELCLECIEWAKSEKRT
FT                   FLRQALEARLVSLYFDTKRYQEALHLGSQLLRELKKMDDKALLVEVQLLESKTYHALSN
FT                   LPKARAALTSART"
FT   gene            2159566..2163726
FT                   /gene="Cdk5r1"
FT                   /locus_tag="mCG_10740"
FT                   /note="gene_id=mCG10740.1"
FT   mRNA            2159566..2163726
FT                   /gene="Cdk5r1"
FT                   /locus_tag="mCG_10740"
FT                   /product="cyclin-dependent kinase 5, regulatory subunit
FT                   (p35) 1"
FT                   /note="gene_id=mCG10740.1 transcript_id=mCT10726.1 created
FT                   on 13-JUN-2003"
FT   CDS             2160052..2160975
FT                   /codon_start=1
FT                   /gene="Cdk5r1"
FT                   /locus_tag="mCG_10740"
FT                   /product="cyclin-dependent kinase 5, regulatory subunit
FT                   (p35) 1"
FT                   /note="gene_id=mCG10740.1 transcript_id=mCT10726.1
FT                   protein_id=mCP13412.1"
FT                   /db_xref="GOA:Q542T9"
FT                   /db_xref="InterPro:IPR004944"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="MGI:MGI:101764"
FT                   /db_xref="UniProtKB/TrEMBL:Q542T9"
FT                   /protein_id="EDL15645.1"
FT                   /translation="MGTVLSLSPSYRKATLFEDGAATVGHYTAVQNSKNAKDKNLKRHS
FT                   IISVLPWKRIVAVSAKKKNSKKAQPNSSYQSNIAHLNNENLKKSLSCANLSTFAQPPPA
FT                   QPPAPPASQLSGSQTGVSSSVKKAPHPAITSAGTPKRVIVQASTSELLRCLGEFLCRRC
FT                   YRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHEL
FT                   QAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHY
FT                   FTQVFSDLKNESGQEDKKRLLLGLDR"
FT   gene            complement(2164669..2463367)
FT                   /gene="Myo1d"
FT                   /locus_tag="mCG_10736"
FT                   /note="gene_id=mCG10736.1"
FT   mRNA            complement(join(2164669..2166925,2240029..2240183,
FT                   2269590..2269703,2275530..2275634,2276482..2276626,
FT                   2284327..2284550,2320682..2320889,2323027..2323193,
FT                   2340201..2340333,2345849..2345923,2349383..2349453,
FT                   2353657..2353827,2357422..2357536,2357625..2357770,
FT                   2358859..2359062,2359630..2359746,2362828..2362923,
FT                   2365190..2365243,2367133..2367298,2368658..2368751,
FT                   2376059..2376267,2463062..2463367))
FT                   /gene="Myo1d"
FT                   /locus_tag="mCG_10736"
FT                   /product="myosin ID"
FT                   /note="gene_id=mCG10736.1 transcript_id=mCT10722.2 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(2166769..2166925,2240029..2240183,
FT                   2269590..2269703,2275530..2275634,2276482..2276626,
FT                   2284327..2284550,2320682..2320889,2323027..2323193,
FT                   2340201..2340333,2345849..2345923,2349383..2349453,
FT                   2353657..2353827,2357422..2357536,2357625..2357770,
FT                   2358859..2359062,2359630..2359746,2362828..2362923,
FT                   2365190..2365243,2367133..2367298,2368658..2368751,
FT                   2376059..2376267,2463062..2463156))
FT                   /codon_start=1
FT                   /gene="Myo1d"
FT                   /locus_tag="mCG_10736"
FT                   /product="myosin ID"
FT                   /note="gene_id=mCG10736.1 transcript_id=mCT10722.2
FT                   protein_id=mCP13436.1"
FT                   /protein_id="EDL15646.1"
FT                   /translation="MAEQESLEFGKADFVLMDTVSMPEFMANLRLRFEKGRIYTFIGEV
FT                   VVSVNPYKVLNIYGRDTVEQYKGRELYERPPHLFAIADAAYKAMKRRSKDTCIMISGES
FT                   GAGKTEASKYIMQYIAAITNPSQRAEIERVKNMLLKSNCVLEAFGNAKTNRNDNSSRFG
FT                   KYMDINFDFKGDPIGGHINNYLLEKSRVIVQQPGERSFHSFYQLLQGGSEQMLHSLHLQ
FT                   KSLSSYNYIRVGAQLKSSINDAAEFKVVADAMKVIGFKPEEIQTVYKILAVILHLGNLK
FT                   FIVDGDTPLIENGKVVSVIAELLSTKADMVEKALLYRTVATGRDIIDKQHTEQEASYGR
FT                   DAFAKAIYERLFCWIVTRINDIIEVKNYDTTIHGKNTVIGVLDIYGFEIFDNNSFEQFC
FT                   INYCNEKLQQLFIQLVLKQEQEEYQREGIPWKHIDYFNNQIIVDLVEQQHKGIIAILDD
FT                   ACMNVGKVTDGMFLEALNSKLGKHGHFSSRKTCASDKILEFDRDFRIRHYAGDVVYSAI
FT                   GFIDKNKDTLFQDFKRLMYNSSNPVLKNMWPEGKLSITEVTKRPLTAATLFKNSMIALV
FT                   DNLASKEPYYVRCIKPNDKKSPQIFDDERCRHQVEYLGLLENVRVRRAGFAFRQTYEKF
FT                   LHRYKMISEFTWPNHDLPSDKEAVKKLIERCGFQDDVAYGKSKIFIRTPRTLFTLEELR
FT                   AQMLVRVVLFLQKVWRGTLARMRYKRTKAALTIIRYYRRYKVKSYIHEVARRFHGVKNM
FT                   RDYGKHVKWPTPPKVLRRFEEALQSIFNRWRASQLIKTIPASDLPQVRAKVAAMEMLKG
FT                   QRADLGLQRAWEGNYLASKPDTPQTSGTFVPVANELKRKDKYMNVLFSCHVRKVNRFSK
FT                   VEDRAIFVTDRHLYKMDPTKQYKVMKTIPLYNLTGLSVSNGKDQLVVFHTKDNKDLIVC
FT                   LFSKQPTHESRIGELVGVLVNHFKSEKRHLQVNVTNPVQCSLHGKKCTVSVETRLNQPQ
FT                   PDFTKNRSGFILSVPGN"
FT   gene            2494175..2506079
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /note="gene_id=mCG10741.1"
FT   mRNA            join(2494175..2494277,2496320..2496503,2498033..2498164,
FT                   2499480..2499513,2501317..2501432,2503744..2503803,
FT                   2505026..2506079)
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /product="transmembrane protein 98, transcript variant
FT                   mCT10727"
FT                   /note="gene_id=mCG10741.1 transcript_id=mCT10727.1 created
FT                   on 03-JAN-2003"
FT   mRNA            join(<2494229..2494273,2496320..2496503,2498033..2498164,
FT                   2499480..2499513,2501317..2501432,2503744..2503803,
FT                   2505026..2505845)
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /product="transmembrane protein 98, transcript variant
FT                   mCT191002"
FT                   /note="gene_id=mCG10741.1 transcript_id=mCT191002.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2494273..2494273,2496320..2496503,2498033..2498164,
FT                   2499480..2499513,2501317..2501432,2503744..2503803,
FT                   2505026..2505233)
FT                   /codon_start=1
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /product="transmembrane protein 98, isoform CRA_a"
FT                   /note="gene_id=mCG10741.1 transcript_id=mCT191002.0
FT                   protein_id=mCP111958.0 isoform=CRA_a"
FT                   /protein_id="EDL15647.1"
FT                   /translation="ASTCSEDVSGLRLGAPGSMETVVIVAIGVLATIFLASFAALVVVC
FT                   RQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVITNPHIEAILENEDWIED
FT                   ASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVDDVVKS
FT                   MYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAA
FT                   LASEPDKSLPNPEGFLQEQSAI"
FT   CDS             join(2496373..2496503,2498033..2498164,2499480..2499513,
FT                   2501317..2501432,2503744..2503803,2505026..2505233)
FT                   /codon_start=1
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /product="transmembrane protein 98, isoform CRA_b"
FT                   /note="gene_id=mCG10741.1 transcript_id=mCT10727.1
FT                   protein_id=mCP13415.2 isoform=CRA_b"
FT                   /protein_id="EDL15648.1"
FT                   /translation="METVVIVAIGVLATIFLASFAALVVVCRQRYCRPRDLLQRYDSKP
FT                   IVDLIGAMETQSEPSELELDDVVITNPHIEAILENEDWIEDASGLMSHCIAILKICHTL
FT                   TEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVDDVVKSMYPPLDPKLLDARTTALL
FT                   LSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPDKSLPNPEGFLQE
FT                   QSAI"
FT   gene            complement(2533961..>2541881)
FT                   /locus_tag="mCG_144657"
FT                   /note="gene_id=mCG144657.0"
FT   mRNA            complement(join(2533961..2534811,2535133..2535260,
FT                   2541708..>2541881))
FT                   /locus_tag="mCG_144657"
FT                   /product="mCG144657"
FT                   /note="gene_id=mCG144657.0 transcript_id=mCT184081.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(2534685..2534811,2535133..2535260,
FT                   2541708..>2541725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144657"
FT                   /product="mCG144657"
FT                   /note="gene_id=mCG144657.0 transcript_id=mCT184081.0
FT                   protein_id=mCP105657.0"
FT                   /protein_id="EDL15649.1"
FT                   /translation="SSLPPKRTPVWFLKPTSGSSQPPVSPTPWDPTASSGLCQYPTHVA
FT                   YTQRPECKLKGSGSEFSTGMLPVCGREVRHDHKIQPPKFCASSAK"
FT   gene            2541942..2551478
FT                   /locus_tag="mCG_10739"
FT                   /note="gene_id=mCG10739.1"
FT   mRNA            join(2541942..2542121,2545613..2545702,2546481..2546746,
FT                   2547443..2547601,2548032..2548110,2551297..2551478)
FT                   /locus_tag="mCG_10739"
FT                   /product="mCG10739"
FT                   /note="gene_id=mCG10739.1 transcript_id=mCT10725.2 created
FT                   on 28-AUG-2002"
FT   CDS             join(2545614..2545702,2546481..2546746,2547443..2547601,
FT                   2548032..2548110,2551297..2551363)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10739"
FT                   /product="mCG10739"
FT                   /note="gene_id=mCG10739.1 transcript_id=mCT10725.2
FT                   protein_id=mCP13498.2"
FT                   /protein_id="EDL15650.1"
FT                   /translation="MGICMSMYTQVLVPVDADGEHQILWSRFYEGSCLNPCAGLVNCLP
FT                   PHSSALYLCHRMEARSRAPRRQLCPPGITWLALAYLLSCLLASSKAKVFSRCELAKEMH
FT                   DFGLDGYRGYNLADWVCLAYYTSGFNTNAVDHEADGSTNNGIFQISSRRWCRTLASNGP
FT                   NLCRIYCTDLLNNDLKDSIVCAMKIVQEPLGLGYWEAWRHHCQGRDLSDWVDGCDF"
FT   gene            complement(2563979..2833173)
FT                   /gene="Accn1"
FT                   /locus_tag="mCG_141259"
FT                   /note="gene_id=mCG141259.0"
FT   mRNA            complement(join(2563979..2564955,2565398..2565466,
FT                   2567207..2567286,2570631..2570722,2573768..2573921,
FT                   2575779..2575835,2578009..2578159,2633151..2633278,
FT                   2652144..2652294,2832445..2833173))
FT                   /gene="Accn1"
FT                   /locus_tag="mCG_141259"
FT                   /product="amiloride-sensitive cation channel 1, neuronal
FT                   (degenerin)"
FT                   /note="gene_id=mCG141259.0 transcript_id=mCT174214.0
FT                   created on 11-OCT-2002"
FT   CDS             complement(join(2564854..2564955,2565398..2565466,
FT                   2567207..2567286,2570631..2570722,2573768..2573921,
FT                   2575779..2575835,2578009..2578159,2633151..2633278,
FT                   2652144..2652294,2832445..2833152))
FT                   /codon_start=1
FT                   /gene="Accn1"
FT                   /locus_tag="mCG_141259"
FT                   /product="amiloride-sensitive cation channel 1, neuronal
FT                   (degenerin)"
FT                   /note="gene_id=mCG141259.0 transcript_id=mCT174214.0
FT                   protein_id=mCP97133.0"
FT                   /db_xref="GOA:B2RRQ1"
FT                   /db_xref="InterPro:IPR001873"
FT                   /db_xref="InterPro:IPR004724"
FT                   /db_xref="InterPro:IPR020903"
FT                   /db_xref="MGI:MGI:1100867"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRQ1"
FT                   /protein_id="EDL15651.1"
FT                   /translation="MSRSGGARLPATALSGPGRFRMAREQPAPAAVAAARQPGGDRSGD
FT                   RELQGPGVARRGRPSLSRTKLHGLRHMCAGRTAAGGSFQRRALWVLAFCTSLGLLLSWS
FT                   SNRLLYWLSFPSHTRVHREWSRQLPFPAVTVCNNNPLRFPRLSKGDLYYAGHWLGLLLP
FT                   NRTARPLVSELLRGDEPRRQWFRKLADFRLFLPPRHFEGISAAFMDRLGHQLEDMLLSC
FT                   KYRGELCGPHNFSSVFTKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLP
FT                   IWGETEETTFEAGVKVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTYLPPPWGEC
FT                   RSSEMGLDFFPVYSITACRIDCETRYIVENCNCRMVHMPGDAPFCTPEQHKECAEPALG
FT                   LLAEKDSNYCLCRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDI
FT                   FFEALNYETIEQKKAYEVAALLGDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLL
FT                   GKEEEEGSHDENMSTCDTMPNHSETISHTVNVPLQTALGTLEEIAC"
FT   gene            complement(3187446..3189172)
FT                   /locus_tag="mCG_147531"
FT                   /note="gene_id=mCG147531.0"
FT   mRNA            complement(3187446..3189172)
FT                   /locus_tag="mCG_147531"
FT                   /product="mCG147531"
FT                   /note="gene_id=mCG147531.0 transcript_id=mCT187794.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3188437..3188760)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147531"
FT                   /product="mCG147531"
FT                   /note="gene_id=mCG147531.0 transcript_id=mCT187794.0
FT                   protein_id=mCP109297.0"
FT                   /protein_id="EDL15652.1"
FT                   /translation="MHGRIYEVICPFSMDGISPGCQGGSLPEGREKIHQPSASHLELAP
FT                   ELTDDWPQISLHVSARKEVAERNFQAVVDNMSSGSGLFWDLLYLICPISYQTGAFLNLL
FT                   TPL"
FT   gene            complement(3242645..>3243619)
FT                   /locus_tag="mCG_48927"
FT                   /note="gene_id=mCG48927.2"
FT   mRNA            complement(3242645..>3243619)
FT                   /locus_tag="mCG_48927"
FT                   /product="mCG48927"
FT                   /note="gene_id=mCG48927.2 transcript_id=mCT49110.2 created
FT                   on 11-OCT-2002"
FT   CDS             complement(3242804..3243619)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48927"
FT                   /product="mCG48927"
FT                   /note="gene_id=mCG48927.2 transcript_id=mCT49110.2
FT                   protein_id=mCP23934.1"
FT                   /db_xref="GOA:Q3V2K0"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="MGI:MGI:3588264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V2K0"
FT                   /protein_id="EDL15653.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVSSALYNVDAGHRAVIFDRFHGV
FT                   QDIVVGEGTHFLIPWVQKPVIFDCRSQPRNIPVITGSKDLQNVNITLRILFRPVASQLP
FT                   HIYTNIGQDYDERVLPSITSEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAETARFVVEKAEQQKVAAIISAEGDAKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSQNVTYLPVGQTVPLKLP"
FT   gene            <3518201..3524057
FT                   /locus_tag="mCG_145245"
FT                   /note="gene_id=mCG145245.0"
FT   mRNA            join(<3518201..3518864,3520955..3522105,3522218..3524057)
FT                   /locus_tag="mCG_145245"
FT                   /product="mCG145245"
FT                   /note="gene_id=mCG145245.0 transcript_id=mCT184669.0
FT                   created on 05-JUN-2003"
FT   CDS             <3523566..3523946
FT                   /codon_start=1
FT                   /locus_tag="mCG_145245"
FT                   /product="mCG145245"
FT                   /note="gene_id=mCG145245.0 transcript_id=mCT184669.0
FT                   protein_id=mCP105661.0"
FT                   /protein_id="EDL15654.1"
FT                   /translation="AACSHRHIEKYLGADEKWLPQVFLETSRDSQQIHEVISLGGNYLS
FT                   SLFIAFPSLFLHRAVLLPCVSLRLLSSLTALAAQFSSQSLKHAWNSATAGTLCVFMKNV
FT                   CANNLIPIPCYEYASFYTLFMC"
FT   gene            complement(<3625361..3626179)
FT                   /locus_tag="mCG_49975"
FT                   /note="gene_id=mCG49975.1"
FT   mRNA            complement(<3625361..3626179)
FT                   /locus_tag="mCG_49975"
FT                   /product="mCG49975"
FT                   /note="gene_id=mCG49975.1 transcript_id=mCT50158.1 created
FT                   on 13-OCT-2002"
FT   CDS             complement(<3625361..3625954)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49975"
FT                   /product="mCG49975"
FT                   /note="gene_id=mCG49975.1 transcript_id=mCT50158.1
FT                   protein_id=mCP23931.1"
FT                   /protein_id="EDL15655.1"
FT                   /translation="MDLKESPSEGSLQPSSIQIFANTSTLHGIRHIFVYGPLTIRRVLW
FT                   AVAFVGSLGLLLVESSERVSYYFSYQHVTKVDEVVAQSLVFPAVTLCNLNGFRFSRLTT
FT                   NDLYHAGELLALLDVNLQIPDPHLADPTVLEALRQKANFKHYKPKQFSMLEFLHRVGHD
FT                   LKDMMLYCKFKGQECGHQDFTTVSTWLSVCSCVHS"
FT   gene            3693559..3695437
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /note="gene_id=mCG8184.2"
FT   mRNA            join(3693559..3693722,3694468..3694585,3694911..3695437)
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /product="chemokine (C-C motif) ligand 2, transcript
FT                   variant mCT7629"
FT                   /note="gene_id=mCG8184.2 transcript_id=mCT7629.1 created on
FT                   31-JUL-2002"
FT   mRNA            join(<3693595..3693722,3694468..3695434)
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /product="chemokine (C-C motif) ligand 2, transcript
FT                   variant mCT191048"
FT                   /note="gene_id=mCG8184.2 transcript_id=mCT191048.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(3693647..3693722,3694468..3694585,3694911..3695163)
FT                   /codon_start=1
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /product="chemokine (C-C motif) ligand 2, isoform CRA_b"
FT                   /note="gene_id=mCG8184.2 transcript_id=mCT7629.1
FT                   protein_id=mCP1004.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SVU3"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:98259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVU3"
FT                   /protein_id="EDL15657.1"
FT                   /translation="MQVPVMLLGLLFTVAGWSIHVLAQPDAVNAPLTCCYSFTSKMIPM
FT                   SRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFK
FT                   TASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN"
FT   CDS             <3694590..3694946
FT                   /codon_start=1
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /product="chemokine (C-C motif) ligand 2, isoform CRA_a"
FT                   /note="gene_id=mCG8184.2 transcript_id=mCT191048.0
FT                   protein_id=mCP112016.0 isoform=CRA_a"
FT                   /protein_id="EDL15656.1"
FT                   /translation="VTYPGPPWSKGFSLRTRDGPHILIVSHTLRSNGETKAKKAKAVLN
FT                   SIVSMAAVQALSTPQAYLRKPAGEAGHFESPFSTCPPPLSSTQPLHVYQTELHLTVSFL
FT                   FPQFCHQAQERGLC"
FT   gene            3703702..3705506
FT                   /gene="Ccl7"
FT                   /locus_tag="mCG_52384"
FT                   /note="gene_id=mCG52384.1"
FT   mRNA            join(3703702..3703844,3704503..3704614,3704970..3705506)
FT                   /gene="Ccl7"
FT                   /locus_tag="mCG_52384"
FT                   /product="chemokine (C-C motif) ligand 7"
FT                   /note="gene_id=mCG52384.1 transcript_id=mCT52567.1 created
FT                   on 31-JUL-2002"
FT   CDS             join(3703769..3703844,3704503..3704614,3704970..3705075)
FT                   /codon_start=1
FT                   /gene="Ccl7"
FT                   /locus_tag="mCG_52384"
FT                   /product="chemokine (C-C motif) ligand 7"
FT                   /note="gene_id=mCG52384.1 transcript_id=mCT52567.1
FT                   protein_id=mCP23932.2"
FT                   /db_xref="GOA:A9Z1Z1"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:99512"
FT                   /db_xref="UniProtKB/TrEMBL:A9Z1Z1"
FT                   /protein_id="EDL15658.1"
FT                   /translation="MRISATLLCLLLIAAAFSIQVWAQPDGPNASTCCYVKKQKIPKRN
FT                   LKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP"
FT   gene            3715808..3720940
FT                   /gene="Ccl11"
FT                   /locus_tag="mCG_8183"
FT                   /note="gene_id=mCG8183.2"
FT   mRNA            join(3715808..3716027,3719664..3719775,3720191..3720940)
FT                   /gene="Ccl11"
FT                   /locus_tag="mCG_8183"
FT                   /product="small chemokine (C-C motif) ligand 11"
FT                   /note="gene_id=mCG8183.2 transcript_id=mCT7628.1 created on
FT                   31-JUL-2002"
FT   CDS             join(3715952..3716027,3719664..3719775,3720191..3720296)
FT                   /codon_start=1
FT                   /gene="Ccl11"
FT                   /locus_tag="mCG_8183"
FT                   /product="small chemokine (C-C motif) ligand 11"
FT                   /note="gene_id=mCG8183.2 transcript_id=mCT7628.1
FT                   protein_id=mCP1016.1"
FT                   /protein_id="EDL15659.1"
FT                   /translation="MQSSTALLFLLLTVTSFTSQVLAHPGSIPTSCCFIMTSKKIPNTL
FT                   LKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP"
FT   gene            3778346..3779958
FT                   /locus_tag="mCG_114938"
FT                   /note="gene_id=mCG114938.0"
FT   mRNA            join(3778346..3778475,3779202..3779313,3779692..3779958)
FT                   /locus_tag="mCG_114938"
FT                   /product="mCG114938"
FT                   /note="gene_id=mCG114938.0 transcript_id=mCT116036.0
FT                   created on 31-JUL-2002"
FT   CDS             join(3778400..3778475,3779202..3779313,3779692..3779797)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114938"
FT                   /product="mCG114938"
FT                   /note="gene_id=mCG114938.0 transcript_id=mCT116036.0
FT                   protein_id=mCP85364.1"
FT                   /db_xref="GOA:Q149U7"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:101878"
FT                   /db_xref="UniProtKB/TrEMBL:Q149U7"
FT                   /protein_id="EDL15660.1"
FT                   /translation="MKIYAVLLCLLLIAVPVSPEKLTGPDKAPVTCCFHVLKLKIPLRV
FT                   LKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP"
FT   gene            complement(3840708..3969829)
FT                   /locus_tag="mCG_145730"
FT                   /note="gene_id=mCG145730.0"
FT   mRNA            complement(join(3840708..3840960,3841838..3841952,
FT                   3860566..3860707,3860940..3861142,3924661..3924848,
FT                   3925812..3925907,3929935..3930553,3934152..3934264,
FT                   3935466..3935537,3967537..3967667,3969639..3969829))
FT                   /locus_tag="mCG_145730"
FT                   /product="mCG145730"
FT                   /note="gene_id=mCG145730.0 transcript_id=mCT185504.0
FT                   created on 10-JUN-2003"
FT   gene            complement(3840708..3843636)
FT                   /locus_tag="mCG_8193"
FT                   /note="gene_id=mCG8193.2"
FT   mRNA            complement(join(3840708..3841059,3841838..3841952,
FT                   3843488..3843631))
FT                   /locus_tag="mCG_8193"
FT                   /product="mCG8193, transcript variant mCT185505"
FT                   /note="gene_id=mCG8193.2 transcript_id=mCT185505.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(3840709..3840960,3841838..3841952,
FT                   3843488..3843636))
FT                   /locus_tag="mCG_8193"
FT                   /product="mCG8193, transcript variant mCT7613"
FT                   /note="gene_id=mCG8193.2 transcript_id=mCT7613.0 created on
FT                   10-JUN-2003"
FT   CDS             complement(join(3840873..3840960,3841838..3841952,
FT                   3843488..3843563))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8193"
FT                   /product="mCG8193, isoform CRA_b"
FT                   /note="gene_id=mCG8193.2 transcript_id=mCT7613.0
FT                   protein_id=mCP1010.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q0VB35"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:98258"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VB35"
FT                   /protein_id="EDL15663.1"
FT                   /translation="MKPTAMALMCLLLAAVWIQDVDSKSMLTVSNSCCLNTLKKELPLK
FT                   FIQCYRKMGSSCPDPPAVVFRLNKGRESCASTNKTWVQNHLKKVNPC"
FT   CDS             complement(join(3840993..3841059,3841838..3841952,
FT                   3843488..3843563))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8193"
FT                   /product="mCG8193, isoform CRA_a"
FT                   /note="gene_id=mCG8193.2 transcript_id=mCT185505.0
FT                   protein_id=mCP106762.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1AVL8"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:98258"
FT                   /db_xref="UniProtKB/TrEMBL:B1AVL8"
FT                   /protein_id="EDL15662.1"
FT                   /translation="MKPTAMALMCLLLAAVWIQDVDSKSMLTVSNSCCLNTLKKELPLK
FT                   FIQCYRKMGSSCPDPPAVVVRSSGVPGLTEAEKTVTDSSE"
FT   CDS             complement(join(3860640..3860707,3860940..3861142,
FT                   3924661..3924680))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145730"
FT                   /product="mCG145730"
FT                   /note="gene_id=mCG145730.0 transcript_id=mCT185504.0
FT                   protein_id=mCP106763.0"
FT                   /protein_id="EDL15661.1"
FT                   /translation="MMLYKRSVFWSATSLDEVDLRFPERKLMPMVECSYMLIKLPKDKE
FT                   NGNGKCRRLSSVSQDLNRAGPVLCVPAIRVITMAIMEIKEHHRKHLQYSRG"
FT   gene            4053183..4110550
FT                   /gene="Tmem132e"
FT                   /locus_tag="mCG_49309"
FT                   /note="gene_id=mCG49309.2"
FT   mRNA            join(4053183..4053397,4098468..4098925,4099202..4099404,
FT                   4101127..4101273,4101524..4101716,4102464..4102607,
FT                   4104654..4104859,4106685..4106973,4107595..4107786,
FT                   4108492..4110550)
FT                   /gene="Tmem132e"
FT                   /locus_tag="mCG_49309"
FT                   /product="transmembrane protein 132E"
FT                   /note="gene_id=mCG49309.2 transcript_id=mCT49492.2 created
FT                   on 13-OCT-2002"
FT   CDS             join(4053331..4053397,4098468..4098925,4099202..4099404,
FT                   4101127..4101273,4101524..4101716,4102464..4102607,
FT                   4104654..4104859,4106685..4106973,4107595..4107786,
FT                   4108492..4109541)
FT                   /codon_start=1
FT                   /gene="Tmem132e"
FT                   /locus_tag="mCG_49309"
FT                   /product="transmembrane protein 132E"
FT                   /note="gene_id=mCG49309.2 transcript_id=mCT49492.2
FT                   protein_id=mCP23928.2"
FT                   /protein_id="EDL15664.1"
FT                   /translation="MAPGMSGRRGAALLCLSVLLAHAASRSHPASPSPPGTQASPILPV
FT                   SYRLSHTRLAFFLKEARPLTPAAINGSLQRSEPFVVFQTKELPVLNVSLGPFSTSQVVA
FT                   RELLQPSSTLDIPERLTVNWKVRAFIVRARVPASQPVAQVLFYVAGRDWDDFGVTERLP
FT                   CVRLHAFRDAREHPLLRIGSISLFRPPPRRAVQEHRLDSNLMIRLPDRPLRPGEVLSIL
FT                   LYLAPNSSSAASPSVEHFTLRVKAKKGVTLLGTKSRSGQWRVTSELLTGAKHSTATVDV
FT                   AWALDTPLPPWEGQGPLEILQLDFEMENFTSQSVKRRIMWHIDYRGHSALPDLERAVTE
FT                   LTVIQRDVQAILPLAMDTEIINTAILTGRTVAIPVKVIAIEVTGLVLDVSDLVECQSHS
FT                   EDIIKVSSSCDYVFVSGKESRGSMNARVTFRYDVLSAPLEMTVWVPKLPLHIELSDARL
FT                   SQVKGWRVPILPDRRSARESEDEEEEEEERRQSANRGCTLQYQHATLQVFTQFHTTSSE
FT                   GTDQVVTMLGPDWLVEVTDLVSDFMRVGDPRVAHLVDSNTLAGLEPGTTPFKVVSPLTE
FT                   AVLGETLLTVTEEKVSITQLQAQVVASLTLSLRPSPGSSHTILATTAAQPTLSLVKQEA
FT                   LLSLWLSYSDGTTAPLSLYSSRDYGLLVSSLDERVATVTQDKAFPLVVAEAEGSGDLLR
FT                   AELTISESCQKTKRKSVLATTPVSLRVHFGRDEEDPTYDYPGPSQPGPGGGEDEARGAG
FT                   PPGTAIPAGEVPGLGTAGPVPPTEDYLPLPTGFLQMPRGLTDLEIGMYALLGVFCLAIL
FT                   VFLINCIVFVLRYRHKRIPPEGQTSMDHSHHWVFLGNGQPLRVQGELSPPAGSALETVP
FT                   ACCHGDHHSSGSSQTSVQSQVHGRGDGSSGGSARDQTEDPASSPTSKRKRVKFTTFTTL
FT                   PTEELAYDSVPAGEEEDEEEDLGWGCPDVAGTTRPTPPPDLHNYMRRIKDIA"
FT   gene            4297623..4300579
FT                   /locus_tag="mCG_1050993"
FT                   /note="gene_id=mCG1050993.0"
FT   mRNA            join(4297623..4297755,4297846..4297971,4298619..4300579)
FT                   /locus_tag="mCG_1050993"
FT                   /product="mCG1050993"
FT                   /note="gene_id=mCG1050993.0 transcript_id=mCT194782.0
FT                   created on 27-JAN-2005"
FT   CDS             4299296..4299559
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050993"
FT                   /product="mCG1050993"
FT                   /note="gene_id=mCG1050993.0 transcript_id=mCT194782.0
FT                   protein_id=mCP115811.0"
FT                   /db_xref="MGI:MGI:3651541"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R5E2"
FT                   /protein_id="EDL15665.1"
FT                   /translation="MEAFLGAEVLPFICSAEQSASEPERQQTRQVVSEHTHNTAEESGQ
FT                   QLQTKQGKGQPGPLSHVRRSLARGSGGSLFPVFALCQLLQAQ"
FT   gene            complement(4383261..>4428351)
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /note="gene_id=mCG8191.2"
FT   mRNA            complement(join(4383261..4383445,4383946..4384018,
FT                   4386392..4386494,4387825..4387958,4400343..4400490,
FT                   4401120..4401216,4403652..4403734,4405305..4405464,
FT                   4406039..4406149,4417663..4417766,4418991..4419164,
FT                   4424379..4424513,4426217..4426280,4428051..>4428351))
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /product="chaperonin subunit 6b (zeta), transcript variant
FT                   mCT191013"
FT                   /note="gene_id=mCG8191.2 transcript_id=mCT191013.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4383261..4383445,4383946..4384018,
FT                   4386392..4386494,4387825..4387958,4400343..4400490,
FT                   4401120..4401216,4403652..4403734,4405305..4405464,
FT                   4406039..4406149,4417663..4417766,4418991..4419164,
FT                   4424379..4424513,4426217..4426280,4428120..4428335))
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /product="chaperonin subunit 6b (zeta), transcript variant
FT                   mCT7612"
FT                   /note="gene_id=mCG8191.2 transcript_id=mCT7612.1 created on
FT                   31-JUL-2002"
FT   CDS             complement(join(4383373..4383445,4383946..4384018,
FT                   4386392..4386494,4387825..4387958,4400343..4400490,
FT                   4401120..4401216,4403652..4403734,4405305..4405464,
FT                   4406039..4406149,4417663..4417766,4418991..4419164,
FT                   4424379..4424513,4426217..4426280,4428120..4428256))
FT                   /codon_start=1
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /product="chaperonin subunit 6b (zeta), isoform CRA_b"
FT                   /note="gene_id=mCG8191.2 transcript_id=mCT7612.1
FT                   protein_id=mCP1009.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q497N0"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012722"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="MGI:MGI:1329013"
FT                   /db_xref="UniProtKB/TrEMBL:Q497N0"
FT                   /protein_id="EDL15667.1"
FT                   /translation="MAAIKIANPGAEVTRSQAALAVNICAARGLQDVLRPTLGPKGALK
FT                   MLVSGAGDIKLTKDGNVLLHEMQIQHPTASIIAKVAAAQDHVTGDGTTSNVLIIGELLK
FT                   QADLYISEGLHPRIITEGFDVAKTKALEVLDEIKVQKEMKREILLDVARTSLQTKVHAE
FT                   LADILTEAVVDSVLAIRRPGVPIDLFMVEIVEMRHKSETDTQLIRGLVLDHGARHPRMR
FT                   KQVRDAYILTCNVSLEYEKTEVSSGFFYKTVEEKEKLVKAERKFIEDRVQKIIDLKQKV
FT                   CAESNKGFVVINQKGIDPVSLEMLAKHNIVALRRAKRRNLERLTLACGGLAVNSFEGLS
FT                   EECLGHAGLVFEYALGEEKFTFIEDCVNPLSVTLLVKGPNKHTLIQIKDALRDGLRAVK
FT                   NAIEDGCVVPGAGAVEVAIAEALVNYKHRVQGRVRLGIQAFADALLIIPKVLAQNSGYD
FT                   LQETLIKIQTKHAESKELLGIDLNTGEPMAAAEAGIWDNYCVKKHLLHSCTVIATNILL
FT                   VDEIMRAGMSSLRD"
FT   CDS             complement(join(4383373..4383445,4383946..4384018,
FT                   4386392..4386494,4387825..4387958,4400343..4400490,
FT                   4401120..4401216,4403652..4403734,4405305..4405464,
FT                   4406039..4406149,4417663..4417766,4418991..4419164,
FT                   4424379..4424513,4426217..4426280,4428051..>4428115))
FT                   /codon_start=1
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /product="chaperonin subunit 6b (zeta), isoform CRA_a"
FT                   /note="gene_id=mCG8191.2 transcript_id=mCT191013.0
FT                   protein_id=mCP111992.0 isoform=CRA_a"
FT                   /protein_id="EDL15666.1"
FT                   /translation="DAARVCGVSRLTLILMLISENLLVSGAGDIKLTKDGNVLLHEMQI
FT                   QHPTASIIAKVAAAQDHVTGDGTTSNVLIIGELLKQADLYISEGLHPRIITEGFDVAKT
FT                   KALEVLDEIKVQKEMKREILLDVARTSLQTKVHAELADILTEAVVDSVLAIRRPGVPID
FT                   LFMVEIVEMRHKSETDTQLIRGLVLDHGARHPRMRKQVRDAYILTCNVSLEYEKTEVSS
FT                   GFFYKTVEEKEKLVKAERKFIEDRVQKIIDLKQKVCAESNKGFVVINQKGIDPVSLEML
FT                   AKHNIVALRRAKRRNLERLTLACGGLAVNSFEGLSEECLGHAGLVFEYALGEEKFTFIE
FT                   DCVNPLSVTLLVKGPNKHTLIQIKDALRDGLRAVKNAIEDGCVVPGAGAVEVAIAEALV
FT                   NYKHRVQGRVRLGIQAFADALLIIPKVLAQNSGYDLQETLIKIQTKHAESKELLGIDLN
FT                   TGEPMAAAEAGIWDNYCVKKHLLHSCTVIATNILLVDEIMRAGMSSLRD"
FT   gene            4428383..4429956
FT                   /gene="Ccdc16"
FT                   /locus_tag="mCG_8189"
FT                   /note="gene_id=mCG8189.0"
FT   mRNA            4428383..4429956
FT                   /gene="Ccdc16"
FT                   /locus_tag="mCG_8189"
FT                   /product="coiled-coil domain containing 16"
FT                   /note="gene_id=mCG8189.0 transcript_id=mCT7618.0 created on
FT                   31-JUL-2002"
FT   CDS             4428401..4429492
FT                   /codon_start=1
FT                   /gene="Ccdc16"
FT                   /locus_tag="mCG_8189"
FT                   /product="coiled-coil domain containing 16"
FT                   /note="gene_id=mCG8189.0 transcript_id=mCT7618.0
FT                   protein_id=mCP1018.1"
FT                   /protein_id="EDL15668.1"
FT                   /translation="MASSTSTRTPAGKRVVNQEELRRLMREKQRLSTNRKRIESPFAKY
FT                   NRLGQLSCALCNTPVKSELLWQTHVLGKQHRERVAELKGAKGATQGPSTGTVPQATKRR
FT                   ATDVESQDAKKAKASAGPQVQPSTSASSANLDAARAAPSKPGLGLLPDYDDEEEEEEEG
FT                   GGEERRDSSKHLPDAQGKEHSLASPRETTSNVLPNDPFNTNPPKAPLVPHSGSIEKAEI
FT                   HEKVVERRENTAEALPEGFFDDPEVDAKVRKVDAPKDQMDKEWDEFQKAMRQVNTISEA
FT                   IVAEEDEEGRLDRQIGEIDEQIECYRRVEKLRNRQDEIKNKLKEVLTIKELQKKEEENV
FT                   DSDDEGELQDLLSQDWRVKGALL"
FT   gene            4445230..4466116
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /note="gene_id=mCG8187.1"
FT   mRNA            join(4445230..4445289,4447254..4447807,4449223..4449366,
FT                   4451536..4451736,4452672..4452823,4453455..4453621,
FT                   4453725..4453802,4454381..4454549,4455945..4456100,
FT                   4457782..4457913,4458412..4458491,4459273..4459360,
FT                   4459617..4459694,4459936..4460059,4461214..4461356,
FT                   4461682..4461756,4462164..4462310,4463330..4463528,
FT                   4464084..4464205,4465189..4466116)
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /product="ligase III, DNA, ATP-dependent, transcript
FT                   variant mCT7617"
FT                   /note="gene_id=mCG8187.1 transcript_id=mCT7617.1 created on
FT                   31-JUL-2002"
FT   mRNA            join(4445230..4445289,4447254..4447807,4449223..4449366,
FT                   4451536..4451736,4452672..4452823,4453455..4453621,
FT                   4453725..4453802,4454381..4454549,4455945..4456100,
FT                   4457782..4457913,4458412..4458491,4459273..4459360,
FT                   4459617..4459694,4459936..4460059,4461214..4461356,
FT                   4461682..4461756,4462164..4462310,4463330..4463528,
FT                   4464084..4464205,4464407..4464561)
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /product="ligase III, DNA, ATP-dependent, transcript
FT                   variant mCT171279"
FT                   /note="gene_id=mCG8187.1 transcript_id=mCT171279.0 created
FT                   on 31-JUL-2002"
FT   CDS             join(4447258..4447807,4449223..4449366,4451536..4451736,
FT                   4452672..4452823,4453455..4453621,4453725..4453802,
FT                   4454381..4454549,4455945..4456100,4457782..4457913,
FT                   4458412..4458491,4459273..4459360,4459617..4459694,
FT                   4459936..4460059,4461214..4461356,4461682..4461756,
FT                   4462164..4462310,4463330..4463528,4464084..4464205,
FT                   4465189..4465422)
FT                   /codon_start=1
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /product="ligase III, DNA, ATP-dependent, isoform CRA_a"
FT                   /note="gene_id=mCG8187.1 transcript_id=mCT7617.1
FT                   protein_id=mCP1014.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q80ZH7"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="MGI:MGI:109152"
FT                   /db_xref="UniProtKB/TrEMBL:Q80ZH7"
FT                   /protein_id="EDL15669.1"
FT                   /translation="MTLAFKILFPRNLCALGRKELCLFPEQNRWAAISQFSQWSETNLL
FT                   GGCCLLQRRKPVLALQRGHLRPRATHLTFWPGSHVGLCTGPCAMAEQRFCVDYAKRGTA
FT                   GCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTE
FT                   LEGWEELEDNEKEQISQHIADLSSKAAATPKKKAAVQAKLTTTGQVTSPVKGASFITST
FT                   NPRKFSGFSAAKPNNSEQAPSSPAPGTSLSASKCDPKHKDCLLREFRKLCAMVAENPSY
FT                   NTKTQIIHDFLQKGSTGDGFHGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNP
FT                   DDMARDLEQGDVSETIRIFFEQSKSFPPAAKSLLTIQEVDAFLLHLSKLTKEDEQQQAL
FT                   QDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLH
FT                   NEQEVEKDPGRRRALRVQASLMTPVQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQ
FT                   VHKKGDHFSYFSRSLKPVLPHKVAHFKDYIPKAFPGGQSMILDSEVLLIDNNTGKPLPF
FT                   GTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIRNRIMFSEM
FT                   KQVTKASDLADMINRVIREGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADL
FT                   VVLGAFYGQGSKGGMMSIFLMGCYDPDSQKWCTVTKCAGGHDDATLARLQKELVMVKIS
FT                   KDPSKIPSWLKINKIYYPDFIVPDPKKAAVWEITGAEFSRSEAHTADGISIRFPRCTRI
FT                   RDDKDWKSATNLPQLKELYQLSKDKADFAVVAGDEASPTTGGSSGENEGTAGSAGPCKG
FT                   PPSKSSASAKTTEQKLNSPSSRGGIKPIPKHSPMKPGEKLAVKSSPVKVGMKRKATDET
FT                   PCLKKVLLDVFTGVRLYLPPSTPDFKRLKRYFVAFDGDLVQEFDMGSATHVLGNREKNT
FT                   DAQLVSSEWIWACIRKRRLIAPC"
FT   CDS             join(4447258..4447807,4449223..4449366,4451536..4451736,
FT                   4452672..4452823,4453455..4453621,4453725..4453802,
FT                   4454381..4454549,4455945..4456100,4457782..4457913,
FT                   4458412..4458491,4459273..4459360,4459617..4459694,
FT                   4459936..4460059,4461214..4461356,4461682..4461756,
FT                   4462164..4462310,4463330..4463528,4464084..4464205,
FT                   4464407..4464463)
FT                   /codon_start=1
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /product="ligase III, DNA, ATP-dependent, isoform CRA_b"
FT                   /note="gene_id=mCG8187.1 transcript_id=mCT171279.0
FT                   protein_id=mCP94198.0 isoform=CRA_b"
FT                   /db_xref="GOA:B1AT03"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="MGI:MGI:109152"
FT                   /db_xref="UniProtKB/TrEMBL:B1AT03"
FT                   /protein_id="EDL15670.1"
FT                   /translation="MTLAFKILFPRNLCALGRKELCLFPEQNRWAAISQFSQWSETNLL
FT                   GGCCLLQRRKPVLALQRGHLRPRATHLTFWPGSHVGLCTGPCAMAEQRFCVDYAKRGTA
FT                   GCKKCKEKIVKGVCRIGKVVPNPFSESGGDMKEWYHIKCMFEKLERARATTKKIEDLTE
FT                   LEGWEELEDNEKEQISQHIADLSSKAAATPKKKAAVQAKLTTTGQVTSPVKGASFITST
FT                   NPRKFSGFSAAKPNNSEQAPSSPAPGTSLSASKCDPKHKDCLLREFRKLCAMVAENPSY
FT                   NTKTQIIHDFLQKGSTGDGFHGDVYLTVKLLLPGVIKSVYNLNDKQIVKLFSRIFNCNP
FT                   DDMARDLEQGDVSETIRIFFEQSKSFPPAAKSLLTIQEVDAFLLHLSKLTKEDEQQQAL
FT                   QDIASRCTANDLKCIIRLIKHDLKMNSGAKHVLDALDPNAYEAFKASRNLQDVVERVLH
FT                   NEQEVEKDPGRRRALRVQASLMTPVQPMLAEACKSIEYAMKKCPNGMFSEIKYDGERVQ
FT                   VHKKGDHFSYFSRSLKPVLPHKVAHFKDYIPKAFPGGQSMILDSEVLLIDNNTGKPLPF
FT                   GTLGVHKKAAFQDANVCLFVFDCIYFNDVSLMDRPLCERRKFLHDNMVEIRNRIMFSEM
FT                   KQVTKASDLADMINRVIREGLEGLVLKDVKGTYEPGKRHWLKVKKDYLNEGAMADTADL
FT                   VVLGAFYGQGSKGGMMSIFLMGCYDPDSQKWCTVTKCAGGHDDATLARLQKELVMVKIS
FT                   KDPSKIPSWLKINKIYYPDFIVPDPKKAAVWEITGAEFSRSEAHTADGISIRFPRCTRI
FT                   RDDKDWKSATNLPQLKELYQLSKDKADFAVVAGDEASPTTGGSSGENEGTAGSAGPCKG
FT                   PPSKSSASAKTTEQKLNSPSSRGGIKPIPKHSPMKPGEKLAVKSSPVKVGMKRKATDET
FT                   PCLKKRRRASRQRGRKAMQTGRR"
FT   gene            complement(4469448..>4535293)
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /note="gene_id=mCG8186.1"
FT   mRNA            complement(join(4469448..4470103,4472427..4472450,
FT                   4473922..4474132,4474942..4475025,4476314..4476757,
FT                   4482328..4482515,4535081..>4535293))
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, transcript variant mCT7616"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT7616.1 created on
FT                   31-JUL-2002"
FT   mRNA            complement(join(4469515..4470103,4472427..4472450,
FT                   4473922..4474132,4476314..4476724,4482328..4482515,
FT                   4492642..4492942))
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, transcript variant mCT171278"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT171278.0 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(4469922..4470103,4472427..4472450,
FT                   4473922..4474132,4474942..4475025,4476314..4476757,
FT                   4482328..4482515,4535081..>4535291))
FT                   /codon_start=1
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, isoform CRA_c"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT7616.1
FT                   protein_id=mCP1017.1 isoform=CRA_c partial"
FT                   /protein_id="EDL15673.1"
FT                   /translation="RTGGAHAEPRGTGLVGVDFLGPPVRMWFGHPGAPQRGVAAAADPA
FT                   APLPEWPRSGSGLCRPRCGPAASAADFIMWASCCNWFCLDGQPEEAPPPQGARTQAYSN
FT                   PGYSSFPSPTGSEPSCKACGVHFASTTRKLTRSPVSCSKQQTCLDCKKNFCMTCSSQEG
FT                   NGPRLCLLCLRFRATAFQREELMKMKVKDLRDYLSLHDISTEMCREKEELVFLVLGQQP
FT                   VISEADRTRVPHLPQAFPEQQAFLTQPQTSTVPPTSPGLPSSPAQVTSVPLAQDQETQQ
FT                   AVGHVSQDHEEPIFPESTARVPTEDETQSVDSEDSFVPGRRASLSDLTHLEDIEGLTVR
FT                   QLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGNEDQNGGAVPSGLEENL
FT                   CKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHVFRS"
FT   CDS             complement(join(4469922..4470103,4472427..4472450,
FT                   4473922..4474132,4476314..4476724,4482328..4482507))
FT                   /codon_start=1
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, isoform CRA_b"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT171278.0
FT                   protein_id=mCP94196.0 isoform=CRA_b partial"
FT                   /db_xref="GOA:Q148A8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:1914588"
FT                   /db_xref="UniProtKB/TrEMBL:Q148A8"
FT                   /protein_id="EDL15672.1"
FT                   /translation="MWASCCNWFCLDGQPEEAPPPQGARTQAYSNPGYSSFPSPTGSEP
FT                   SCKACGVHFASTTRKQTCLDCKKNFCMTCSSQEGNGPRLCLLCLRFRATAFQREELMKM
FT                   KVKDLRDYLSLHDISTEMCREKEELVFLVLGQQPVISEADRTRVPHLPQAFPEQQAFLT
FT                   QPQTSTVPPTSPGLPSSPAQVTSVPLAQDQETQQSVDSEDSFVPGRRASLSDLTHLEDI
FT                   EGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGNEDQNGGAVPS
FT                   GLEENLCKICMDSPIDCVLLECGHMVTCTKCGKRMNECPICRQYVIRAVHVFRS"
FT   mRNA            complement(join(4471336..4471451,4472427..4472450,
FT                   4473922..4474132,4476314..4476724,4482328..4482515,
FT                   4492642..4492956))
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, transcript variant mCT171277"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT171277.0 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(4471396..4471451,4472427..4472450,
FT                   4473922..4474132,4476314..4476724,4482328..4482507))
FT                   /codon_start=1
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, isoform CRA_a"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT171277.0
FT                   protein_id=mCP94197.0 isoform=CRA_a"
FT                   /protein_id="EDL15671.1"
FT                   /translation="MWASCCNWFCLDGQPEEAPPPQGARTQAYSNPGYSSFPSPTGSEP
FT                   SCKACGVHFASTTRKQTCLDCKKNFCMTCSSQEGNGPRLCLLCLRFRATAFQREELMKM
FT                   KVKDLRDYLSLHDISTEMCREKEELVFLVLGQQPVISEADRTRVPHLPQAFPEQQAFLT
FT                   QPQTSTVPPTSPGLPSSPAQVTSVPLAQDQETQQSVDSEDSFVPGRRASLSDLTHLEDI
FT                   EGLTVRQLKEILARNFVNYKGCCEKWELMERVTRLYKDQKGLQHLVSGNEDQNASHLLW
FT                   EVFFDLMFHSYV"
FT   gene            complement(4540460..4554249)
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /note="gene_id=mCG8185.2"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545224..4545294,4545409..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553604..4553665,
FT                   4553972..4554249))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT171275"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171275.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547493..4547574,4553326..4553444,4553604..4553665,
FT                   4553972..4554249))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT171274"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171274.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4546494..4546589,4547100..4547234,4547493..4547574,
FT                   4553326..4553444,4553604..4553665,4553972..4554249))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT171273"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171273.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545394..4545484,4546494..4546589,4547100..4547234,
FT                   4547493..4547574,4553326..4553444,4553604..4553665,
FT                   4553972..4554249))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT171276"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171276.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553326..4553444,
FT                   4553604..4553665,4553972..4554244))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT7619"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT7619.2 created on
FT                   11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553604..4553665,
FT                   4553972..>4554216))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT191049"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191049.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4542760..4543046,4543210..4543377,
FT                   4545224..4545294,4545409..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553326..4553444,
FT                   4553604..4553665,4553972..>4554223))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT191050"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191050.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4542760..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553303..4553444,
FT                   4553604..4553665,4553972..>4554223))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT191051"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191051.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545409..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553326..4553444,
FT                   4553604..4553665,4553972..>4554140))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_d"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191050.0
FT                   protein_id=mCP112018.0 isoform=CRA_d"
FT                   /protein_id="EDL15677.1"
FT                   /translation="VELRNAQSGGLGERPSDREPPGHPGFAGTMGMLRAGLCPGLTEET
FT                   VQLLRGRKIKTVADLAAADLEEVAQKCGLSYKALVALRRVLLAQFSAFPLNGADLYEEL
FT                   KTSTAILSTGIGSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANVAHSLQQNVLY
FT                   VDSNGGMTASRLLQLLQARTQDEEKQASALQRIQVVRSFDIFRMLDMLQDLRGTIAQQE
FT                   ATSSGAVKVVIVDSVTAVAAPLLGGLALMMQLARELKILARDLGVAVVVTNHLTRDWDG
FT                   RRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTGLQEMIDIGTLG
FT                   TEEQSPELPGKQT"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547493..4547574,4553326..4553444,4553604..4553665,
FT                   4553972..4554053))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171274.1
FT                   protein_id=mCP94195.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9EPC0"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261809"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EPC0"
FT                   /protein_id="EDL15674.1"
FT                   /translation="MGMLRAGLCPGLTEETVQLLRGRKIKTVADLAAADLEEVAQKCGL
FT                   SYKALVALRRVLLAQFSAFPLNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTE
FT                   IVGGPGSGKTQASALQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVVIVDSV
FT                   TAVAAPLLGGQQREGLALMMQLARELKILARDLGVAVVVTNHLTRDWDGRRFKPALGRS
FT                   WSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTGLQEMIDIGTLGTEEQSPELPG
FT                   KQT"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4546494..4546589,4547100..4547234,4547493..4547574,
FT                   4553326..4553444,4553604..4553665,4553972..4554053))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_f"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171273.1
FT                   protein_id=mCP94194.1 isoform=CRA_f"
FT                   /db_xref="GOA:Q9EP85"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261809"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EP85"
FT                   /protein_id="EDL15679.1"
FT                   /translation="MGMLRAGLCPGLTEETVQLLRGRKIKTVADLAAADLEEVAQKCGL
FT                   SYKALVALRRVLLAQFSAFPLNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTE
FT                   IVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMTASRLLQLLQARTQDEEKQASA
FT                   LQRIQVVRSFDIFRMLDMLQDLRGTIAQQVTNHLTRDWDGRRFKPALGRSWSFVPSTRI
FT                   LLDVTEGAGTLGSSQRTVCLTKSPRQPTGLQEMIDIGTLGTEEQSPELPGKQT"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553326..4553444,
FT                   4553604..4553665,4553972..4554053))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_h"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT7619.2
FT                   protein_id=mCP1012.2 isoform=CRA_h"
FT                   /db_xref="GOA:Q9EQS6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQS6"
FT                   /protein_id="EDL15681.1"
FT                   /translation="MGMLRAGLCPGLTEETVQLLRGRKIKTVADLAAADLEEVAQKCGL
FT                   SYKALVALRRVLLAQFSAFPLNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTE
FT                   IVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMTASRLLQLLQARTQDEEKQASA
FT                   LQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVVIVDSVTAVAAPLLGGQQRE
FT                   GLALMMQLARELKILARDLGVAVVVTNHLTRDWDGRRFKPALGRSWSFVPSTRILLDVT
FT                   EGAGTLGSSQRTVCLTKSPRQPTGLQEMIDIGTLGTEEQSPELPGKQT"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553604..>4553629))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191049.0
FT                   protein_id=mCP112017.0 isoform=CRA_c"
FT                   /protein_id="EDL15676.1"
FT                   /translation="PRSVACPTSLDKLLDAGLYTGEVTEIVGGPGSGKTQVCLCVAANV
FT                   AHSLQQNVLYVDSNGGMTASRLLQLLQARTQDEEKQASALQRIQVVRSFDIFRMLDMLQ
FT                   DLRGTIAQQEATSSGAVKVVIVDSVTAVAAPLLGGQQREGLALMMQLARELKILARDLG
FT                   VAVVVTNHLTRDWDGRRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPR
FT                   QPTGLQEMIDIGTLGTEEQSPELPGKQT"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553303..>4553370))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_e"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191051.0
FT                   protein_id=mCP112019.0 isoform=CRA_e"
FT                   /protein_id="EDL15678.1"
FT                   /translation="GTEDFHGHPVHRHRKVCMRTWTSLDKLLDAGLYTGEVTEIVGGPG
FT                   SGKTQVCLCVAANVAHSLQQNVLYVDSNGGMTASRLLQLLQARTQDEEKQASALQRIQV
FT                   VRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVVIVDSVTAVAAPLLGGQQREGLALMM
FT                   QLARELKILARDLGVAVVVTNHLTRDWDGRRFKPALGRSWSFVPSTRILLDVTEGAGTL
FT                   GSSQRTVCLTKSPRQPTGLQEMIDIGTLGTEEQSPELPGKQT"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545409..4545484,4546494..4546589,
FT                   4547100..4547159))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171275.1
FT                   protein_id=mCP94193.1 isoform=CRA_b"
FT                   /protein_id="EDL15675.1"
FT                   /translation="MTASRLLQLLQARTQDEEKQASALQRIQVVRSFDIFRMLDMLQDL
FT                   RGTIAQQEATSSGAVKVVIVDSVTAVAAPLLGGLALMMQLARELKILARDLGVAVVVTN
FT                   HLTRDWDGRRFKPALGRSWSFVPSTRILLDVTEGAGTLGSSQRTVCLTKSPRQPTGLQE
FT                   MIDIGTLGTEEQSPELPGKQT"
FT   CDS             complement(join(4543343..4543377,4545394..4545484,
FT                   4546494..4546589,4547100..4547234,4547493..4547574,
FT                   4553326..4553444,4553604..4553665,4553972..4554053))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_g"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171276.1
FT                   protein_id=mCP94192.1 isoform=CRA_g"
FT                   /db_xref="GOA:Q9EPA9"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261809"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EPA9"
FT                   /protein_id="EDL15680.1"
FT                   /translation="MGMLRAGLCPGLTEETVQLLRGRKIKTVADLAAADLEEVAQKCGL
FT                   SYKALVALRRVLLAQFSAFPLNGADLYEELKTSTAILSTGIGSLDKLLDAGLYTGEVTE
FT                   IVGGPGSGKTQVCLCVAANVAHSLQQNVLYVDSNGGMTASRLLQLLQARTQDEEKQASA
FT                   LQRIQVVRSFDIFRMLDMLQDLRGTIAQQEATSSGAVKVVIVDSVTAVAAPLLGGQQRE
FT                   GDQPLDSRLGW"
FT   gene            4555708..4564451
FT                   /locus_tag="mCG_8190"
FT                   /note="gene_id=mCG8190.1"
FT   mRNA            join(4555708..4555986,4561203..4561572,4562245..4562481,
FT                   4563171..4564451)
FT                   /locus_tag="mCG_8190"
FT                   /product="mCG8190"
FT                   /note="gene_id=mCG8190.1 transcript_id=mCT7611.1 created on
FT                   28-AUG-2002"
FT   CDS             join(4555781..4555986,4561203..4561572,4562245..4562481,
FT                   4563171..4563323)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8190"
FT                   /product="mCG8190"
FT                   /note="gene_id=mCG8190.1 transcript_id=mCT7611.1
FT                   protein_id=mCP1011.2"
FT                   /db_xref="GOA:B2RQ03"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1926169"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQ03"
FT                   /protein_id="EDL15682.1"
FT                   /translation="MATVFCKVGGGEEAVPKKEALNVINVIDQLPKPCPNPKFINRSMA
FT                   TKGLLLPSRRSLASFSEEENTDVMMHMPVEDSEYSSDDTSMSPIPSTLMNPIKMAVTQP
FT                   NSSFFAGILEGELNKLSLASVVKNTEKDNLAICPRSSKSQIATRGLLDLDNPALDTDTS
FT                   STRSESSVVLDVPEVPFICEHTVGDSTAVISWTYAAGKQQVSFYQVLLQEATKPADKDT
FT                   PKIKTRPWIFNKILGTTVKLMELKSNTSYCLTVRAANTAGVGKWCKPYKFATVSTDFNS
FT                   FPETNPIQVTVQRKQPHRRTVSMTMEEMRRLEDLEYLYPY"
FT   gene            complement(4564418..4576926)
FT                   /gene="Nle1"
FT                   /locus_tag="mCG_8192"
FT                   /note="gene_id=mCG8192.1"
FT   mRNA            complement(join(4564418..4564701,4565208..4565278,
FT                   4565360..4565519,4566646..4566848,4567795..4567841,
FT                   4567945..4568080,4568497..4568680,4569790..4569992,
FT                   4570777..4570823,4570943..4571078,4571505..4571644,
FT                   4573461..4573537,4573828..4573925,4574057..4574133,
FT                   4574975..4575054,4576110..4576327,4576649..4576792,
FT                   4576896..4576926))
FT                   /gene="Nle1"
FT                   /locus_tag="mCG_8192"
FT                   /product="notchless homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG8192.1 transcript_id=mCT7610.2 created on
FT                   13-OCT-2002"
FT   CDS             complement(join(4564689..4564701,4565208..4565278,
FT                   4565360..4565519,4566646..4566848,4567795..4567841,
FT                   4567945..4568080,4568497..4568680,4569790..4569992,
FT                   4570777..4570823,4570943..4571078,4571505..4571644,
FT                   4573461..4573537,4573828..4573925,4574057..4574133,
FT                   4574975..4575054,4576110..4576327,4576649..4576792,
FT                   4576896..4576913))
FT                   /codon_start=1
FT                   /gene="Nle1"
FT                   /locus_tag="mCG_8192"
FT                   /product="notchless homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG8192.1 transcript_id=mCT7610.2
FT                   protein_id=mCP1013.2"
FT                   /protein_id="EDL15683.1"
FT                   /translation="MAAAVVEEAAAGDVQRLLVQFQDEGGQLLGSPFDVPVDITPDKLQ
FT                   LVCNALLAQEEPLPLAFYVHDAEIVSSLGKTLESQSVETEKIVDIIYQPQAVFRVRAVT
FT                   RCTSSLEGHSEAVISVAFSPTGKYLASGSGDTTVRFWDLSTETPHFTCKGHRHWVLSIS
FT                   WSPDGKKLASGCKNGQILLWDPSTGLQVGRTLTGHSKWITGLSWEPLHMNPECRYVASS
FT                   SKDGSVRVWDTTAGRFWDTTAGRCERILTGHTQSVTCLRWGGDGLLYSASQDRTIKVWR
FT                   AHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEATVNAQDLQGSLKELKERASSR
FT                   YNLVRGQGPERLVSGSDDFTLFLWSPAEDKKPLARMTGHQALINQVLFSPDSRIVASAS
FT                   FDKSIKLWDGRTGNAATWPAAPKTAVYECWDTTAGRCERILTGHTQSVTCLRWGGDGLL
FT                   YSASQDRTIKVWRAHDGVLCRTLQGHGHWVNTMALSTDYALRTGAFEPAEATVNAQDLQ
FT                   GSLKELKERASSRYNLVRGQGPERLVSGSDDFTLFLWSPAEDKKPLARMTGHQALINQV
FT                   LFSPDSRIVASASFDKSIKLWDGRTGKYLASLRGHVAAVYQIAWSADSRLLVSGSSDST
FT                   LKVWDVKAQKLATDLPGHADEVYAVDWSPDGQRVASGGKDKCLRIWRR"
FT   gene            4579839..4610357
FT                   /gene="Unc45b"
FT                   /locus_tag="mCG_8194"
FT                   /note="gene_id=mCG8194.2"
FT   mRNA            join(4579839..4579914,4580235..4580423,4581392..4581428,
FT                   4582188..4582363,4584046..4584135,4585996..4586163,
FT                   4586693..4586861,4590170..4590341,4594339..4594639,
FT                   4597108..4597202,4597385..4597532,4597874..4598014,
FT                   4601100..4601227,4602013..4602079,4603583..4603696,
FT                   4604033..4604148,4604951..4605068,4607404..4607559,
FT                   4609706..4610357)
FT                   /gene="Unc45b"
FT                   /locus_tag="mCG_8194"
FT                   /product="unc-45 homolog B (C. elegans)"
FT                   /note="gene_id=mCG8194.2 transcript_id=mCT7614.2 created on
FT                   13-OCT-2002"
FT   CDS             join(4580235..4580423,4581392..4581428,4582188..4582363,
FT                   4584046..4584135,4585996..4586163,4586693..4586861,
FT                   4590170..4590341,4594339..4594639,4597108..4597202,
FT                   4597385..4597532,4597874..4598014,4601100..4601227,
FT                   4602013..4602079,4603583..4603696,4604033..4604148,
FT                   4604951..4605068,4607404..4607559,4609706..4609966)
FT                   /codon_start=1
FT                   /gene="Unc45b"
FT                   /locus_tag="mCG_8194"
FT                   /product="unc-45 homolog B (C. elegans)"
FT                   /note="gene_id=mCG8194.2 transcript_id=mCT7614.2
FT                   protein_id=mCP1003.2"
FT                   /protein_id="EDL15684.1"
FT                   /translation="MAEAEAAQLKEEGNRHFQLQDYKAATKSYSQALKLTKDKALLATL
FT                   YRNRAACGLKMVWDRTAWESYAQAASDASRAIDINSADIKALYRRCQALEHLGKLDQAF
FT                   KDVQRCATLEPRNQNFQETLRRLNTSIQEQLRVQFSTDSRVQTMFEILLNENSEADKRE
FT                   KAANNLIVLGREEAGAERIFQSNGVALLLQLMNTQRPELLLAAVRTLSGMCSGHRARAT
FT                   AILHAVRIDRICSLMALENEEMSLAVCNLLQAIIDSLSGEDKREHRGKEEALVLGLRKI
FT                   LKVVGQVPDLPSCLPLTDNTRMLASILINKLYDDLRCDPERDHFRKICEEYITSKFDPQ
FT                   DMDKNVNAIQTVSGILQGPFDLGNQLLGMKGVMEMMVALCGSEREADQLVAVEALIHAS
FT                   TKLSRATFIITNGVTLLKQIYKTTKNEKIKIRTLVGLCKLGSAGGSDYGLRQFAEGSTE
FT                   KLAKQCRKWLCNTAIDTRTRRWAVEGLAYLTLDADVKDDFVQDIPALQAMFELAKARTS
FT                   DKTILYSVANTLVNCTNSYDVKEVVPELVQLAKFSKQHVPEEHPKDKKDFVDLRVKRLL
FT                   KAGVISALACMVKADSAILTDQTKELLARVFLALCDNPKDRGTIVAQGGGKALIPLALE
FT                   GTDVGKVKAAHGLAKIAAVSNPDIAFPGERVYEVVRPLVSLLDTQRDGLQNYEALLGLT
FT                   NLSGRSDKLRQKIFKEKALPDIENYMFENHDQLRQAATECMCNMVLNKEVQERFLADGN
FT                   DRLKLVVLLCGEDDHKLQNAAAGALAMLTAAHKKLCLKMTEVTTQWLEILQRLCLHDQL
FT                   SVQHRGLVIAHNLLSADAELARKLVESELLEILTVVGKQEPDEKRAAVVQTARECLIKC
FT                   MDYGFIKPVS"
FT   gene            complement(4609559..4627889)
FT                   /locus_tag="mCG_1050995"
FT                   /note="gene_id=mCG1050995.0"
FT   mRNA            complement(join(4609559..4609856,4610669..4610864,
FT                   4627836..4627889))
FT                   /locus_tag="mCG_1050995"
FT                   /product="mCG1050995"
FT                   /note="gene_id=mCG1050995.0 transcript_id=mCT194784.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(4609651..4609856,4610669..4610768))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050995"
FT                   /product="mCG1050995"
FT                   /note="gene_id=mCG1050995.0 transcript_id=mCT194784.0
FT                   protein_id=mCP115813.0"
FT                   /db_xref="MGI:MGI:1923642"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAQ2"
FT                   /protein_id="EDL15685.1"
FT                   /translation="MQRAHRKMRSTGRNAETRCGTKRKKNTQTQNKTVRISSSSLSTSF
FT                   LASSASADSRLWAMTRPRCCTDNWSCRQSRCRISSHWVVCRVEAEESVRRQRKDFS"
FT   gene            <4619333..4630171
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /note="gene_id=mCG8197.3"
FT   mRNA            join(<4619333..4619427,4621947..4622012,4623495..4624522,
FT                   4625907..4626032,4627236..4627959,4628131..4630171)
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /product="schlafen 5, transcript variant mCT191024"
FT                   /note="gene_id=mCG8197.3 transcript_id=mCT191024.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4619333..4619427,4621947..4622012,4623495..4624522,
FT                   4625907..4626032,4627236..4627959,4628131..4628935)
FT                   /codon_start=1
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /product="schlafen 5, isoform CRA_a"
FT                   /note="gene_id=mCG8197.3 transcript_id=mCT191024.0
FT                   protein_id=mCP111993.0 isoform=CRA_a"
FT                   /protein_id="EDL15686.1"
FT                   /translation="TQGRGLHSGPRTSALIPGDGAPCGLRRTDSGGFLEVPARHHLTTC
FT                   RSRAQPLARKRFQLKAEKMSFLEDLELNFAECIQDGGKATLGVRQREEMDTTHCMKQNE
FT                   IISQAVCALLNSGGGVVRVEIENGDYNFERDGVGLNLPPLFRNHLDEMLYGKLFLIYVS
FT                   SWDVAASHVRLATLCSNLYHRCGTFTEVMDPEKALKFLKRVQDPRILGDSDSLNLQEAP
FT                   VDDAQMILASDLFHSPQLQYLEKLNFTKSSHVEFQMFSADLSQGIRERLPKCVSALANS
FT                   EGGYVFFGVHDETRHVIGCEKEKINCTNLKSTIDACIRKMPVYHFCGQNHKVQYELKFL
FT                   EVYDKEALHGYVCAIKVERFCCAAFAKAPDSWEIKDNNKKPLTANDWASRMIEINPDLS
FT                   SFPQMIPWKSMLNTTPCSKTVFTHKYLKCVEDLQKDYFPVSPNRITYTPESVYKDLFAD
FT                   YRGLRNLINMEMRCFSQGILIFSHSWAVDLGLQRRQDVICDALLISPNNVPILYTICNK
FT                   WDLGNRHYSMKVARTLKQKLVNMGGYPGRLGIIPLVLPLGSHQRVRNDLEMPVYPESYN
FT                   FTTTKQVEALLQSLVIILFGFRPLLNEELNLESETVALLSDQQYGLLSTNLSKHREMFV
FT                   HGLPGSGKTTLALMIVGKIRNVFNCQADDILYICENQSLKRFIVRKNVCQAVTRKTFMK
FT                   NTFDNVQHIIVDEAQNFRTEDGNWYAKAKAITQRARDGPGVLYIFLDYFQINHLCCSGL
FT                   PELQHQKPLLKLTRMLRSGDNITSYLQDIMHQIRENPPPNVPQEALMVGEELEWGPDVT
FT                   GNLEITDNLNLEQMSVYVAEKCQSLWRSGYFTDVAVLFTRARDIEKCRDKLLLAMRRRS
FT                   MSQLAEEPSLLVQVREGLDSLGSHVVLESVHRFSGMERSIVFGIIPMGSETAIFYNALL
FT                   CLASRARTHLYIVKVVF"
FT   mRNA            join(4619349..4619427,4621947..4622012,4623495..4624522,
FT                   4625907..4626032,4627236..4627434,4629943..4630167)
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /product="schlafen 5, transcript variant mCT7607"
FT                   /note="gene_id=mCG8197.3 transcript_id=mCT7607.2 created on
FT                   13-OCT-2002"
FT   CDS             join(4623523..4624522,4625907..4626032,4627236..4627434,
FT                   4629943..4630027)
FT                   /codon_start=1
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /product="schlafen 5, isoform CRA_b"
FT                   /note="gene_id=mCG8197.3 transcript_id=mCT7607.2
FT                   protein_id=mCP1008.2 isoform=CRA_b"
FT                   /protein_id="EDL15687.1"
FT                   /translation="MSFLEDLELNFAECIQDGGKATLGVRQREEMDTTHCMKQNEIISQ
FT                   AVCALLNSGGGVVRVEIENGDYNFERDGVGLNLPPLFRNHLDEMLYGKLFLIYVSSWDV
FT                   AASHVRLATLCSNLYHRCGTFTEVMDPEKALKFLKRVQDPRILGDSDSLNLQEAPVDDA
FT                   QMILASDLFHSPQLQYLEKLNFTKSSHVEFQMFSADLSQGIRERLPKCVSALANSEGGY
FT                   VFFGVHDETRHVIGCEKEKINCTNLKSTIDACIRKMPVYHFCGQNHKVQYELKFLEVYD
FT                   KEALHGYVCAIKVERFCCAAFAKAPDSWEIKDNNKKPLTANDWASRMIEINPDLSSFPQ
FT                   MIPWKSMLNTTPCSKTVFTHKYLKCVEDLQKDYFPVSPNRITYTPESVYKDLFADYRGL
FT                   RNLINMEMRCFSQGILIFSHSWAVDLGLQRRQDVICDALLISPKLFWETQTNKNPEFIS
FT                   RDDLQEQIMKT"
FT   gene            complement(4652411..4695321)
FT                   /locus_tag="mCG_118877"
FT                   /note="gene_id=mCG118877.1"
FT   mRNA            complement(join(4652411..4653402,4653570..4654293,
FT                   4655972..4656106,4691568..4692637,4695248..4695321))
FT                   /locus_tag="mCG_118877"
FT                   /product="mCG118877"
FT                   /note="gene_id=mCG118877.1 transcript_id=mCT120052.1
FT                   created on 19-JUN-2003"
FT   CDS             complement(join(4652592..4653402,4653570..4654293,
FT                   4655972..4656106,4691568..4692630))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118877"
FT                   /product="mCG118877"
FT                   /note="gene_id=mCG118877.1 transcript_id=mCT120052.1
FT                   protein_id=mCP85427.1"
FT                   /protein_id="EDL15688.1"
FT                   /translation="METHPSLAVKWSCPDLTIYAGEVTIGEKDRNKMDSKKRKLEKTRI
FT                   TEAACALLNSGGGLIVMQMTNKSEHPMEMGQDLEKSLRELIMSPNMQAFFETKQQEDQF
FT                   YIFIKSWSCSPEDGSTKPRICSLGTSLYCRSLTSKVAMNSREAFEFLKEKKACIEYSPT
FT                   DDRAPPAKIPRTMCQNSLESNRAFEIFQSKKLEYGQRLRFSESPSIEFKQFSTKHVQEY
FT                   MKNIIPEYISAFANTQGGYLFIGVDDESIILGCPKDNVDRDSLKTVANEAISKLPVFHF
FT                   CSSKDKDKVSYETRVIDVFQGGNLYGYLCVIKVEPFCCAVFSEAPISWMVDKKKGVYRL
FT                   NTEEWVHMMVDVGPEAASNDLSRDFECQLSLSDSPPHCRPVYSKKGLEHKVDLQQHLFQ
FT                   VSPDCLKYTPESLWSELCSQHERLEDLVNQQIRSFSCGLLILSRSWAVDLNLEEKQEVI
FT                   CDALLIAQNSPPILYTILGEQDEQGQDYCTRTAFTLKQKLVNTGGYTGRVCVMTKVLCL
FT                   SSQNNNKTSGGSVSPIDYPSSYNLANIQEMQGLLQALVIVLLNFRSFLSDQLGCEVLNL
FT                   LTAQQYEILSKSLRKTRELFVHGLPGSGKTIIAMKIMEKIRNTFHCETDRILYICENQP
FT                   LRDFIQAKNICQAVTRKTFMNYKFKTERFQHIIIDEAQNFRTEDGNWYEKAKGITRGMK
FT                   NCPGILWIFLDYFQTSHLQESGLPDFSLQYPKEELTQVVRNADKIAEFLQQELQKIRDN
FT                   PPCSIPQESLNILHEFKWSQGVSGTYEITYLTLEKMVSYITDKCDVFLSKGYSPQDIAV
FT                   LFSTDREKKAYEHMFLREMRKRRRASHMNDESVCHSNMFDSIRRFSGLERSIVFGINPI
FT                   ATEQPISHNLLLCLASRAMKHLYILYLSTPEGQSSMVAC"
FT   gene            complement(<4703652..>4710032)
FT                   /locus_tag="mCG_118892"
FT                   /note="gene_id=mCG118892.0"
FT   mRNA            complement(join(<4703652..4704375,4706040..4706174,
FT                   4708976..>4710032))
FT                   /locus_tag="mCG_118892"
FT                   /product="mCG118892"
FT                   /note="gene_id=mCG118892.0 transcript_id=mCT120053.0
FT                   created on 13-OCT-2002"
FT   CDS             complement(join(<4703652..4704375,4706040..4706174,
FT                   4708976..4710032))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118892"
FT                   /product="mCG118892"
FT                   /note="gene_id=mCG118892.0 transcript_id=mCT120053.0
FT                   protein_id=mCP85430.0"
FT                   /protein_id="EDL15689.1"
FT                   /translation="METHPSLEVKGSCPDLIIYTGEVTLGEKVRSKMDSKKRKLEKKRI
FT                   TEAACALLNSGGGLIAMQTTNKSEHPVEMGQDLEKSLRELIMSSNMQGFFETKQQEDQF
FT                   YIFVKSWSCSPEDASTKPRICSLGSSLYCRSLTSNVAMDSREAFDFLKGKKRCVKCSPT
FT                   DDRANKIPGAMYQNSLETNPAFEIFQSKKLEYGQHLLFSESTFIQFKQFSTKHVQEYIK
FT                   NKIPEYISAFANTQGGYLFIGVDDKSTILGCPKDNVDRDSLKTVANEAISKLPVFHFCS
FT                   SKDKDKVSYETRVIDVFQEGNLYGYLCVIKVEPFCCAVFSEAPISWMVDKEKGVYRLNT
FT                   EEWVRMMVDVGPEAASKDLSKDFECQLSLSNSPPRCRPVYSKKGLEHKVDLQQHLFQVS
FT                   PDHLKYTPESLWSELCFEHERLEDLVNQQIRSFSCGLLILSRSWAVDLNLEEKQEVICD
FT                   ALLIAENSPPILYTILGEQDEQGQDYCTRTAFTLKQKLVNTGGYTGRVCVMTKVLCLSS
FT                   QNSIETNGGSVSPIDYPHSYNLANIQEMQDLLQALVIILLNFRSFLSDQLGCEILNLLT
FT                   AQQYEILSKSLRKTRELFVHGLPGSGKTIIAMKIMEKIRNTFHCETDRILYICENQPLR
FT                   DFI"
FT   gene            4733370..4738967
FT                   /gene="Slfn2"
FT                   /locus_tag="mCG_118881"
FT                   /note="gene_id=mCG118881.0"
FT   mRNA            join(4733370..4733601,4737544..4738967)
FT                   /gene="Slfn2"
FT                   /locus_tag="mCG_118881"
FT                   /product="schlafen 2"
FT                   /note="gene_id=mCG118881.0 transcript_id=mCT120041.0
FT                   created on 31-JUL-2002"
FT   CDS             join(4733552..4733601,4737544..4738630)
FT                   /codon_start=1
FT                   /gene="Slfn2"
FT                   /locus_tag="mCG_118881"
FT                   /product="schlafen 2"
FT                   /note="gene_id=mCG118881.0 transcript_id=mCT120041.0
FT                   protein_id=mCP85326.1"
FT                   /db_xref="GOA:Q9Z0I6"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="MGI:MGI:1313258"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z0I6"
FT                   /protein_id="EDL15690.1"
FT                   /translation="MGTRLEATEQSNHRTQRNDIQLENAKAAGKMGISVDLEAKYAKLG
FT                   LNLGAITFGEKDRKKMKNSHLRKQENANISLAVCALLNSGGGAIKVKIENENYSLTRDG
FT                   LGLDLEASLCKCLPFVQWHLDFTESEGYIYIYVKSWSQEIFGLPIGTLRTNLYVRSMSS
FT                   SVQVSAAAALEFLQDLEETGGRPCVRPELPASIAFPEVEGEWHLEDLAAALFNRTEFQY
FT                   EETFPFTRSRYVEVTLLSAKRLRKRIKELLPQTVSAFANTDGGFLFIGLDGKTQQIIGF
FT                   EAEKSDLVLLESEIEKHIRQLPVTHFCEEKEKIKYTCKFIEVHKSGAVCAYVCALRVER
FT                   FCCAVFAAEPESWHVEGGCVKRFTTEEWVKLQMNAPSG"
FT   gene            4785507..4791321
FT                   /gene="Slfn1"
FT                   /locus_tag="mCG_18884"
FT                   /note="gene_id=mCG18884.0"
FT   mRNA            join(4785507..4785724,4789683..4791321)
FT                   /gene="Slfn1"
FT                   /locus_tag="mCG_18884"
FT                   /product="schlafen 1"
FT                   /note="gene_id=mCG18884.0 transcript_id=mCT15931.0 created
FT                   on 31-JUL-2002"
FT   CDS             4789722..4790735
FT                   /codon_start=1
FT                   /gene="Slfn1"
FT                   /locus_tag="mCG_18884"
FT                   /product="schlafen 1"
FT                   /note="gene_id=mCG18884.0 transcript_id=mCT15931.0
FT                   protein_id=mCP3883.1"
FT                   /db_xref="GOA:Q9Z0I7"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="MGI:MGI:1313259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z0I7"
FT                   /protein_id="EDL15691.1"
FT                   /translation="MNITDEGTPVLILNAGGITLGTESRKTMENHDRVEENRNITKALC
FT                   ALINSGEGKVKAHIKNPDYILSKHGIGEDLETSFKNILPSRPLDFKQYQSYFFICVEKS
FT                   QSPDVSVGKPATIATNLYMRNGASSVEMNLDAAQKFLDNIKVAGGRSPSARPSDRPGDD
FT                   TQEEGHIQELAAAFFKQSKLTKKENFLFSESKNVEYKSFETKKLLQRVKEILPRTVSAF
FT                   ANTDGGYLFIGLDEKKQEIVGFEAKNCQPKCLESEIEKCIQQLPVTHFCEEREKIKYKC
FT                   KFIEVHDSGVVCKYVCALRVERFCCAVFAAEPESWHMKDGGVKRFTIEEWIKLLMS"
FT   gene            4809238..4824266
FT                   /locus_tag="mCG_118890"
FT                   /note="gene_id=mCG118890.2"
FT   mRNA            join(4809238..4809445,4809615..4809696,4809880..4809965,
FT                   4810129..4810851,4813726..4813811,4819323..4819501,
FT                   4820580..4821619,4822718..4824265)
FT                   /locus_tag="mCG_118890"
FT                   /product="mCG118890, transcript variant mCT120050"
FT                   /note="gene_id=mCG118890.2 transcript_id=mCT120050.2
FT                   created on 16-JUN-2003"
FT   mRNA            join(4810655..4810851,4813726..4813811,4822718..4824266)
FT                   /locus_tag="mCG_118890"
FT                   /product="mCG118890, transcript variant mCT174212"
FT                   /note="gene_id=mCG118890.2 transcript_id=mCT174212.1
FT                   created on 16-JUN-2003"
FT   CDS             join(4820842..4821619,4822718..4823349)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118890"
FT                   /product="mCG118890, isoform CRA_a"
FT                   /note="gene_id=mCG118890.2 transcript_id=mCT120050.2
FT                   protein_id=mCP85420.1 isoform=CRA_a"
FT                   /protein_id="EDL15692.1"
FT                   /translation="MGLDLVNPLPGILHLPHDYLDFMQYNDYFFVFVKPWKPNQRGPGI
FT                   ATWKTNLYKRIFSFSVELKAADAVQFLKSRPSSHGKTVCNETLNECLSLFNRDWLAYEE
FT                   TFCFTKSTHAEVKLTPKEKISPKEKILELLPQTVSAFANTDGGYLFIGLDGKTQQIIGF
FT                   EAEKSDLVLLESEIEKCIQQLPVTHFCEEKEKIKYTCKFIEVHKSGAVCAYVCAIRVEK
FT                   FCCAVFAAEPESWHVEGSCVKRFTTEEWVKRQMDATAVMPGKVICSPEALCMKPFSQHE
FT                   GYEQLVRTELGSLRKGTLVVSKSWALDLGLQEKQEVIWDVLHISQGSLLTLHVFVQGDE
FT                   NLEGNSSLLGKLGAELKGYYKQIALTLKQTLVNHCGYTAKIGIIVKITYLGHKTMCLYD
FT                   SSAKICYPQIYYLTTKAVKDLEKALAEILGSYESFYSLPRRNWDSFMSAFLNVGSYIVY
FT                   FSRNVLTHIRI"
FT   CDS             4822720..4823349
FT                   /codon_start=1
FT                   /locus_tag="mCG_118890"
FT                   /product="mCG118890, isoform CRA_b"
FT                   /note="gene_id=mCG118890.2 transcript_id=mCT174212.1
FT                   protein_id=mCP97131.0 isoform=CRA_b"
FT                   /protein_id="EDL15693.1"
FT                   /translation="MPGKVICSPEALCMKPFSQHEGYEQLVRTELGSLRKGTLVVSKSW
FT                   ALDLGLQEKQEVIWDVLHISQGSLLTLHVFVQGDENLEGNSSLLGKLGAELKGYYKQIA
FT                   LTLKQTLVNHCGYTAKIGIIVKITYLGHKTMCLYDSSAKICYPQIYYLTTKAVKDLEKA
FT                   LAEILGSYESFYSLPRRNWDSFMSAFLNVGSYIVYFSRNVLTHIRI"
FT   gene            4825384..4849829
FT                   /locus_tag="mCG_141260"
FT                   /note="gene_id=mCG141260.0"
FT   mRNA            join(4825384..4825463,4846590..4847659,4848534..4849829)
FT                   /locus_tag="mCG_141260"
FT                   /product="mCG141260"
FT                   /note="gene_id=mCG141260.0 transcript_id=mCT174215.0
FT                   created on 13-OCT-2002"
FT   CDS             join(4846720..4847659,4848534..4849147)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141260"
FT                   /product="mCG141260"
FT                   /note="gene_id=mCG141260.0 transcript_id=mCT174215.0
FT                   protein_id=mCP97134.0"
FT                   /db_xref="GOA:Q9Z0I5"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="MGI:MGI:1329005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z0I5"
FT                   /protein_id="EDL15694.1"
FT                   /translation="MKDIQLRRKEAKSILQAVCTLLNSGGGVVKAHIKNQNYSFTRDGM
FT                   GLDLVNSLPGIMHLPHDYLDFMQHKDYFFVFVKPLKPNQKGPGITTLKTNLYRRINSIS
FT                   DEVKVANAVQLLKSRTDPEEKAESRPSSPGKIVCNETLNECLSLFNRDWLAYEETFCFT
FT                   KSIHAEVKLTPKEKIFPKEKILELLPQTVSAFANTDGGFLFIGLDGKTQQIIGFEAEKS
FT                   NLVLLESEIEKCIQQLPVTHFCGEKEKIKYTCKFIEVRKSGAVCAYVCALRVERFCCAV
FT                   FAAEPESWHVEGGCVKRFTTEEWVKRQMDATAVMPGKVICCPEALYMKPFSQHEGYEHL
FT                   VRTELGSLLKGTLVISKSWALDLGLQEKQEVIWDVLHISQGSLLTLYVFVQGDENLEGN
FT                   SSLLGELGAELKGYYKQIALTLKQMLLNHCGYTAEIGIIVKITYLGHKTMCLYDTSTKI
FT                   RYPQKYYLSAKAVKDLEKALVEILGSYESFYSLPRRNWDSFMSAFLNVGSYIVPVLRNV
FT                   "
FT   gene            4857592..4860631
FT                   /locus_tag="mCG_118897"
FT                   /note="gene_id=mCG118897.1"
FT   mRNA            join(4857592..4857697,4858499..4858678,4859581..4860631)
FT                   /locus_tag="mCG_118897"
FT                   /product="mCG118897, transcript variant mCT120059"
FT                   /note="gene_id=mCG118897.1 transcript_id=mCT120059.1
FT                   created on 13-OCT-2002"
FT   mRNA            join(4857655..4857697,4859581..4859947)
FT                   /locus_tag="mCG_118897"
FT                   /product="mCG118897, transcript variant mCT174213"
FT                   /note="gene_id=mCG118897.1 transcript_id=mCT174213.0
FT                   created on 13-OCT-2002"
FT   CDS             4859608..4859886
FT                   /codon_start=1
FT                   /locus_tag="mCG_118897"
FT                   /product="mCG118897, isoform CRA_a"
FT                   /note="gene_id=mCG118897.1 transcript_id=mCT174213.0
FT                   protein_id=mCP97132.0 isoform=CRA_a"
FT                   /protein_id="EDL15695.1"
FT                   /translation="MEFVPPVSTTTSRGRTPTVLRTSCCCGVLLCSPSSRSPHPSWSVS
FT                   CMKTPKRLPAPHWTVSLVSRIVIALFQVLQLEQITDSTTTLRKDIEL"
FT   CDS             4859608..4859886
FT                   /codon_start=1
FT                   /locus_tag="mCG_118897"
FT                   /product="mCG118897, isoform CRA_a"
FT                   /note="gene_id=mCG118897.1 transcript_id=mCT120059.1
FT                   protein_id=mCP85470.1 isoform=CRA_a"
FT                   /protein_id="EDL15696.1"
FT                   /translation="MEFVPPVSTTTSRGRTPTVLRTSCCCGVLLCSPSSRSPHPSWSVS
FT                   CMKTPKRLPAPHWTVSLVSRIVIALFQVLQLEQITDSTTTLRKDIEL"
FT   gene            complement(<4915824..>4920916)
FT                   /locus_tag="mCG_59729"
FT                   /note="gene_id=mCG59729.1"
FT   mRNA            complement(join(<4915824..4916327,4919890..>4920916))
FT                   /locus_tag="mCG_59729"
FT                   /product="mCG59729"
FT                   /note="gene_id=mCG59729.1 transcript_id=mCT59912.1 created
FT                   on 13-OCT-2002"
FT   CDS             complement(join(<4915824..4916327,4919890..4920916))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59729"
FT                   /product="mCG59729"
FT                   /note="gene_id=mCG59729.1 transcript_id=mCT59912.1
FT                   protein_id=mCP33421.1"
FT                   /protein_id="EDL15697.1"
FT                   /translation="MPYAEITVNLGKVTLGEENRKKMTNSCLKRHENSSLVQAVCALLN
FT                   SGGGVIKAEINDKSYSYRCHGLGQDLETSFQKLLPSGSQKHLDYMQQNHDLLIFVKSWS
FT                   PDASSLPLRICSLRSNLYQRDVTSAINLCANGALELLREKESRAQRGTPRLHSQDHILN
FT                   RTIQEEEDIKMCALEFFKKDKLNFKEKLSFTESTHVEFKRFTTKKIVPRIKETLAHYVS
FT                   AFANTQGGYIIIGVDDKSKEVFGCKKEKVNPDSLKTEIKNCIEKLPTYHFCREKPKVNF
FT                   TTKILKVYQKEALYGFVCVVQVEPFCCVVFAEDPDSWIMENNIVTRLKVQQWVEMMLDI
FT                   QSVTQENLQFQPESLCKKLFSDHEGLEDLLKAQTHPCSHGIVIFSRSWAGDIGLMREEK
FT                   VLCDALLVAVGSPLVLYTILTDPSSTGRADYTQNTALQLKRQLQTLGGYPGKICVIPRV
FT                   IYLASRGSRPDQPPVYYPRPYTLSSKAEVEDLLQGLVLVSLCSRSVLSDQLG"
FT   gene            complement(4931339..>4935672)
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /note="gene_id=mCG11692.2"
FT   mRNA            complement(join(4931339..4933134,4934182..4934735,
FT                   4935010..4935247,4935406..4935668))
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /product="peroxisomal biogenesis factor 12, transcript
FT                   variant mCT16940"
FT                   /note="gene_id=mCG11692.2 transcript_id=mCT16940.1 created
FT                   on 31-JUL-2002"
FT   mRNA            complement(join(4931340..4933134,4934182..4934735,
FT                   4935010..4935247,4935534..>4935672))
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /product="peroxisomal biogenesis factor 12, transcript
FT                   variant mCT191015"
FT                   /note="gene_id=mCG11692.2 transcript_id=mCT191015.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(4932735..4933134,4934182..4934735,
FT                   4935010..>4935177))
FT                   /codon_start=1
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /product="peroxisomal biogenesis factor 12, isoform CRA_b"
FT                   /note="gene_id=mCG11692.2 transcript_id=mCT191015.0
FT                   protein_id=mCP111959.0 isoform=CRA_b"
FT                   /protein_id="EDL15699.1"
FT                   /translation="SVRGKSESQFTQDTMAEHGAHITTASVADDQPSIFEVVAQDSLMT
FT                   AVRPALQHVVKVLAESNPAHYGFLWRWFDEIFTLLDFLLQQHYLSRTSASFSEHFYGLK
FT                   RIVAGSSPHLQRPASAGLPKEHLWKSAMFLVLLPYLKVKLEKLASSLREEDEYSIHPPS
FT                   SRWKRFYRAFLAAYPFVNMAWEGWFLTQQLRYILGKAEHHSPLLKLAGVRLARLTAQDM
FT                   QAIKQRLVEASAMQEPVRSVGEKIKSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSS
FT                   ENQEAIKSLTALPTPPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCY
FT                   RCVFNYVRSHQACPITGYPTEVQHLIKLYSPEN"
FT   CDS             complement(join(4932735..4933134,4934182..4934735,
FT                   4935010..4935135))
FT                   /codon_start=1
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /product="peroxisomal biogenesis factor 12, isoform CRA_a"
FT                   /note="gene_id=mCG11692.2 transcript_id=mCT16940.1
FT                   protein_id=mCP11659.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TLN1"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="MGI:MGI:2144177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLN1"
FT                   /protein_id="EDL15698.1"
FT                   /translation="MAEHGAHITTASVADDQPSIFEVVAQDSLMTAVRPALQHVVKVLA
FT                   ESNPAHYGFLWRWFDEIFTLLDFLLQQHYLSRTSASFSEHFYGLKRIVAGSSPHLQRPA
FT                   SAGLPKEHLWKSAMFLVLLPYLKVKLEKLASSLREEDEYSIHPPSSRWKRFYRAFLAAY
FT                   PFVNMAWEGWFLTQQLRYILGKAEHHSPLLKLAGVRLARLTAQDMQAIKQRLVEASAMQ
FT                   EPVRSVGEKIKSALKKAVGGVALSLSTGLSVGVFFLQFLDWWYSSENQEAIKSLTALPT
FT                   PPPPVHLDYNSDSPLLPKMKTVCPLCRKTRVNDTVLATSGYVFCYRCVFNYVRSHQACP
FT                   ITGYPTEVQHLIKLYSPEN"
FT   gene            4939174..5044120
FT                   /gene="Ap2b1"
FT                   /locus_tag="mCG_140993"
FT                   /note="gene_id=mCG140993.0"
FT   mRNA            join(4939174..4939523,4944911..4944970,4953109..4953214,
FT                   4958627..4958762,4961199..4961444,4969666..4969856,
FT                   4972061..4972282,4973023..4973143,4973447..4973542,
FT                   4975993..4976108,4980670..4980835,4981996..4982094,
FT                   4986038..4986297,4990369..4990573,5005028..5005174,
FT                   5008983..5009054,5028781..5028865,5029773..5029859,
FT                   5036842..5036996,5041658..5043084,5043929..5044120)
FT                   /gene="Ap2b1"
FT                   /locus_tag="mCG_140993"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /note="gene_id=mCG140993.0 transcript_id=mCT172631.0
FT                   created on 28-AUG-2002"
FT   CDS             join(4944934..4944970,4953109..4953214,4958627..4958762,
FT                   4961199..4961444,4969666..4969856,4972061..4972282,
FT                   4973023..4973143,4973447..4973542,4975993..4976108,
FT                   4980670..4980835,4981996..4982094,4986038..4986297,
FT                   4990369..4990573,5005028..5005174,5008983..5009054,
FT                   5028781..5028865,5029773..5029859,5036842..5036996,
FT                   5041658..5041732)
FT                   /codon_start=1
FT                   /gene="Ap2b1"
FT                   /locus_tag="mCG_140993"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /note="gene_id=mCG140993.0 transcript_id=mCT172631.0
FT                   protein_id=mCP95550.0"
FT                   /protein_id="EDL15700.1"
FT                   /translation="MTDSKYFTTNKKGEIFELKAELNNEKKEKRKEAVKKVIAAMTVGK
FT                   DVSSLFPDVVNCMQTDNLELKKLVYLYLMNYAKSQPDMAIMAVNSFVKDCEDPNPLIRA
FT                   LAVRTMGCIRVDKITEYLCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQMVEDQGFLD
FT                   SLRDLIADSNPMVVANAVAALSEISESHPNSNLLDLNPQNINKLLTALNECTEWGQIFI
FT                   LDCLSNYNPKDDREAQSICERVTPRLSHANSAVVLSAVKVLMKFLELLPKDSDYYNMLL
FT                   KKLAPPLVTLLSGEPEVQYVALRNINLIVQKRPEILKQEIKVFFVKYNDPIYVKLEKLD
FT                   IMIRLASQANIAQVLAELKEYATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLI
FT                   QTKVNYVVQEAIVVIRDIFRKYPNKYESIIATLCENLDSLDEPDARAAMIWIVGEYAER
FT                   IDNADELLESFLEGFHDESTQVQLTLLTAIVKLFLKKPSETQELVQQVLSLATQDSDNP
FT                   DLRDRGYIYWRLLSTDPVTAKEVVLSEKPLISEETDLIEPTLLDELICHIGSLASVYHK
FT                   PPNAFVEGSHGIHRKHLPIHHGSTDAGDSPVGTTTTTNLEQPQVIPSQGDLLGDLLNLD
FT                   LGPPVNVPQVSSMQMGAVDLLGGGLDSLVSIFVGQSFIPSSVPATFAPSPTPAVVSSGL
FT                   NDLFELSTGIGMAPGGYVAPKASIDVSLPLNTLGPVMKMEPLNNLQVAVKNNIDVFYFS
FT                   CLIPLNVLFVEDGKMERQVFLATWKDIPNENELQFQIKECHLNADTVSSKLQNNNVYTI
FT                   AKRNVEGQDMLYQSLKLTNGIWILAELRIQPGNPNYTLSLKCRAPEVSQYIYQVYDSIL
FT                   KN"
FT   gene            5051580..>5057922
FT                   /gene="Rasl10b"
FT                   /locus_tag="mCG_11691"
FT                   /note="gene_id=mCG11691.2"
FT   mRNA            join(5051580..5051944,5056958..5057082,5057656..>5057922)
FT                   /gene="Rasl10b"
FT                   /locus_tag="mCG_11691"
FT                   /product="RAS-like, family 10, member B"
FT                   /note="gene_id=mCG11691.2 transcript_id=mCT16933.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(5051729..5051944,5056958..5057082,5057656..>5057922)
FT                   /codon_start=1
FT                   /gene="Rasl10b"
FT                   /locus_tag="mCG_11691"
FT                   /product="RAS-like, family 10, member B"
FT                   /note="gene_id=mCG11691.2 transcript_id=mCT16933.2
FT                   protein_id=mCP11649.2"
FT                   /protein_id="EDL15701.1"
FT                   /translation="MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTTRRLYLPA
FT                   VVMNGHVHDLQILDFPPISAFPVNTLQEWADACCRGLRSVHAYILVYDICCFDSFEYVK
FT                   TIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPRWNVSHLVRKTWKCGYVECSAKYN
FT                   WHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAI"
FT   gene            complement(5063932..>5068528)
FT                   /gene="RP23-249K18.2"
FT                   /locus_tag="mCG_11686"
FT                   /note="gene_id=mCG11686.2"
FT   mRNA            complement(join(5063932..5064255,5065316..5065423,
FT                   5066355..5066596,5068144..>5068528))
FT                   /gene="RP23-249K18.2"
FT                   /locus_tag="mCG_11686"
FT                   /product="hypothetical protein LOC237891"
FT                   /note="created on 18-OCT-2002"
FT   CDS             complement(join(5064097..5064255,5065316..5065423,
FT                   5066355..5066596,5068144..5068528))
FT                   /codon_start=1
FT                   /gene="RP23-249K18.2"
FT                   /locus_tag="mCG_11686"
FT                   /product="hypothetical protein LOC237891"
FT                   /protein_id="EDL15702.1"
FT                   /translation="MSQHVGHGRRPRTPGPPVRSIRPFKSSEQYLEAMKEDLAEWLRDL
FT                   YGLDIDADNFLRVLETGLVLCRHANTVTEAALAFLAEAPERAQKIPMPQAGVFCNGAAQ
FT                   PGTFQARDNISNFIQWCRKEMGIQEVLMFETEDLVLRKNVKSVVLCLLELGRRAWRFGV
FT                   AAPALVHLEEEIDEELRRDLALPSPDPPPPIPPARRPCHFHNLDQMVQSLVSHCTCPVQ
FT                   FSMVKISEGKYRVGDSNTLIFIRILRSHVMVRVGGGWDTLGHYLDKHDPCRCTSLCEFP
FT                   RKFPLWAWLERHRHSS"
FT   gene            5076854..5080381
FT                   /gene="1700020L24Rik"
FT                   /locus_tag="mCG_11687"
FT                   /note="gene_id=mCG11687.2"
FT   mRNA            join(5076854..5076919,5079452..5079761,5079841..5080381)
FT                   /gene="1700020L24Rik"
FT                   /locus_tag="mCG_11687"
FT                   /product="RIKEN cDNA 1700020L24"
FT                   /note="gene_id=mCG11687.2 transcript_id=mCT16936.2 created
FT                   on 28-AUG-2002"
FT   CDS             join(5076907..5076919,5079452..5079761,5079841..5080087)
FT                   /codon_start=1
FT                   /gene="1700020L24Rik"
FT                   /locus_tag="mCG_11687"
FT                   /product="RIKEN cDNA 1700020L24"
FT                   /note="gene_id=mCG11687.2 transcript_id=mCT16936.2
FT                   protein_id=mCP11666.2"
FT                   /protein_id="EDL15703.1"
FT                   /translation="MDKHGVKTPLWRKEVEDPEAREEDLEDDSSSSSSSSSVEERSDPE
FT                   SATETEEDSRDADEREARSVSYSPLRQESSSQQVALLRRSDSSFWGWLSPFALLGGLAA
FT                   PADRKRGAPEEPCVLETRRRPPRRGGCARCEILFCKKCKTLHSHPAYVEHCILEHPDLG
FT                   KAEATGNSELIDSQPPSPQCSKLFYL"
FT   gene            complement(5081039..5102231)
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /note="gene_id=mCG11680.3"
FT   mRNA            complement(join(5081039..5082111,5082925..5083020,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102121))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT191041"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191041.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(5081039..5082111,5082925..5083062,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102121))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT191042"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191042.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(5081039..5082111,5082925..5083092,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102121))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT191043"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191043.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(<5081717..5082111,5082925..5083092,
FT                   5083985..5084230,5086693..5086917,5090529..5090716,
FT                   5090803..5090882,5101908..5102231))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT16928"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT16928.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(5081717..5082111,5082925..5083020,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102117))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191041.0
FT                   protein_id=mCP111998.0 isoform=CRA_c"
FT                   /protein_id="EDL15706.1"
FT                   /translation="GPWGPGGSARGPRRTGIRGSRAQLTTTPQQLAAMVAGVSLLLRAL
FT                   PLLLWGCQDAQPTQHGLPELRQEAEAFLEKYGYLSEQGSKAPASAQFRNAIREFQWISQ
FT                   LPLSGVLDQATLRQMTRPRCGVADTDSHATWTERISTLLAGHRAKMRRKKRFAKPGNKW
FT                   YKQHLSYRLVNWPERLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGD
FT                   HNDGLANAFDGPGGALAHAFLPRRGEAHFDGDERWSLSRRRGRNLFVVLAHEIGHTLGL
FT                   THSPAPRALMAPYYKKLGRDALLSWDDVLAVQSLYGKPLGRSVATQLPGKVFTDFEAWD
FT                   PHNSQSRRPETRGPKYCHSSFDAITVEPRPLQKRWPGLPPGIEAAAVSLEDGDFYFFKG
FT                   NRCWRFQGTKSVWGFAQLCRAGGLPRHPDAALFFPPLRRLVLFKGSRYYVLAQGGMQVE
FT                   PYYPRSLRDWAGVPEEVSGALPRPDGSIIFFRDDHYWHLDQAKLRVTSSGRWATELSWM
FT                   GCWNANSGGALF"
FT   CDS             complement(join(5081717..5082111,5082925..5083062,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102117))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191042.0
FT                   protein_id=mCP111999.0 isoform=CRA_d"
FT                   /protein_id="EDL15707.1"
FT                   /translation="GPWGPGGSARGPRRTGIRGSRAQLTTTPQQLAAMVAGVSLLLRAL
FT                   PLLLWGCQDAQPTQHGLPELRQEAEAFLEKYGYLSEQGSKAPASAQFRNAIREFQWISQ
FT                   LPLSGVLDQATLRQMTRPRCGVADTDSHATWTERISTLLAGHRAKMRRKKRFAKPGNKW
FT                   YKQHLSYRLVNWPERLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGD
FT                   HNDGLANAFDGPGGALAHAFLPRRGEAHFDGDERWSLSRRRGRNLFVVLAHEIGHTLGL
FT                   THSPAPRALMAPYYKKLGRDALLSWDDVLAVQSLYGKPLGRSVATQLPGKVFTDFEAWD
FT                   PHNSQSRRPETRGPKYCHSSFDAITVGSYFWEVTVDGNVSEPRPLQKRWPGLPPGIEAA
FT                   AVSLEDGDFYFFKGNRCWRFQGTKSVWGFAQLCRAGGLPRHPDAALFFPPLRRLVLFKG
FT                   SRYYVLAQGGMQVEPYYPRSLRDWAGVPEEVSGALPRPDGSIIFFRDDHYWHLDQAKLR
FT                   VTSSGRWATELSWMGCWNANSGGALF"
FT   CDS             complement(join(5081717..5082111,5082925..5083092,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102117))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191043.0
FT                   protein_id=mCP112000.0 isoform=CRA_e"
FT                   /protein_id="EDL15708.1"
FT                   /translation="GPWGPGGSARGPRRTGIRGSRAQLTTTPQQLAAMVAGVSLLLRAL
FT                   PLLLWGCQDAQPTQHGLPELRQEAEAFLEKYGYLSEQGSKAPASAQFRNAIREFQWISQ
FT                   LPLSGVLDQATLRQMTRPRCGVADTDSHATWTERISTLLAGHRAKMRRKKRFAKPGNKW
FT                   YKQHLSYRLVNWPERLPEPAVRGAVRAAFQLWSNVSALEFWEAPATGPADIRLTFFQGD
FT                   HNDGLANAFDGPGGALAHAFLPRRGEAHFDGDERWSLSRRRGRNLFVVLAHEIGHTLGL
FT                   THSPAPRALMAPYYKKLGRDALLSWDDVLAVQSLYGKPLGRSVATQLPGKVFTDFEAWD
FT                   PHNSQSRRPETRGPKYCHSSFDAITVDGQWRLYVFKGSYFWEVTVDGNVSEPRPLQKRW
FT                   PGLPPGIEAAAVSLEDGDFYFFKGNRCWRFQGTKSVWGFAQLCRAGGLPRHPDAALFFP
FT                   PLRRLVLFKGSRYYVLAQGGMQVEPYYPRSLRDWAGVPEEVSGALPRPDGSIIFFRDDH
FT                   YWHLDQAKLRVTSSGRWATELSWMGCWNANSGGALF"
FT   CDS             complement(join(5081717..5082111,5082925..5083092,
FT                   5083985..5084230,5086693..5086917,5090529..5090716,
FT                   5090803..5090882,5101908..5102018))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT16928.2
FT                   protein_id=mCP11658.2 isoform=CRA_a"
FT                   /protein_id="EDL15704.1"
FT                   /translation="MVAGVSLLLRALPLLLWGCQDAQPTQHGLPELRQEAEAFLEKYGY
FT                   LSEQGSKAPASAQFRNAIREFQWISQLPLSGVLDQATLRQMTRPRCGVADTDSHATWTE
FT                   RISTLLAGHRAKMRRKKRFAKPGNKWYKQHLSYRLVNWPERLPEPAVRGAVRAAFQLWS
FT                   NVSALEFWEAPATGPADIRLTFFQGDHNDGLANAFDGPGGALAHAFLPRRGEAHFDGDE
FT                   RWSLSRRRGRNLFVVLAHEIGHTLGLTHSPAPRALMAPYYKKLGRDALLSWDDVLAVQS
FT                   LYDGQWRLYVFKGSYFWEVTVDGNVSEPRPLQKRWPGLPPGIEAAAVSLEDGDFYFFKG
FT                   NRCWRFQGTKSVWGFAQLCRAGGLPRHPDAALFFPPLRRLVLFKGSRYYVLAQGGMQVE
FT                   PYYPRSLRDWAGVPEEVSGALPRPDGSIIFFRDDHYWHLDQAKLRVTSSGRWATELSWM
FT                   GCWNANSGGALF"
FT   mRNA            complement(join(5090545..5090716,5090803..5090982,
FT                   5101908..5102231))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT174519"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT174519.0 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(5090649..5090716,5090803..5090959))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT174519.0
FT                   protein_id=mCP97438.0 isoform=CRA_b"
FT                   /protein_id="EDL15705.1"
FT                   /translation="MCLRPLYKRRQGCCMVRRADGPLSPRHSWRSMDTSVSRAPKPQPP
FT                   HSSGTPSESSSGYPSCPSVVCWTRPHCAR"
FT   gene            5119382..5152830
FT                   /gene="Taf15"
FT                   /locus_tag="mCG_118745"
FT                   /note="gene_id=mCG118745.0"
FT   mRNA            join(5119382..5119503,5128229..5128268,5130870..5130921,
FT                   5131029..5131113,5131196..5131298,5133393..5133583,
FT                   5135094..5135214,5143333..5143367,5143965..5143997,
FT                   5145144..5145253,5147178..5147307,5148823..5148915,
FT                   5150313..5150394,5150495..5150583,5150709..5151167,
FT                   5152504..5152830)
FT                   /gene="Taf15"
FT                   /locus_tag="mCG_118745"
FT                   /product="TAF15 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG118745.0 transcript_id=mCT119914.1
FT                   created on 08-NOV-2002"
FT   CDS             join(5119497..5119503,5128229..5128268,5130870..5130921,
FT                   5131029..5131113,5131196..5131298,5133393..5133583,
FT                   5135094..5135214,5143333..5143367,5143965..5143997,
FT                   5145144..5145253,5147178..5147307,5148823..5148915,
FT                   5150313..5150394,5150495..5150583,5150709..5151167,
FT                   5152504..5152808)
FT                   /codon_start=1
FT                   /gene="Taf15"
FT                   /locus_tag="mCG_118745"
FT                   /product="TAF15 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG118745.0 transcript_id=mCT119914.1
FT                   protein_id=mCP85045.1"
FT                   /protein_id="EDL15709.1"
FT                   /translation="MSDSGSYSQSGGEQQSYSSYGNQGSQGYGQTPQGYSGYGQTTDSS
FT                   YGQNYGGYSGYGQNQSGYSQSYGSYENQKQSSYGQQSYNNQGQQNTESSGGQGGRAPSY
FT                   GQSDYGQQDSYDQQSGYDQHQGSYDEQSNYQQHDSYNQNQQSYHSQRENYSHHTQDDRR
FT                   DVSRYGEDNRGYGGSQGGGRGRGGYDKDGRGPMTGSSGGDRGGFKNFGGHRDYGPRPDA
FT                   DSESDNSDNNTIFVQGLGEGVSTDQVGEFFKQIGIIKTNKKTGKPMINLYTDKDTGKPK
FT                   GEATVSFDDPPSAKAAIDWFDGKEFHGNIIKVSFATRRPEFMRGGGSGGGRRGRGGYRG
FT                   RGGFQGRGGDPKNGDWVCPNPSCGNMNFARRNSCNQCNEPRPEDSRPSGGDFRGRGYGG
FT                   ERGYRGRGGRGGDRGGYGGDRSGGGYGGDRSGGGYGGDRGGSYGGDRGGYGGDRGGSYG
FT                   GDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRGGYGGDRSRGAYGGDRGGSGSGSGGYGG
FT                   DRSGGYGGDRSGGYGGDRGGYGGDRGETTTEMISATDHTDDCFRYSFVSDMIRGELSEC
FT                   ACCFPHGLLGSEIDIWVFIWVGGLGAVFFLEMSIKKIPFYFPTFSFLTLKAKCVVKYCQ
FT                   NGKCFVILQ"
FT   gene            complement(5171842..5176564)
FT                   /gene="Ccl5"
FT                   /locus_tag="mCG_11684"
FT                   /note="gene_id=mCG11684.1"
FT   mRNA            complement(join(5171842..5172127,5175219..5175330,
FT                   5176453..5176564))
FT                   /gene="Ccl5"
FT                   /locus_tag="mCG_11684"
FT                   /product="chemokine (C-C motif) ligand 5"
FT                   /note="gene_id=mCG11684.1 transcript_id=mCT16931.0 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(5172040..5172127,5175219..5175330,
FT                   5176453..5176528))
FT                   /codon_start=1
FT                   /gene="Ccl5"
FT                   /locus_tag="mCG_11684"
FT                   /product="chemokine (C-C motif) ligand 5"
FT                   /note="gene_id=mCG11684.1 transcript_id=mCT16931.0
FT                   protein_id=mCP11675.1"
FT                   /db_xref="GOA:Q5XZF2"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:98262"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XZF2"
FT                   /protein_id="EDL15710.1"
FT                   /translation="MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYLSLALPRA
FT                   HVKEYFYTSSKCSNLAVVFVTRRNRQVCANPEKKWVQEYINYLEMS"
FT   gene            complement(5220993..5224949)
FT                   /gene="Ccl9"
FT                   /locus_tag="mCG_19020"
FT                   /note="gene_id=mCG19020.1"
FT   mRNA            complement(join(5220993..5221830,5222178..5222286,
FT                   5222710..5222781,5224724..5224949))
FT                   /gene="Ccl9"
FT                   /locus_tag="mCG_19020"
FT                   /product="chemokine (C-C motif) ligand 9"
FT                   /note="gene_id=mCG19020.1 transcript_id=mCT16894.1 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(5221719..5221830,5222178..5222286,
FT                   5222710..5222781,5224724..5224799))
FT                   /codon_start=1
FT                   /gene="Ccl9"
FT                   /locus_tag="mCG_19020"
FT                   /product="chemokine (C-C motif) ligand 9"
FT                   /note="gene_id=mCG19020.1 transcript_id=mCT16894.1
FT                   protein_id=mCP11639.1"
FT                   /db_xref="GOA:Q3U9T8"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:104533"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U9T8"
FT                   /protein_id="EDL15711.1"
FT                   /translation="MKPFHTALSFLILTTALGIWAQITHATETKEVQSSLKAQQGLEIE
FT                   MFHMGFQDSSDCCLSYNSRIQCSRFIGYFPTSGGCTRPGIIFISKRGFQVCANPSDRRV
FT                   QRCIERLEQNSQPRTYKQ"
FT   gene            <5230952..5272627
FT                   /gene="E230016K23Rik"
FT                   /locus_tag="mCG_144658"
FT                   /note="gene_id=mCG144658.0"
FT   mRNA            join(<5230952..5231030,5250190..5250323,5258952..5259076,
FT                   5259763..5259833,5260054..5260153,5269772..5269908,
FT                   5270288..5270459,5270572..5270737,5271470..5272627)
FT                   /gene="E230016K23Rik"
FT                   /locus_tag="mCG_144658"
FT                   /product="RIKEN cDNA E230016K23"
FT                   /note="gene_id=mCG144658.0 transcript_id=mCT184082.0
FT                   created on 05-JUN-2003"
FT   gene            complement(5236795..5241918)
FT                   /gene="Ccl6"
FT                   /locus_tag="mCG_11623"
FT                   /note="gene_id=mCG11623.1"
FT   mRNA            complement(join(5236795..5237842,5238205..5238316,
FT                   5238678..5238725,5241794..5241918))
FT                   /gene="Ccl6"
FT                   /locus_tag="mCG_11623"
FT                   /product="chemokine (C-C motif) ligand 6"
FT                   /note="gene_id=mCG11623.1 transcript_id=mCT16923.1 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(5237728..5237842,5238205..5238316,
FT                   5238678..5238725,5241794..5241869))
FT                   /codon_start=1
FT                   /gene="Ccl6"
FT                   /locus_tag="mCG_11623"
FT                   /product="chemokine (C-C motif) ligand 6"
FT                   /note="gene_id=mCG11623.1 transcript_id=mCT16923.1
FT                   protein_id=mCP11644.2"
FT                   /protein_id="EDL15713.1"
FT                   /translation="MRNSKTAISFFILVAVLGSQAGLIQEMEKEDRRYNPPIIHQGFQD
FT                   TSSDCCFSYATQIPCKRFIYYFPTSGGCIKPGIIFISRRGTQVCADPSDRRVQRCLSTL
FT                   KQGPRSGNKVIA"
FT   CDS             join(<5270573..5270737,5271470..5271835)
FT                   /codon_start=1
FT                   /gene="E230016K23Rik"
FT                   /locus_tag="mCG_144658"
FT                   /product="RIKEN cDNA E230016K23"
FT                   /note="gene_id=mCG144658.0 transcript_id=mCT184082.0
FT                   protein_id=mCP105658.0"
FT                   /protein_id="EDL15712.1"
FT                   /translation="PSPLLNSMPTFSLKKTNRQVKDKQGRISSRETKKEHETRTHFLVW
FT                   ALGLWLEPVQFLQDFYHEEMLDFIKDTKGNGPDPQACQKQQRYKVIEFMSTLQSASHPL
FT                   PFGKPIPSSCSRAVGTLCSACLPRVHRVCSQSVYPVLSQLLRNGVFCTRGRNTTFVVLF
FT                   FSALSFVEIRLPS"
FT   gene            complement(5293877..5294561)
FT                   /locus_tag="mCG_50795"
FT                   /note="gene_id=mCG50795.1"
FT   mRNA            complement(5293877..5294561)
FT                   /locus_tag="mCG_50795"
FT                   /product="mCG50795"
FT                   /note="gene_id=mCG50795.1 transcript_id=mCT50978.1 created
FT                   on 11-NOV-2002"
FT   CDS             complement(5293966..5294541)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50795"
FT                   /product="mCG50795"
FT                   /note="gene_id=mCG50795.1 transcript_id=mCT50978.1
FT                   protein_id=mCP33422.0"
FT                   /db_xref="GOA:S4R1R7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="MGI:MGI:3649210"
FT                   /db_xref="UniProtKB/TrEMBL:S4R1R7"
FT                   /protein_id="EDL15714.1"
FT                   /translation="MKTILSNQTVNIPENVKITLKGRTVIMKGPRGTLQRDFNHINVEL
FT                   SLLGKKKKRLRVDKWWGNRKELATIRNICSHVQNMIKSVTLGFRYKMRSMYAHFPINVL
FT                   SRRMTLWLKSEISWVKIHRRVQMRTGVACSVSQAQKNELILEGNDIELVSNSATLIQQA
FT                   TTVKNKDIRKCLDGIYVSEKGTVQQADE"
FT   gene            complement(5296765..5298277)
FT                   /gene="Ccl3"
FT                   /locus_tag="mCG_11624"
FT                   /note="gene_id=mCG11624.0"
FT   mRNA            complement(join(5296765..5297263,5297489..5297600,
FT                   5298122..5298277))
FT                   /gene="Ccl3"
FT                   /locus_tag="mCG_11624"
FT                   /product="chemokine (C-C motif) ligand 3"
FT                   /note="gene_id=mCG11624.0 transcript_id=mCT16924.1 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(5297173..5297263,5297489..5297600,
FT                   5298122..5298197))
FT                   /codon_start=1
FT                   /gene="Ccl3"
FT                   /locus_tag="mCG_11624"
FT                   /product="chemokine (C-C motif) ligand 3"
FT                   /note="gene_id=mCG11624.0 transcript_id=mCT16924.1
FT                   protein_id=mCP11648.1"
FT                   /db_xref="GOA:Q5QNW0"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:98260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QNW0"
FT                   /protein_id="EDL15715.1"
FT                   /translation="MKVSTTALAVLLCTMTLCNQVFSAPYGADTPTACCFSYSRKIPRQ
FT                   FIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA"
FT   gene            5311503..5313598
FT                   /gene="Ccl4"
FT                   /locus_tag="mCG_11627"
FT                   /note="gene_id=mCG11627.1"
FT   mRNA            join(5311503..5311656,5312377..5312491,5313212..5313598)
FT                   /gene="Ccl4"
FT                   /locus_tag="mCG_11627"
FT                   /product="chemokine (C-C motif) ligand 4"
FT                   /note="gene_id=mCG11627.1 transcript_id=mCT16927.1 created
FT                   on 31-JUL-2002"
FT   CDS             join(5311581..5311656,5312377..5312491,5313212..5313299)
FT                   /codon_start=1
FT                   /gene="Ccl4"
FT                   /locus_tag="mCG_11627"
FT                   /product="chemokine (C-C motif) ligand 4"
FT                   /note="gene_id=mCG11627.1 transcript_id=mCT16927.1
FT                   protein_id=mCP11650.2"
FT                   /db_xref="GOA:Q5QNV9"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="MGI:MGI:98261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QNV9"
FT                   /protein_id="EDL15716.1"
FT                   /translation="MKLCVSALSLLLLVAAFCAPGFSAPMGSDPPTSCCFSYTSRQLHR
FT                   SFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN"
FT   gene            5353210..5355352
FT                   /locus_tag="mCG_147555"
FT                   /note="gene_id=mCG147555.0"
FT   mRNA            join(5353210..5353256,5353877..5354025,5355152..5355352)
FT                   /locus_tag="mCG_147555"
FT                   /product="mCG147555"
FT                   /note="gene_id=mCG147555.0 transcript_id=mCT187818.0
FT                   created on 13-JAN-2004"
FT   CDS             join(5354000..5354025,5355152..5355317)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147555"
FT                   /product="mCG147555"
FT                   /note="gene_id=mCG147555.0 transcript_id=mCT187818.0
FT                   protein_id=mCP109321.0"
FT                   /protein_id="EDL15717.1"
FT                   /translation="MSAKLLSFKWLTAMWKMDSIFINMNDGQPQKISSEFTEPVLGYFL
FT                   ALELHSWTRKIYIVVTMP"
FT   gene            5358098..5360422
FT                   /gene="Expi"
FT                   /locus_tag="mCG_11682"
FT                   /note="gene_id=mCG11682.1"
FT   mRNA            join(5358098..5358281,5358939..5359081,5360238..5360422)
FT                   /gene="Expi"
FT                   /locus_tag="mCG_11682"
FT                   /product="extracellular proteinase inhibitor"
FT                   /note="gene_id=mCG11682.1 transcript_id=mCT16930.2 created
FT                   on 31-JUL-2002"
FT   CDS             join(5358200..5358281,5358939..5359081)
FT                   /codon_start=1
FT                   /gene="Expi"
FT                   /locus_tag="mCG_11682"
FT                   /product="extracellular proteinase inhibitor"
FT                   /note="gene_id=mCG11682.1 transcript_id=mCT16930.2
FT                   protein_id=mCP11652.2"
FT                   /protein_id="EDL15718.1"
FT                   /translation="MKTATVFVLVALIFMTMTTAWALSNPKEKPGACPKPPPRSFGTCD
FT                   ERCTGDGSCSGNMKCCSNGCGHACKPPVF"
FT   gene            5396150..5401795
FT                   /gene="1100001G20Rik"
FT                   /locus_tag="mCG_1032064"
FT                   /note="gene_id=mCG1032064.1"
FT   mRNA            join(5396150..5396276,5398386..5398486,5401647..5401795)
FT                   /gene="1100001G20Rik"
FT                   /locus_tag="mCG_1032064"
FT                   /product="RIKEN cDNA 1100001G20"
FT                   /note="gene_id=mCG1032064.1 transcript_id=mCT149768.1
FT                   created on 05-SEP-2002"
FT   CDS             join(5396180..5396276,5398386..5398480)
FT                   /codon_start=1
FT                   /gene="1100001G20Rik"
FT                   /locus_tag="mCG_1032064"
FT                   /product="RIKEN cDNA 1100001G20"
FT                   /note="gene_id=mCG1032064.1 transcript_id=mCT149768.1
FT                   protein_id=mCP85151.1"
FT                   /db_xref="GOA:Q8BTE6"
FT                   /db_xref="InterPro:IPR008197"
FT                   /db_xref="MGI:MGI:1913357"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BTE6"
FT                   /protein_id="EDL15719.1"
FT                   /translation="MKLGAFLLLVSLITLSLEVQELQAAVRPLQLLGTCAELCRGDWDC
FT                   GPEEQCVSIGCSHICTTN"
FT   gene            5402846..5431918
FT                   /locus_tag="mCG_118740"
FT                   /note="gene_id=mCG118740.0"
FT   mRNA            join(5402846..5403094,5403287..5403430,5404858..5404965,
FT                   5406458..5406598,5407437..5407552,5408452..5408566,
FT                   5410047..5410148,5414034..5414171,5415001..5415308,
FT                   5416226..5416403,5418204..5418410,5418816..5418915,
FT                   5421393..5421748,5423018..5423140,5423570..5423656,
FT                   5424851..5424985,5425764..5425886,5426388..5426512,
FT                   5427995..5428091,5428551..5428755,5430301..5431918)
FT                   /locus_tag="mCG_118740"
FT                   /product="mCG118740, transcript variant mCT119912"
FT                   /note="gene_id=mCG118740.0 transcript_id=mCT119912.1
FT                   created on 05-SEP-2002"
FT   mRNA            join(<5402866..5403298,5404858..5404965,5406458..5406598,
FT                   5407437..5407552,5408452..5408566,5410047..5410148,
FT                   5414034..5414171,5415001..5415308,5416226..5416403,
FT                   5418204..5418410,5418816..5418915,5421393..5421748,
FT                   5423018..5423140,5423570..5423656,5424851..5424985,
FT                   5425764..5425886,5426388..5426512,5427995..5428091,
FT                   5428551..5428755,5430301..5431171)
FT                   /locus_tag="mCG_118740"
FT                   /product="mCG118740, transcript variant mCT190999"
FT                   /note="gene_id=mCG118740.0 transcript_id=mCT190999.0
FT                   created on 08-MAR-2004"
FT   CDS             join(5402876..5403094,5403287..5403430,5404858..5404965,
FT                   5406458..5406598,5407437..5407552,5408452..5408566,
FT                   5410047..5410148,5414034..5414171,5415001..5415308,
FT                   5416226..5416403,5418204..5418410,5418816..5418915,
FT                   5421393..5421748,5423018..5423140,5423570..5423656,
FT                   5424851..5424985,5425764..5425886,5426388..5426512,
FT                   5427995..5428091,5428551..5428755,5430301..5430872)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118740"
FT                   /product="mCG118740, isoform CRA_a"
FT                   /note="gene_id=mCG118740.0 transcript_id=mCT119912.1
FT                   protein_id=mCP85541.1 isoform=CRA_a"
FT                   /protein_id="EDL15720.1"
FT                   /translation="MAAVQVAASLPCGQPREAPRELSPEQDDGFRRLSARLRALQPDDS
FT                   TVSRMEIHLLFDQLISENYSEGGGVAPELPSLVSDSGNVGARVVLVDFADVRTEAHKRS
FT                   SVTVWANGRARLEPKFVDVSALLVRACQLVPLNQNHLVSKVCQLIHRLLNRLQVVVDEP
FT                   NLDFLLTYTISALQQCSSWTHMEILQALAALVYCNGSKCQKHLPDLLGKSGLLMKLSDL
FT                   SHSDPEVRRAAVHCMANLCLSVPGQPYLEEPYQHVCFQAFLTILQSPKSSDMDDITFCM
FT                   LLQNALKGIQSLLNGGKMRLTQTEHLGALLAVLKKAMFHGLPGLNIEMPAVLYPTPLPQ
FT                   YDGRSPVKPQQPESTTARSSANKKKKHKVKTKKTQQGEKAEEEEEEPCGEVEAAPGLSM
FT                   DQANVSGESAWCSSPWGSQGLPVDGGRAAGREQASLPFASSSWKRVSSSESDYSDAEGG
FT                   MQGKMRSYQAKVRQGALACFLSTIKSIEKKVLYGYWSAFVPDTPELGSPQSVSLMTLTL
FT                   KDPSPKTRACALQVLSAILEGSKQFLSVAEDTSDHKRAFTPFSVTIASSIRELHRCLLL
FT                   ALVAESSSQTLTQIIKCLANLVSNAPYNRLKLSLLTKVWNHIKPYIRHKDVNVRVSSLT
FT                   LLGAIVSTHAPLPEVQLLLQQPCSSGLSSSSSATPHLSTPDGWKTFPAGSSLEEASLSS
FT                   PKGSSEPCWLIRLCISTVVLPKEDSCSGSDAGSALGSTYEPSPMRLEALQVLAHLARGY
FT                   FSTAQLYLMELGEVICKCMCEANPSIQLHGVKLLEELGAGLIQQYKPDSNIAPEQRVPV
FT                   HLVVVFWTAMLSGPLPRALQSAEHPTLQASACDALSSILPEAFSSLPNDKQILCITVLL
FT                   GLNDSKNHLVKAATSRALGVYVLFPCLRQDVIFVADTANAILMSLQDKSLNVRAKAAWS
FT                   LGNLTDTLIVNMDTPDPSFQDEFSGLLLLKMLQCAIQASTDKDKVKSNAVRALGNLLHF
FT                   LQPSHVERPRFAEIIEESIQALISTVVNEAAMKVRWNACYAMGNVFKNPALPLGTAPWT
FT                   SQAYKALTSVVMSCKNFKVRIRSAAALSVPSKRGQYGSLEQFIQIWSALVTALQKSEDT
FT                   TDFLEFKYCASLRTHICQALLHLLSLASASDLPGIQETLKLHGDMIRSYILQFLKSGAE
FT                   GDDPGAVHTPQERVQMVRVALKHIHRVQTLAGDTARGAIMGFLEDILTVHCDSSGEQVM
FT                   LRGPSDQ"
FT   CDS             join(<5403278..5403298,5404858..5404965,5406458..5406598,
FT                   5407437..5407552,5408452..5408566,5410047..5410148,
FT                   5414034..5414171,5415001..5415308,5416226..5416403,
FT                   5418204..5418410,5418816..5418915,5421393..5421748,
FT                   5423018..5423140,5423570..5423656,5424851..5424985,
FT                   5425764..5425886,5426388..5426512,5427995..5428091,
FT                   5428551..5428755,5430301..5430872)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118740"
FT                   /product="mCG118740, isoform CRA_b"
FT                   /note="gene_id=mCG118740.0 transcript_id=mCT190999.0
FT                   protein_id=mCP111961.0 isoform=CRA_b"
FT                   /protein_id="EDL15721.1"
FT                   /translation="RPQLPSLDVSALLVRACQLVPLNQNHLVSKVCQLIHRLLNRLQVV
FT                   VDEPNLDFLLTYTISALQQCSSWTHMEILQALAALVYCNGSKCQKHLPDLLGKSGLLMK
FT                   LSDLSHSDPEVRRAAVHCMANLCLSVPGQPYLEEPYQHVCFQAFLTILQSPKSSDMDDI
FT                   TFCMLLQNALKGIQSLLNGGKMRLTQTEHLGALLAVLKKAMFHGLPGLNIEMPAVLYPT
FT                   PLPQYDGRSPVKPQQPESTTARSSANKKKKHKVKTKKTQQGEKAEEEEEEPCGEVEAAP
FT                   GLSMDQANVSGESAWCSSPWGSQGLPVDGGRAAGREQASLPFASSSWKRVSSSESDYSD
FT                   AEGGMQGKMRSYQAKVRQGALACFLSTIKSIEKKVLYGYWSAFVPDTPELGSPQSVSLM
FT                   TLTLKDPSPKTRACALQVLSAILEGSKQFLSVAEDTSDHKRAFTPFSVTIASSIRELHR
FT                   CLLLALVAESSSQTLTQIIKCLANLVSNAPYNRLKLSLLTKVWNHIKPYIRHKDVNVRV
FT                   SSLTLLGAIVSTHAPLPEVQLLLQQPCSSGLSSSSSATPHLSTPDGWKTFPAGSSLEEA
FT                   SLSSPKGSSEPCWLIRLCISTVVLPKEDSCSGSDAGSALGSTYEPSPMRLEALQVLAHL
FT                   ARGYFSTAQLYLMELGEVICKCMCEANPSIQLHGVKLLEELGAGLIQQYKPDSNIAPEQ
FT                   RVPVHLVVVFWTAMLSGPLPRALQSAEHPTLQASACDALSSILPEAFSSLPNDKQILCI
FT                   TVLLGLNDSKNHLVKAATSRALGVYVLFPCLRQDVIFVADTANAILMSLQDKSLNVRAK
FT                   AAWSLGNLTDTLIVNMDTPDPSFQDEFSGLLLLKMLQCAIQASTDKDKVKSNAVRALGN
FT                   LLHFLQPSHVERPRFAEIIEESIQALISTVVNEAAMKVRWNACYAMGNVFKNPALPLGT
FT                   APWTSQAYKALTSVVMSCKNFKVRIRSAAALSVPSKRGQYGSLEQFIQIWSALVTALQK
FT                   SEDTTDFLEFKYCASLRTHICQALLHLLSLASASDLPGIQETLKLHGDMIRSYILQFLK
FT                   SGAEGDDPGAVHTPQERVQMVRVALKHIHRVQTLAGDTARGAIMGFLEDILTVHCDSSG
FT                   EQVMLRGPSDQ"
FT   gene            5449541..5450695
FT                   /locus_tag="mCG_11619"
FT                   /note="gene_id=mCG11619.2"
FT   mRNA            5449541..5450695
FT                   /locus_tag="mCG_11619"
FT                   /product="mCG11619"
FT                   /note="gene_id=mCG11619.2 transcript_id=mCT16919.2 created
FT                   on 11-NOV-2002"
FT   CDS             5449599..5450174
FT                   /codon_start=1
FT                   /locus_tag="mCG_11619"
FT                   /product="mCG11619"
FT                   /note="gene_id=mCG11619.2 transcript_id=mCT16919.2
FT                   protein_id=mCP11676.2"
FT                   /protein_id="EDL15722.1"
FT                   /translation="MAALTAEHFVALQSLLKASSKDAIRQLCQESFFSSSLDSKKKKKK
FT                   KKKLLDNTCSSLSVTQEAEQLLQALHHFTRLVAFRDLTSAEAILSLFPEKFHQNLKNLL
FT                   TKIILGHISTWRAEAQANQISLPHLVDLDWRVDIKTSSDNISRKVVPACLLQMKIQEDP
FT                   SLCGEKPSISAMTMELSKETLDTMLDGL"
FT   gene            complement(5466727..5498365)
FT                   /locus_tag="mCG_147535"
FT                   /note="gene_id=mCG147535.0"
FT   mRNA            complement(join(5466727..5469488,5498090..5498365))
FT                   /locus_tag="mCG_147535"
FT                   /product="mCG147535"
FT                   /note="gene_id=mCG147535.0 transcript_id=mCT187798.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5467139..5467531)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147535"
FT                   /product="mCG147535"
FT                   /note="gene_id=mCG147535.0 transcript_id=mCT187798.0
FT                   protein_id=mCP109301.0"
FT                   /protein_id="EDL15723.1"
FT                   /translation="MLTHSADAFCLLKVRSSPRTRYGDIVRSRKPCERGHQVRVEARSA
FT                   DGASNVNICWYCVAVGDAGGRNSLCRNSHCPGRARIPCWTWAKKADSPPPAKSVSGCGG
FT                   NWPMSGSLHWCCLWVVYLSRVVTYIV"
FT   gene            5499715..5555231
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /note="gene_id=mCG19019.3"
FT   mRNA            join(5499715..5500080,5513434..5513475,5531931..5532076)
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, transcript variant
FT                   mCT171270"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT171270.0 created
FT                   on 31-JUL-2002"
FT   mRNA            join(<5499889..5500232,5504744..5504943,5510979..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554760)
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, transcript variant
FT                   mCT16893"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT16893.0 created
FT                   on 31-JUL-2002"
FT   mRNA            join(<5499889..5500232,5504744..5504943,5511057..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554419)
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, transcript variant
FT                   mCT171269"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT171269.0 created
FT                   on 31-JUL-2002"
FT   CDS             join(5499889..5500232,5504744..5504943,5510979..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554343)
FT                   /codon_start=1
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, isoform CRA_a"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT16893.0
FT                   protein_id=mCP11677.0 isoform=CRA_a"
FT                   /protein_id="EDL15724.1"
FT                   /translation="MVSKLTSLQQELLSALLSSGVTKEVLIQALEELLPSPNFGVKLET
FT                   LPLSPGSGADLDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAA
FT                   EQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQ
FT                   KRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQNQGPGQSEDT
FT                   CSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRGVSPS
FT                   KAHGLGSNLVTEVRVYNWFANRRKEEAFRQKLAMDAYSSNQTHNLNPLLTHGSPHHQPS
FT                   SSPPNKMSGVRYNQPGNNEVTSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHSLLSPD
FT                   SKMQITVSGGGLPPVSTLTNIHSLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQAQGVP
FT                   VINSVASSLAALQPVQFSQQLHSPHQQPLMQQSPGSHMAQQPFMAAVTQLQNSHMYAHK
FT                   QEPPQYSHTSRFPSAMVVTDTSSINTLTSMSSSKQCPLQAW"
FT   CDS             join(5499889..5500232,5504744..5504943,5511057..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554343)
FT                   /codon_start=1
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, isoform CRA_d"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT171269.0
FT                   protein_id=mCP94189.0 isoform=CRA_d"
FT                   /protein_id="EDL15727.1"
FT                   /translation="MVSKLTSLQQELLSALLSSGVTKEVLIQALEELLPSPNFGVKLET
FT                   LPLSPGSGADLDTKPVFHTLTNGHAKGRLSGDEGSEDGDDYDTPPILKELQALNTEEAA
FT                   EQRAEVDRMLSEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGTPMKTQ
FT                   KRAALYTWYVRKQREILRQFSQQNQGPGQSEDTCSEPTNKKMRRNRFKWGPASQQILYQ
FT                   AYDRQKNPSKEEREALVEECNRAECLQRGVSPSKAHGLGSNLVTEVRVYNWFANRRKEE
FT                   AFRQKLAMDAYSSNQTHNLNPLLTHGSPHHQPSSSPPNKMSGVRYNQPGNNEVTSSSTI
FT                   SHHGNSAMVTSQSVLQQVSPASLDPGHSLLSPDSKMQITVSGGGLPPVSTLTNIHSLSH
FT                   HNPQQSQNLIMTPLSGVMAIAQSLNTSQAQGVPVINSVASSLAALQPVQFSQQLHSPHQ
FT                   QPLMQQSPGSHMAQQPFMAAVTQLQNSHMYAHKQEPPQYSHTSRFPSAMVVTDTSSINT
FT                   LTSMSSSKQCPLQAW"
FT   CDS             join(5499889..5500080,5513434..5513475,5531931..5532011)
FT                   /codon_start=1
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, isoform CRA_b"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT171270.0
FT                   protein_id=mCP94188.0 isoform=CRA_b"
FT                   /protein_id="EDL15725.1"
FT                   /translation="MVSKLTSLQQELLSALLSSGVTKEVLIQALEELLPSPNFGVKLET
FT                   LPLSPGSGADLDTKPVFHTLTISQAPLHPTRCQECATTSRETMRSLPLRQSVTMVTVPW
FT                   "
FT   mRNA            join(<5501801..5501955,5504744..5504943,5510979..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5555231)
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, transcript variant
FT                   mCT191026"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT191026.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5501951..5501955,5504744..5504943,5510979..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554343)
FT                   /codon_start=1
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, isoform CRA_c"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT191026.0
FT                   protein_id=mCP111974.0 isoform=CRA_c"
FT                   /protein_id="EDL15726.1"
FT                   /translation="LGEDPWRAAKMIKGYMQQHNIPQREVVDVTGLNQSHLSQHLNKGT
FT                   PMKTQKRAALYTWYVRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQNQGPG
FT                   QSEDTCSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQR
FT                   GVSPSKAHGLGSNLVTEVRVYNWFANRRKEEAFRQKLAMDAYSSNQTHNLNPLLTHGSP
FT                   HHQPSSSPPNKMSGVRYNQPGNNEVTSSSTISHHGNSAMVTSQSVLQQVSPASLDPGHS
FT                   LLSPDSKMQITVSGGGLPPVSTLTNIHSLSHHNPQQSQNLIMTPLSGVMAIAQSLNTSQ
FT                   AQGVPVINSVASSLAALQPVQFSQQLHSPHQQPLMQQSPGSHMAQQPFMAAVTQLQNSH
FT                   MYAHKQEPPQYSHTSRFPSAMVVTDTSSINTLTSMSSSKQCPLQAW"
FT   gene            5591711..5612655
FT                   /gene="Ddx52"
FT                   /locus_tag="mCG_11621"
FT                   /note="gene_id=mCG11621.1"
FT   mRNA            join(5591711..5591841,5592820..5593018,5594113..5594246,
FT                   5595682..5595867,5598024..5598167,5599162..5599273,
FT                   5600869..5600941,5601691..5601894,5602806..5602896,
FT                   5604660..5604782,5604868..5605018,5605551..5605626,
FT                   5607045..5607116,5609026..5609112,5611329..5612655)
FT                   /gene="Ddx52"
FT                   /locus_tag="mCG_11621"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 52"
FT                   /note="gene_id=mCG11621.1 transcript_id=mCT16921.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(5591755..5591841,5592820..5593018,5594113..5594246,
FT                   5595682..5595867,5598024..5598167,5599162..5599273,
FT                   5600869..5600941,5601691..5601894,5602806..5602896,
FT                   5604660..5604782,5604868..5605018,5605551..5605626,
FT                   5607045..5607116,5609026..5609112,5611329..5611386)
FT                   /codon_start=1
FT                   /gene="Ddx52"
FT                   /locus_tag="mCG_11621"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 52"
FT                   /note="gene_id=mCG11621.1 transcript_id=mCT16921.2
FT                   protein_id=mCP11636.2"
FT                   /db_xref="GOA:Q8K301"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1925644"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K301"
FT                   /protein_id="EDL15728.1"
FT                   /translation="MDSYDLFRRLGAGAKFDVKRFSADATRFQVGKRKFDSESLEVLKG
FT                   LDFFGNKKSVSDECGALQIHQEPPNEEKTQGVLLERSKEPKKKKRKKMTSEVPAQEDFD
FT                   GGIQWTSSVEAKLQDEKVSGEKKLTSGKLEHLRKEKVNFFRNKHKIHVQGTDLPDPIAT
FT                   FQQLDQEYKINSRLLQNILDAGFQVPTPIQMQAIPVMLHGRELLASAPTGSGKTLAFSI
FT                   PILMQLKQPTNKGFRALVISPTRELASQIHRELIKISEGTGFRIHMIHKAAIAAKKFGP
FT                   KSSKKFDILVTTPNRLIYLLKQDPPGIDLTNVEWLVVDESDKLFEDGKTGFREQLASIF
FT                   LACTSPKVRRAMFSATFAYDVEQWCKLNLDNVVSVSIGARNSAVETVEQELLFVGSETG
FT                   KLLAMRELVKKGFKPPVLVFVQSIERAKELFHELIYEGINVDVIHAERTQQQRDNTVHS
FT                   FRAGKIWVLICTALLARGIDFKGVNLVINYDFPTSSVEYIHRIGRTGRAGNRGKAVTFF
FT                   TEDDKPLLRSVANVIQQAGCPVPEYIKGFQKLLSKQKKKMIKKPLERESICTTPKYFLE
FT                   QAKQKKVAGQNSKKKETLKEKS"
FT   gene            <5613933..5691738
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /note="gene_id=mCG11683.2"
FT   mRNA            join(<5613933..5613981,5626739..5626860,5628579..5628709,
FT                   5631076..5631181,5637611..5637665,5639355..5639551,
FT                   5640370..5640618,5644004..5644137,5651534..5651646,
FT                   5651849..5651911,5658294..5659226,5669266..5669628,
FT                   5672942..5673105,5673959..5674012,5674676..5674772,
FT                   5676277..5676425,5688872..5688982,5689317..5689352,
FT                   5690458..5691737)
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /product="AP1 gamma subunit binding protein 1, transcript
FT                   variant mCT16934"
FT                   /note="gene_id=mCG11683.2 transcript_id=mCT16934.2 created
FT                   on 18-OCT-2002"
FT   CDS             join(5613933..5613981,5626739..5626860,5628579..5628709,
FT                   5631076..5631181,5637611..5637665,5639355..5639551,
FT                   5640370..5640618,5644004..5644137,5651534..5651646,
FT                   5651849..5651911,5658294..5659226,5669266..5669628,
FT                   5672942..5673105,5673959..5674012,5674676..5674772,
FT                   5676277..5676425,5688872..5688982,5689317..5689352,
FT                   5690458..5690589)
FT                   /codon_start=1
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /product="AP1 gamma subunit binding protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11683.2 transcript_id=mCT16934.2
FT                   protein_id=mCP11660.2 isoform=CRA_a"
FT                   /protein_id="EDL15729.1"
FT                   /translation="MKSRGRAAPPRRRPRLAGLIPMQQQGFPMVSVMQPNMQGMMGMNY
FT                   SSQMSQGPIAMQAGIPMGPMPAAGVPFLGQPPFLSMRPAGPQYTPDMQKQFAEEQQKRF
FT                   EQQQKLLEEERKRRQFEEQKQKLRLLSSVKPKDPAQSRMPPWIYNESLVPDAYKKILET
FT                   TMTPTGIDTAKLYPILMSSGLPRETLGQIWALANRTTPGRLTKEELYTVLAMVAVTQRG
FT                   VPAMSPDALSQFPAAPIPTLSGFPMTLPTPVSQPTAMPSGPTGSMPLTLGQPIMGINLV
FT                   GPVGGAAAPTSSGFMPAYPSNQVGKTEEDDFQDFQDASKSGSIDDSFTDFQEMPASSKT
FT                   SNSQHGNSAPSLLIPFPGTKASTDKYAVFKGISTDKPSENPASFGESGDKYSAFRELEQ
FT                   TTDSKPLGESFAEFRSTGTDDGFTDFKTADSVSPLEPPTKDTFPSAFASGAAQQTQTQV
FT                   KTPLNLEDLDMFSSVDCSGEKQVPFSATFSTAKSVSTRPQPAGSAAASAALASTKTSSL
FT                   ADDFGEFNLFGEYSNPASAGEQDDFADFMAFGNSSISSEPKASDKYEALREEVSPSPLS
FT                   SSTVEGAQHPPAAATKYDVFKQLSLEGAGLAMEEFKENTSSTKSDDDFADFHSSKFSST
FT                   SSDKSLGEKAVAFRHAKEDSSSVKSLDLPSIGGSSVGKEDSEDALSVQFDMKLADVGGD
FT                   LKHVMSDSSLDLPTVSGQHPPAAGSALASEDALPETAFPAFASFKDMMPQTTEQKEFES
FT                   GDFQDFTRQDMPTVDRSQETSCPSPASSVASHETPKEGADDFGEFQSEKSKISKFDFLV
FT                   ANSQSKMKSSEEMIKSELATFDLSVQGSHKRSLSLGDKEISRSSPSPALEQPFRDRSNT
FT                   LSERAALPVIRDKYKDLTGEVEENERYAYEWQRCLGSALDVIKKANDTLNGISSSAVCT
FT                   EVIQSAQGMEYLLGVVEVYRVTKRVELGIKATAVCSEKLQQLLKDIDKVWNNLIGFMSL
FT                   ATLTPDENSLDFSSCMLRPGIKNAQELACGVCLLNVDSRSRKEETPAEEQPKKAFNSET
FT                   DSFKLAYGGHQYHASCANFWINCVEPKPPGLLLPDLL"
FT   mRNA            join(<5621206..5621249,5626742..5626860,5628579..5628709,
FT                   5631076..5631181,5631855..5631966,5637588..5637665,
FT                   5639355..5639551,5640370..5640618,5644004..5644137,
FT                   5651534..5651646,5651849..5651911,5658294..5659226,
FT                   5669266..5669628,5672942..5673105,5673959..5674012,
FT                   5674676..5674772,5676277..5676425,5688872..5688982,
FT                   5690458..5691738)
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /product="AP1 gamma subunit binding protein 1, transcript
FT                   variant mCT191045"
FT                   /note="gene_id=mCG11683.2 transcript_id=mCT191045.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5621207..5621249,5626742..5626860,5628579..5628709,
FT                   5631076..5631181,5631855..5631966,5637588..5637665,
FT                   5639355..5639551,5640370..5640618,5644004..5644137,
FT                   5651534..5651646,5651849..5651911,5658294..5659226,
FT                   5669266..5669628,5672942..5673105,5673959..5674012,
FT                   5674676..5674772,5676277..5676425,5688872..5688982,
FT                   5690458..5690589)
FT                   /codon_start=1
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /product="AP1 gamma subunit binding protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11683.2 transcript_id=mCT191045.0
FT                   protein_id=mCP112001.0 isoform=CRA_b"
FT                   /protein_id="EDL15730.1"
FT                   /translation="SFMFPVAGGMRPPQGLIPMQQQGFPMVSVMQPNMQGMMGMNYSSQ
FT                   MSQGPIAMQAGIPMGPMPAAGVPFLGQPPFLSMRPAGPQYTPDMQKQFAEEQQKRFEQQ
FT                   QKLLEEERKRRQFEEQKQKLRLLSSVKPKTGEKNRDDALEAIKGNLDGFSRDAKMHPTP
FT                   ASHPKKQGVGVFPSQDPAQSRMPPWIYNESLVPDAYKKILETTMTPTGIDTAKLYPILM
FT                   SSGLPRETLGQIWALANRTTPGRLTKEELYTVLAMVAVTQRGVPAMSPDALSQFPAAPI
FT                   PTLSGFPMTLPTPVSQPTAMPSGPTGSMPLTLGQPIMGINLVGPVGGAAAPTSSGFMPA
FT                   YPSNQVGKTEEDDFQDFQDASKSGSIDDSFTDFQEMPASSKTSNSQHGNSAPSLLIPFP
FT                   GTKASTDKYAVFKGISTDKPSENPASFGESGDKYSAFRELEQTTDSKPLGESFAEFRST
FT                   GTDDGFTDFKTADSVSPLEPPTKDTFPSAFASGAAQQTQTQVKTPLNLEDLDMFSSVDC
FT                   SGEKQVPFSATFSTAKSVSTRPQPAGSAAASAALASTKTSSLADDFGEFNLFGEYSNPA
FT                   SAGEQDDFADFMAFGNSSISSEPKASDKYEALREEVSPSPLSSSTVEGAQHPPAAATKY
FT                   DVFKQLSLEGAGLAMEEFKENTSSTKSDDDFADFHSSKFSSTSSDKSLGEKAVAFRHAK
FT                   EDSSSVKSLDLPSIGGSSVGKEDSEDALSVQFDMKLADVGGDLKHVMSDSSLDLPTVSG
FT                   QHPPAAGSALASEDALPETAFPAFASFKDMMPQTTEQKEFESGDFQDFTRQDMPTVDRS
FT                   QETSCPSPASSVASHETPKEGADDFGEFQSEKSKISKFDFLVANSQSKMKSSEEMIKSE
FT                   LATFDLSVQGSHKRSLSLGDKEISRSSPSPALEQPFRDRSNTLSERAALPVIRDKYKDL
FT                   TGEVEENERYAYEWQRCLGSALDVIKKANDTLNGISSSAVCTEVIQSAQGMEYLLGVVE
FT                   VYRVTKRVELGIKATAVCSEKLQQLLKDIDKVWNNLIGFMSLATLTPDENSLDFSSCML
FT                   RPGIKNAQELACGVCLLNVDSRSRAFNSETDSFKLAYGGHQYHASCANFWINCVEPKPP
FT                   GLLLPDLL"
FT   gene            complement(5698105..5719323)
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /note="gene_id=mCG11620.2"
FT   mRNA            complement(join(5698105..5699374,5700896..5700984,
FT                   5718543..5718642,5719135..5719323))
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, transcript
FT                   variant mCT16920"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT16920.2 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5698105..5699374,5700896..5700984,
FT                   5718543..5718642,5718753..5718862))
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, transcript
FT                   variant mCT185272"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT185272.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5698105..5699374,5700896..5700984,
FT                   5717047..5717142))
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, transcript
FT                   variant mCT185273"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT185273.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(5698681..5699277)
FT                   /codon_start=1
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, isoform CRA_a"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT185272.0
FT                   protein_id=mCP106530.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TLZ7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020417"
FT                   /db_xref="InterPro:IPR020420"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1927168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLZ7"
FT                   /protein_id="EDL15731.1"
FT                   /translation="MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNR
FT                   HLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKH
FT                   GATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYES
FT                   QLFGKSSVKMVQTPYGIIPDVYEKESRHLMPYWGI"
FT   CDS             complement(5698681..5699277)
FT                   /codon_start=1
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, isoform CRA_a"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT185273.0
FT                   protein_id=mCP106531.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TLZ7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020417"
FT                   /db_xref="InterPro:IPR020420"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1927168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLZ7"
FT                   /protein_id="EDL15732.1"
FT                   /translation="MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNR
FT                   HLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKH
FT                   GATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYES
FT                   QLFGKSSVKMVQTPYGIIPDVYEKESRHLMPYWGI"
FT   CDS             complement(5698681..5699277)
FT                   /codon_start=1
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, isoform CRA_a"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT16920.2
FT                   protein_id=mCP11643.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TLZ7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020417"
FT                   /db_xref="InterPro:IPR020420"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1927168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLZ7"
FT                   /protein_id="EDL15733.1"
FT                   /translation="MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRASVASNR
FT                   HLLQARGITCVINATIEIPNFNWPQFEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKH
FT                   GATLVHCAAGVSRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYES
FT                   QLFGKSSVKMVQTPYGIIPDVYEKESRHLMPYWGI"
FT   gene            complement(5728834..5782715)
FT                   /gene="Tada2l"
FT                   /locus_tag="mCG_11688"
FT                   /note="gene_id=mCG11688.1"
FT   mRNA            complement(join(5728834..5729933,5734598..5734641,
FT                   5735523..5735655,5736995..5737066,5740422..5740532,
FT                   5741849..5741892,5743457..5743520,5752928..5753000,
FT                   5754067..5754155,5756064..5756221,5763042..5763133,
FT                   5771303..5771362,5774138..5774244,5780048..5780155,
FT                   5782663..5782715))
FT                   /gene="Tada2l"
FT                   /locus_tag="mCG_11688"
FT                   /product="transcriptional adaptor 2 (ADA2 homolog,
FT                   yeast)-like"
FT                   /note="gene_id=mCG11688.1 transcript_id=mCT16937.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(5729887..5729933,5734598..5734641,
FT                   5735523..5735655,5736995..5737066,5740422..5740532,
FT                   5741849..5741892,5743457..5743520,5752928..5753000,
FT                   5754067..5754155,5756064..5756221,5763042..5763133,
FT                   5771303..5771362,5774138..5774244,5780048..5780072))
FT                   /codon_start=1
FT                   /gene="Tada2l"
FT                   /locus_tag="mCG_11688"
FT                   /product="transcriptional adaptor 2 (ADA2 homolog,
FT                   yeast)-like"
FT                   /note="gene_id=mCG11688.1 transcript_id=mCT16937.2
FT                   protein_id=mCP11678.2"
FT                   /protein_id="EDL15734.1"
FT                   /translation="MDRLGSFSNDPSDKPPCRGCSSYLTEPYIKCAECGPPPFFLCLQC
FT                   FTRGFEYKKHQSDHTYEIMTSDFPVLDPSWTAQEEMALLEAVMDCGFGNWQDVANQMCT
FT                   KTKEECEKHYMKHFINNPLFASTLLNLKQAEAAKAADTAIPFHSADDPPRPAFDSLLSR
FT                   DMAGYMPARADFIEEFDNYAEWDLRDIDFVEDDSDILHALKMAVVDIYHSRLKERQRRK
FT                   KIIRDHGLVNLRKFRLMERRYPKEVQDLYETMRRFARIVGPVEHDKFIESHALEFELRR
FT                   EIKRLQEYRTAGITNFCSARTYDHLKKTREEERLKRTMLSEVLQYIQDSSACQQWLRRQ
FT                   ADIDSGLSPSVLMASNSALSGGEVGTWSLLGI"
FT   gene            5849244..6057523
FT                   /gene="Acaca"
FT                   /locus_tag="mCG_141310"
FT                   /note="gene_id=mCG141310.0"
FT   mRNA            join(5849244..5849493,5867952..5868084,5869638..5869776,
FT                   5876902..5877011,5878204..5878285,5879894..5879992,
FT                   5882451..5882557,5885182..5885292,5892341..5892550,
FT                   5896793..5896963,5898722..5898883,5899209..5899372,
FT                   5902929..5903079,5904747..5904850,5910199..5910280,
FT                   5910691..5910836,5912834..5912984,5914135..5914269,
FT                   5915021..5915167,5915907..5916095,5916783..5916883,
FT                   5917550..5917638,5923892..5924016,5930109..5930222,
FT                   5931371..5931484,5932441..5932530,5933967..5934085,
FT                   5943875..5943898,5946478..5946621,5947736..5947784,
FT                   5948738..5948845,5953869..5953925,5960918..5960959,
FT                   5965067..5965282,5966313..5966468,5969360..5969563,
FT                   5974116..5974271,5976073..5976186,5991939..5992208,
FT                   5995572..5995669,5999610..5999730,6000349..6000459,
FT                   6017765..6017908,6018428..6018548,6024636..6024732,
FT                   6027466..6027562,6028544..6028679,6036474..6036651,
FT                   6038404..6038516,6047463..6047617,6048169..6048339,
FT                   6053918..6054054,6055422..6055506,6056457..6057523)
FT                   /gene="Acaca"
FT                   /locus_tag="mCG_141310"
FT                   /product="acetyl-Coenzyme A carboxylase alpha"
FT                   /note="gene_id=mCG141310.0 transcript_id=mCT174523.0
FT                   created on 18-OCT-2002"
FT   CDS             join(5849270..5849493,5867952..5868084,5869638..5869776,
FT                   5876902..5877011,5878204..5878285,5879894..5879992,
FT                   5882451..5882557,5885182..5885292,5892341..5892550,
FT                   5896793..5896963,5898722..5898883,5899209..5899372,
FT                   5902929..5903079,5904747..5904850,5910199..5910280,
FT                   5910691..5910836,5912834..5912984,5914135..5914269,
FT                   5915021..5915167,5915907..5916095,5916783..5916883,
FT                   5917550..5917638,5923892..5924016,5930109..5930222,
FT                   5931371..5931484,5932441..5932530,5933967..5934085,
FT                   5943875..5943898,5946478..5946621,5947736..5947784,
FT                   5948738..5948845,5953869..5953925,5960918..5960959,
FT                   5965067..5965282,5966313..5966468,5969360..5969563,
FT                   5974116..5974271,5976073..5976186,5991939..5992208,
FT                   5995572..5995669,5999610..5999730,6000349..6000459,
FT                   6017765..6017908,6018428..6018548,6024636..6024732,
FT                   6027466..6027562,6028544..6028679,6036474..6036651,
FT                   6038404..6038516,6047463..6047617,6048169..6048339,
FT                   6053918..6054054,6055422..6055506,6056457..6056723)
FT                   /codon_start=1
FT                   /gene="Acaca"
FT                   /locus_tag="mCG_141310"
FT                   /product="acetyl-Coenzyme A carboxylase alpha"
FT                   /note="gene_id=mCG141310.0 transcript_id=mCT174523.0
FT                   protein_id=mCP97442.0"
FT                   /protein_id="EDL15735.1"
FT                   /translation="MDEPSPLAKTLELNQHSRFIIGSVSEDNSEDEISNLVKLDLEEKE
FT                   GSLSPASVSSDTLSDLGISGLQDGLAFHMRSSMSGLHLVKQGRDRKKIDSQRDFTVASP
FT                   AEFVTRFGGNKVIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKA
FT                   NAEYIKMADHYVPVPGGPNNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLL
FT                   KNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVP
FT                   QDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEV
FT                   PGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAV
FT                   FEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPA
FT                   AQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEG
FT                   FKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVA
FT                   LKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIAEKVQAERPDTMLGVVCGA
FT                   LHVADVSLRNSISNFLHSLERGQVLPAHTLLNTVDVELIYEGIKYVLKVTRQSPNSYVV
FT                   IMNGSCVEVDVHRLSDGGLLLSYDGSSYTTYMKEEVDRYRITIGNKTCVFEKENDPSVM
FT                   RSPSAGKLIQYIVEDGGHVFAGQCYAEIEVMKMVMTLTAVESGCIHYVKRPGAALDPGC
FT                   VIAKMQLDNPSKVQQAELHTGSLPQIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDP
FT                   FFSSRVKDWVERLMKTLRDPSLPLLELQDIMTSVSGRIPLNVEKSIKKEMAQYASNITS
FT                   VLCQFPSQQIANILDSHAATLNRKSEREVFFMNTQSIVQLVQRYRSGIRGHMKAVVMDL
FT                   LRQYLRVETQFQNGHYDKCVFALREENKSDMNTVLNYIFSHAQVTKKNLLVTMLIDQLC
FT                   GRDPTLTDELLNILTELTQLSKTTNAKVALRARQVLIASHLPSYELRHNQVESIFLSAI
FT                   DMYGHQFCIENLQKLILSETSIFDVLPNFFYHSNQVVRMAALEVYVRRAYIAYELNSVQ
FT                   HRQLKDNTCVVEFQFMLPTSHPNRGNIPTLNRMSFASNLNHYGMTHVASVSDVLLDNAF
FT                   TPPCQRMGGMVSFRTFEDFVSPTFPESGHTSLYDEDKVPRDEPIHILNVAIKTDGDIED
FT                   DRLAAMFREFTQQNKATLVEHGIRRLTFLVAQKREFPKFFTFRARDKFEEDRIYRHLEP
FT                   ALAFQLELNRMRNFDLTAIPCANHKMHLYLGAAKVEVGTEVTDYRFFVRAIIRHSDLVT
FT                   KEASFEYLQNEGERLLLEAMDELEVAFNNTNVRTDCNHIFLNFVPTVIMDPSKIEESVR
FT                   SMVMRYGSRLWKLRVLQAELKINIRLTTTGKAIPIRLFLTNESGYYLDISLYKEVTDSR
FT                   TAQIMFQAYGDKQGPLHGMLINTPYVTKDLLQSKRFQAQSLGTTYIYDIPEMFRQSLIK
FT                   LWESMSTQAFLPSPPLPSDILTYTELVLDDQGQLIGMVAWKMSLKSPEYPDGRDIIVIG
FT                   NDITYRIGSFGPQEDLLFLRASELARAEGIPRIYVAANSGARIGLAEEIRHMFHVAWVD
FT                   PEDPYKGYKYLYLTPQDYKRVSALNSVHCEHVEDEGESRYKITDIIGKEEGLGAENLRG
FT                   SGMIAGESSLAYDEVITISLVTCRAIGIGAYLVRLGQRTIQVENSHLILTGAGALNKVL
FT                   GREVYTSNNQLGGIQIMHNNGVTHSTVCDDFEGVFTVLHWLSYMPKSVHSSVPLLNSKD
FT                   PIDRIIEFVPTKAPYDPRWMLAGRPHPTQKGQWLSGFFDYGSFSEIMQPWAQTVVVGRA
FT                   RLGGIPVGVVAVETRTVELSIPADPANLDSEAKIIQQAGQVWFPDSAFKTYQAIKDFNR
FT                   EGLPLMVFANWRGFSGGMKDMYDQVLKFGAYIVDGLRECSQPVMVYIPPQAELRGGSWV
FT                   VIDPTINPRHMEMYADRESRGSVLEPEGTVEIKFRKKDLVKTMRRVDPVYIRLAERLGT
FT                   PELSPTERKELESKLKEREEFLIPIYHQVAVQFADLHDTPGRMQEKGVINDILDWKTSR
FT                   TFFYWRLRRLLLEDLVKKKIHNANPELTDGQIQAMLRRWFVEVEGTVKAYVWDNNKDLV
FT                   EWLEKQLTEEDGVRSVIEENIKYISRDYVLKQIRSLVQANPEVAMDSIVHMTQHISPTQ
FT                   RAEVKVWRVTHLMTPVLSAPETGLLDVRRLPGNKNSPALKIPYSSVSVLVFPDFWALCG
FT                   QQHGFLRGGLKSLTTHLSKKAADGSAFVFIKQE"
FT   gene            complement(5861575..5861945)
FT                   /pseudo
FT                   /locus_tag="mCG_11278"
FT                   /note="gene_id=mCG11278.1"
FT   mRNA            complement(5861575..5861945)
FT                   /pseudo
FT                   /locus_tag="mCG_11278"
FT                   /note="gene_id=mCG11278.1 transcript_id=mCT11717.1 created
FT                   on 18-OCT-2002"
FT   gene            complement(6078876..>6170854)
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /note="gene_id=mCG11286.1"
FT   mRNA            complement(join(6078876..6079039,6098563..6098634,
FT                   6101622..6101702,6105130..6105197,6123496..6123579,
FT                   6126967..6127166,6128932..6129046,6167247..6167384,
FT                   6167787..6168005,6168836..6168931,6169494..6169682,
FT                   6170645..>6170854))
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /product="apoptosis antagonizing transcription factor,
FT                   transcript variant mCT11725"
FT                   /note="gene_id=mCG11286.1 transcript_id=mCT11725.1 created
FT                   on 01-AUG-2002"
FT   mRNA            complement(join(6078903..6079039,6098563..6098634,
FT                   6101622..6101702,6105130..6105197,6123496..6123579,
FT                   6126967..6127166,6128932..6129046,6147638..6147726))
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /product="apoptosis antagonizing transcription factor,
FT                   transcript variant mCT171265"
FT                   /note="gene_id=mCG11286.1 transcript_id=mCT171265.0 created
FT                   on 01-AUG-2002"
FT   CDS             complement(join(6078976..6079039,6098563..6098634,
FT                   6101622..6101702,6105130..6105197,6123496..6123579,
FT                   6126967..6127005))
FT                   /codon_start=1
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /product="apoptosis antagonizing transcription factor,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11286.1 transcript_id=mCT171265.0
FT                   protein_id=mCP94184.0 isoform=CRA_a"
FT                   /protein_id="EDL15736.1"
FT                   /translation="MIKPSLLLENWARETLPQGPANAHLRDLDEEIFDDDDFYHQLLRE
FT                   LIERKTSSLDPNDQVAMGRQWLAIQKLRSKIRKKVDRKASKGRKLRFHVLSKLLSFMAP
FT                   IDHTAMSDDARTELFRSLFGQLNPPDADRGK"
FT   CDS             complement(join(6123530..6123579,6126967..6127166,
FT                   6128932..6129046,6167247..6167384,6167787..6168005,
FT                   6168836..6168931,6169494..6169682,6170645..>6170852))
FT                   /codon_start=1
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /product="apoptosis antagonizing transcription factor,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11286.1 transcript_id=mCT11725.1
FT                   protein_id=mCP11656.1 isoform=CRA_b"
FT                   /protein_id="EDL15737.1"
FT                   /translation="RLELPSRVWAVAPLLRVSGRGARAAVQVHERSAGSDLVTMAAPQP
FT                   LALQLEQLLNPRPREADPEADPEEATRARVIDRFDEGEEEKDDLAVSSIRKLAPVSLLD
FT                   TDKRYSGKTTSRKAWKEDHWEQALPSSSDNEASDEGGSEDGDSEGLGLEEISEDVDEDL
FT                   EDNKISDEGGSEDGDSEGLGLEEFSEDVEEDLEGEDEEDREEDRNSEDDGVVAAFSSVK
FT                   VSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPVFKDKGGPEFASAL
FT                   KNSHKALKALLRSLVDLQEELLFQYPDTRHIVNGAKPNTESEEISSEDDELVGEKKKQR
FT                   KAPPKRKLEMEDYPSFMAKRFADFTIYRNHTLQKWHDKTKLASGKLGKGDASSGPCQCP
FT                   PEGLG"
FT   gene            complement(6176729..6182884)
FT                   /gene="Lhx1"
FT                   /locus_tag="mCG_11270"
FT                   /note="gene_id=mCG11270.1"
FT   mRNA            complement(join(6176729..6177278,6177634..6177799,
FT                   6179040..6179317,6179411..6179637,6181356..6182884))
FT                   /gene="Lhx1"
FT                   /locus_tag="mCG_11270"
FT                   /product="LIM homeobox protein 1"
FT                   /note="gene_id=mCG11270.1 transcript_id=mCT11711.1 created
FT                   on 01-AUG-2002"
FT   CDS             complement(join(6176899..6177278,6177634..6177799,
FT                   6179040..6179317,6179411..6179637,6181356..6181525))
FT                   /codon_start=1
FT                   /gene="Lhx1"
FT                   /locus_tag="mCG_11270"
FT                   /product="LIM homeobox protein 1"
FT                   /note="gene_id=mCG11270.1 transcript_id=mCT11711.1
FT                   protein_id=mCP11661.2"
FT                   /db_xref="GOA:Q569N5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:99783"
FT                   /db_xref="UniProtKB/TrEMBL:Q569N5"
FT                   /protein_id="EDL15738.1"
FT                   /translation="MVHCAGCKRPILDRFLLNVLDRAWHVKCVQCCECKCNLTEKCFSR
FT                   EGKLYCKNDFFRCFGTKCAGCAQGISPSDLVRRARSKVFHLNCFTCMMCNKQLSTGEEL
FT                   YIIDENKFVCKEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSD
FT                   KEGGSNENDDQNLGAKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMR
FT                   VIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNGPFSFYGD
FT                   YQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTPLGGLDHPLPGHHPSSEA
FT                   QRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPE
FT                   MNEAAVW"
FT   gene            <6183033..6193133
FT                   /locus_tag="mCG_145244"
FT                   /note="gene_id=mCG145244.0"
FT   mRNA            join(<6183033..6183098,6191783..6191963,6192419..6192524,
FT                   6192887..6193133)
FT                   /locus_tag="mCG_145244"
FT                   /product="mCG145244"
FT                   /note="gene_id=mCG145244.0 transcript_id=mCT184668.0
FT                   created on 05-JUN-2003"
FT   CDS             <6192929..6193102
FT                   /codon_start=1
FT                   /locus_tag="mCG_145244"
FT                   /product="mCG145244"
FT                   /note="gene_id=mCG145244.0 transcript_id=mCT184668.0
FT                   protein_id=mCP105660.0"
FT                   /protein_id="EDL15739.1"
FT                   /translation="PGLKKESEEGESPRKGGDSWNFCLHWSTTHVSYAIISKFHIYCSC
FT                   LQCVCPGRMLLG"
FT   gene            complement(<6376442..>6379519)
FT                   /locus_tag="mCG_1032072"
FT                   /note="gene_id=mCG1032072.0"
FT   mRNA            complement(join(<6376442..6376625,6379405..>6379519))
FT                   /locus_tag="mCG_1032072"
FT                   /product="mCG1032072"
FT                   /note="gene_id=mCG1032072.0 transcript_id=mCT149776.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(<6376442..>6376603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032072"
FT                   /product="mCG1032072"
FT                   /note="gene_id=mCG1032072.0 transcript_id=mCT149776.0
FT                   protein_id=mCP85413.0"
FT                   /protein_id="EDL15740.1"
FT                   /translation="PLQHSRTKRGPASTGGKRELTPQRCHLTSADVPWHVYVCTYAHAH
FT                   IPIIKTTTT"
FT   gene            complement(6477518..>6483967)
FT                   /gene="Mrm1"
FT                   /locus_tag="mCG_145254"
FT                   /note="gene_id=mCG145254.0"
FT   mRNA            complement(join(6477518..6478966,6479141..6479260,
FT                   6479360..6479492,6483052..6483145,6483289..>6483967))
FT                   /gene="Mrm1"
FT                   /locus_tag="mCG_145254"
FT                   /product="mitochondrial rRNA methyltransferase 1 homolog
FT                   (S. cerevisiae)"
FT                   /note="gene_id=mCG145254.0 transcript_id=mCT184678.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(6478887..6478966,6479141..6479260,
FT                   6479360..6479492,6483052..6483145,6483289..>6483938))
FT                   /codon_start=1
FT                   /gene="Mrm1"
FT                   /locus_tag="mCG_145254"
FT                   /product="mitochondrial rRNA methyltransferase 1 homolog
FT                   (S. cerevisiae)"
FT                   /note="gene_id=mCG145254.0 transcript_id=mCT184678.0
FT                   protein_id=mCP105670.0"
FT                   /protein_id="EDL15741.1"
FT                   /translation="LSWLEGQVVGSPCEGTKCGRSTGPPQLSVSGVSGAAGAMRRLWTV
FT                   GCFSRLIARHFSSVARRGERPGGEELSRLLLDDLAPAQRLERLFGLSPCLLALRAARRR
FT                   VARLLLQAGKAGLQGERAELLRVAEARGIPVLRPRRQKLDALCGYQVHQGVCMEVSPLR
FT                   PRPCDEAADTSSGDDPQQLWLVLEGLQDPRNLGAVMRSAHFLGVDRVITSQRNSCPLTP
FT                   VVSKASAGAMEVMDVFATPDLPGFLQAKAQQGWLVVGTVGCPGPEISQSSKVPITSCLE
FT                   FVWDRPTLLVLGSEGSGLSQEVFASCQLLLTILPRRHLPPGLESLNVSVATGILLHSIC
FT                   SQKKGFPVQERGQLLQDS"
FT   gene            complement(6484230..6493440)
FT                   /gene="BC022224"
FT                   /locus_tag="mCG_11280"
FT                   /note="gene_id=mCG11280.1"
FT   mRNA            complement(join(6484230..6485753,6485855..6485920,
FT                   6486117..6486209,6486763..6486892,6487524..6487618,
FT                   6489820..6490029,6493191..6493440))
FT                   /gene="BC022224"
FT                   /locus_tag="mCG_11280"
FT                   /product="cDNA sequence BC022224"
FT                   /note="gene_id=mCG11280.1 transcript_id=mCT11719.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(6485712..6485753,6485855..6485920,
FT                   6486117..6486209,6486763..6486892,6487524..6487618,
FT                   6489820..6490029,6493191..6493337))
FT                   /codon_start=1
FT                   /gene="BC022224"
FT                   /locus_tag="mCG_11280"
FT                   /product="cDNA sequence BC022224"
FT                   /note="gene_id=mCG11280.1 transcript_id=mCT11719.1
FT                   protein_id=mCP11657.2"
FT                   /protein_id="EDL15742.1"
FT                   /translation="MTRAGMERWRDRLALVTGASGGIGAAVARALVQQGLKVVGCARTV
FT                   GNIEELAAECKSAGYPGTLIPYRCDLSNEEDILSMFSAVRSQHSGVDICINNAGMARPD
FT                   TLLSGSTSGWKDMFNVNVLALSICTREAYQSMKERNIDDGHIININSMCGHRVPPQSVI
FT                   HFYSATKYAVTALTEGLRQELLEAQTHIRATCISPGLVETQFAFKLHDKDPGEAAATYE
FT                   HIKCLRPEDVAEAVIYVLSTPPHVQVGDIQMRPTEQVT"
FT   gene            <6493616..6495308
FT                   /locus_tag="mCG_145243"
FT                   /note="gene_id=mCG145243.0"
FT   mRNA            join(<6493616..6493852,6494342..6494482,6494930..6495308)
FT                   /locus_tag="mCG_145243"
FT                   /product="mCG145243"
FT                   /note="gene_id=mCG145243.0 transcript_id=mCT184667.0
FT                   created on 05-JUN-2003"
FT   CDS             <6493617..6493850
FT                   /codon_start=1
FT                   /locus_tag="mCG_145243"
FT                   /product="mCG145243"
FT                   /note="gene_id=mCG145243.0 transcript_id=mCT184667.0
FT                   protein_id=mCP105659.0"
FT                   /protein_id="EDL15743.1"
FT                   /translation="HSLEDRGPPRKWGLTAGGVAFTVSASLCGGEPPSARKRTHARTHS
FT                   RPPLLNQPYFQRPEDRMGDLKVTPVPSQTTGD"
FT   gene            complement(6496799..6534726)
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /note="gene_id=mCG11275.1"
FT   mRNA            complement(join(6496799..6497652,6498774..6499022,
FT                   6500804..6500952,6501038..6501163,6502280..6502427,
FT                   6504420..6504614,6504700..6504874,6505854..6506063,
FT                   6518630..6518743,6518831..6518956,6523012..6523110,
FT                   6525121..6525374,6526814..6526894,6534452..6534726))
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /product="gametogenetin binding protein 2, transcript
FT                   variant mCT11714"
FT                   /note="gene_id=mCG11275.1 transcript_id=mCT11714.1 created
FT                   on 06-SEP-2002"
FT   mRNA            complement(join(6497298..6497652,6498774..6499022,
FT                   6500804..6500952,6501038..6501165,6523012..6523110,
FT                   6525121..6525374,6526814..6526894,6534452..>6534643))
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /product="gametogenetin binding protein 2, transcript
FT                   variant mCT172620"
FT                   /note="gene_id=mCG11275.1 transcript_id=mCT172620.0 created
FT                   on 06-SEP-2002"
FT   CDS             complement(join(6497449..6497652,6498774..6499022,
FT                   6500804..6500952,6501038..6501163,6502280..6502427,
FT                   6504420..6504614,6504700..6504874,6505854..6506063,
FT                   6518630..6518743,6518831..6518956,6523012..6523110,
FT                   6525121..6525374,6526814..6526894,6534452..6534544))
FT                   /codon_start=1
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /product="gametogenetin binding protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG11275.1 transcript_id=mCT11714.1
FT                   protein_id=mCP11646.1 isoform=CRA_b"
FT                   /protein_id="EDL15745.1"
FT                   /translation="MARLVAVCRDGEEEFPFERRQIPLYIDDTLTMVMEFPDNVLNLDG
FT                   HQNNGAQLKQFIQRHSMLKQQDLSIAMVVTSREVLSALSQLVPCVGCRRSVERLFSQLV
FT                   ESGNPALEPLTVGPKGVLSLTRSCMTDAKKLYTLFYVHGSKLNDMIDAIPKSKKNKRCQ
FT                   LHSLDTHKPKPLGEGSSSSVSSEKLSTDKRSSEDHRKDSKCRIIFHYGPFQGTARGCWM
FT                   DVWELMSQECRDEVVLIDSSCLLETLETYLRKHRFCTDCKNKVLRAYNILIGELDCSKE
FT                   KGYCAALYEGLRCCPHERHIHVCCETDFIAHLLGRAEPEFAGGYERRERHAKTIDIAQE
FT                   EVLTCLGIHLYERLHRIWQKLRAEEQTWQMLFYLGVDALRKSFEMTVEKVQGISRLEQL
FT                   CEEFSEEERVRELKQEKKRQKRKNRRKNKCVCDTPASLHTADEKAVSREKETDFIENSC
FT                   NACGSAEDGETCVEVMVTSENTSCTCPSSGNLLGSPKIKKGMSPHCNGSDCGYSSSMEG
FT                   SETGSREGSDVACTEGICNHDEHGEDSCVHHCEDKEDDGDSCVECWANSEENNIKGKNK
FT                   KKKKKSKMLKCDEHIQKLGSCITDPGNRETSGNTMHTVFHRDKTKDAHPESCCSTEKGG
FT                   QPLPWFEHRKSVPQFTEPTEMSFGPDSGKGAKSLVELLDESECTSDEEIFISQDEIQSF
FT                   MANNQSFYSNREQYRQHLKEKFNKYCRLNDHKRPVCSGWLTTAGAN"
FT   CDS             complement(join(6497449..6497652,6498774..6499022,
FT                   6500804..6500952,6501038..6501165,6523012..6523110,
FT                   6525121..>6525338))
FT                   /codon_start=1
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /product="gametogenetin binding protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG11275.1 transcript_id=mCT172620.0
FT                   protein_id=mCP95539.0 isoform=CRA_a"
FT                   /protein_id="EDL15744.1"
FT                   /translation="AMVVTSREVLSALSQLVPCVGCRRSVERLFSQLVESGNPALEPLT
FT                   VGPKGVLSLTRSCMTDAKKLYTLFYVHGSKLNDMIDAIPKSKKNKRCQLHSLDTHKPKP
FT                   LGGMSPHCNGSDCGYSSSMEGSETGSREGSDVACTEGICNHDEHGEDSCVHHCEDKEDD
FT                   GDSCVECWANSEENNIKGKNKKKKKKSKMLKCDEHIQKLGSCITDPGNRETSGNTMHTV
FT                   FHRDKTKDAHPESCCSTEKGGQPLPWFEHRKSVPQFTEPTEMSFGPDSGKGAKSLVELL
FT                   DESECTSDEEIFISQDEIQSFMANNQSFYSNREQYRQHLKEKFNKYCRLNDHKRPVCSG
FT                   WLTTAGAN"
FT   gene            complement(6540869..6545085)
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /note="gene_id=mCG52793.2"
FT   mRNA            complement(join(6540869..6543068,6545063..6545085))
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class W, transcript variant mCT180885"
FT                   /note="gene_id=mCG52793.2 transcript_id=mCT180885.0 created
FT                   on 05-MAR-2003"
FT   mRNA            complement(join(6540869..6543068,6544275..6544676))
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class W, transcript variant mCT52976"
FT                   /note="gene_id=mCG52793.2 transcript_id=mCT52976.2 created
FT                   on 05-MAR-2003"
FT   CDS             complement(6541546..6543057)
FT                   /codon_start=1
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class W, isoform CRA_a"
FT                   /note="gene_id=mCG52793.2 transcript_id=mCT180885.0
FT                   protein_id=mCP103807.0 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZN11"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="MGI:MGI:1917575"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN11"
FT                   /protein_id="EDL15746.1"
FT                   /translation="MSQKQLKEAFVRNLSGTSVLEVTQGLCFPAFCILCRGLWIIFSQH
FT                   VCSFSNTWSTRFLMDFVVLIVPLVITLTVLSSFILLENLTVIVWGAWLLYQIYHRRTCY
FT                   AKVPVQKVFANFLKISLESEYNPAITCYRVINSVFTAIAILAVDFPLFPRRFAKTELYG
FT                   TGAMDFGVGGFIFGAAMVCPEVRRKSIEESRFNYLRKSLYSVWPLVFLGMGRLVIIKSI
FT                   GYQEHSTEYGIHWNFFFTIIVVRLVTSLLLIIFPLNKSWIVAVSITVVYQLALDYTPLK
FT                   RILLYGTDGSGTRVGFLNANREGIISTLGYVTIHMAGVQTGLYVLKGRAQVRDWIKATC
FT                   WVFSVAVGFFISLHIVQVNIEAVSRRMANLAFCLWVVASSLMLLSCLLLSGIILSFAQF
FT                   LIKGSLVPCSWKLIQSPTTHKNHSESLILEAEKNQPSLCLITALNRNQLFFFLLSNITT
FT                   GLINLTMDTLHTGALWTLVVLSIYMFTNCLVIYVLDLQGKTIKFW"
FT   CDS             complement(6541546..6543057)
FT                   /codon_start=1
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class W, isoform CRA_a"
FT                   /note="gene_id=mCG52793.2 transcript_id=mCT52976.2
FT                   protein_id=mCP33420.2 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZN11"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="MGI:MGI:1917575"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN11"
FT                   /protein_id="EDL15747.1"
FT                   /translation="MSQKQLKEAFVRNLSGTSVLEVTQGLCFPAFCILCRGLWIIFSQH
FT                   VCSFSNTWSTRFLMDFVVLIVPLVITLTVLSSFILLENLTVIVWGAWLLYQIYHRRTCY
FT                   AKVPVQKVFANFLKISLESEYNPAITCYRVINSVFTAIAILAVDFPLFPRRFAKTELYG
FT                   TGAMDFGVGGFIFGAAMVCPEVRRKSIEESRFNYLRKSLYSVWPLVFLGMGRLVIIKSI
FT                   GYQEHSTEYGIHWNFFFTIIVVRLVTSLLLIIFPLNKSWIVAVSITVVYQLALDYTPLK
FT                   RILLYGTDGSGTRVGFLNANREGIISTLGYVTIHMAGVQTGLYVLKGRAQVRDWIKATC
FT                   WVFSVAVGFFISLHIVQVNIEAVSRRMANLAFCLWVVASSLMLLSCLLLSGIILSFAQF
FT                   LIKGSLVPCSWKLIQSPTTHKNHSESLILEAEKNQPSLCLITALNRNQLFFFLLSNITT
FT                   GLINLTMDTLHTGALWTLVVLSIYMFTNCLVIYVLDLQGKTIKFW"
FT   gene            <6545200..6557802
FT                   /locus_tag="mCG_145248"
FT                   /note="gene_id=mCG145248.0"
FT   mRNA            join(<6545200..6545346,6547422..6547563,6549950..6550088,
FT                   6550419..6550567,6552803..6552916,6556825..6557802)
FT                   /locus_tag="mCG_145248"
FT                   /product="mCG145248"
FT                   /note="gene_id=mCG145248.0 transcript_id=mCT184672.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6547546..6547563,6549950..6550088,6550419..6550567,
FT                   6552803..6552916,6556825..6557031)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145248"
FT                   /product="mCG145248"
FT                   /note="gene_id=mCG145248.0 transcript_id=mCT184672.0
FT                   protein_id=mCP105664.0"
FT                   /protein_id="EDL15748.1"
FT                   /translation="STMLQQVNGHSLGSDAEGRASLKGDLREFLGGEIPLHQLDDLTKV
FT                   NPVTLETVLRCLQARYTEDIFYTNAGCTLVALNPFKHVPQLYAPELMQEYHAAPQPQKL
FT                   KPHIFTVGEQTYRNVKSLIEPVNQSIVVSGESGAGKTWTSRCLMKFYAVVAASPTSCEN
FT                   HKIAERIEQRILNSNPVMEAFGKLSVLALPSGAISSATRPPLPRC"
FT   gene            <6559339..6575863
FT                   /locus_tag="mCG_146190"
FT                   /note="gene_id=mCG146190.0"
FT   mRNA            join(<6559339..6559396,6560012..6560108,6560222..6560298,
FT                   6561865..6561955,6562293..6562464,6564121..6564194,
FT                   6564940..6565061,6565218..6565331,6565586..6565762,
FT                   6566095..6566247,6566844..6566951,6567901..6567971,
FT                   6570286..6570389,6571982..6572148,6572252..6572381,
FT                   6572966..6573051,6574000..6574299,6575139..6575863)
FT                   /locus_tag="mCG_146190"
FT                   /product="mCG146190"
FT                   /note="gene_id=mCG146190.0 transcript_id=mCT186293.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<6559340..6559396,6560012..6560108,6560222..6560298,
FT                   6561865..6561955,6562293..6562464,6564121..6564194,
FT                   6564940..6565061,6565218..6565331,6565586..6565762,
FT                   6566095..6566247,6566844..6566951,6567901..6567971,
FT                   6570286..6570389,6571982..6572148,6572252..6572381,
FT                   6572966..6573051,6574000..6574299,6575139..6575267)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146190"
FT                   /product="mCG146190"
FT                   /note="gene_id=mCG146190.0 transcript_id=mCT186293.0
FT                   protein_id=mCP107522.0"
FT                   /protein_id="EDL15749.1"
FT                   /translation="KTRVACQASSERNFHIFYQICKGATKDERLQWHLPEGTAFSWLPN
FT                   PESSLEEDCFEVTREAMLHLGIDTPTQNNIFKVLAGLLHLGNVHFVDSEDEALPCQVMD
FT                   DTKVSVRTSALLLQLPEKMLLESMQIRTIKAGKQQQVFQKPCSRAECDTRRDCLAKLIY
FT                   ARLFDWLVSVINSSICADSKSWTAFIGLLDVYGFESFPNNSLEQLCINYANEKLQQHFV
FT                   AHYLRAQQEEYEVEGLEWSFVNYQDNQTCLDLLEGSPISICSLINEECRLNRPSSAAQL
FT                   QTRIESTLAGRPCLGHNKLSREPSFVVVHFAGPVRYHTAGLVEKNKDPVPPELTELLQQ
FT                   SQDPLLTMLFPANPEEKTQEELSGQSRAPALTVVSKFKASLEQLLQVLHNTTPHYIRCI
FT                   KPNSQSQPQTFLQEEVLNQLEACGLVETIHISAAGFPIRVSHQNFIERYKLLRRLGPRM
FT                   SSGLGGLEPAEGSSEQPLCAKEATLQPLLQDILHALPALIQTAATPSDPAKNTQIPLYC
FT                   GRTKIFMTDSMLELLECGRAQMLEQCARCIQCGWRRHRLQKQEKQRRAAVLIQAAFRSW
FT                   LTRKHIRRLHIAATVIKHAWHKWRIRMACLASKELDGMEEKPMPQAPGTLRSSMSPAHT
FT                   RFLGAIIHLWPLGLVLANSADGVRGFQRKLVAHACLRLPSDRPSNKVQTPQQDQAGITS
FT                   IRALPQGSIKFHCRKSPLQYADICPDPSASCVTGFNQILLESHRPVQV"
FT   gene            complement(6575701..6581116)
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /note="gene_id=mCG11283.3"
FT   mRNA            complement(join(6575701..6576394,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581114))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT11722"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT11722.2 created
FT                   on 16-JUN-2003"
FT   mRNA            complement(join(6575701..6576284,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581105))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT185827"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT185827.0 created
FT                   on 16-JUN-2003"
FT   mRNA            complement(join(6575764..6576394,6577968..6578182,
FT                   6578957..6579031,6580845..6580876,6581002..6581116))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT180850"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT180850.1 created
FT                   on 16-JUN-2003"
FT   mRNA            complement(join(6575764..6576394,6577968..6578048,
FT                   6578957..6579129,6580845..6580876,6581002..6581116))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT180851"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT180851.1 created
FT                   on 16-JUN-2003"
FT   CDS             complement(join(6576085..6576284,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581087))
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_c"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT185827.0
FT                   protein_id=mCP107085.0 isoform=CRA_c"
FT                   /protein_id="EDL15752.1"
FT                   /translation="MASLNCRTAVCVVCLEKPKYRCPTCRVPYCSVPCFQKHKEQCSSE
FT                   ARPVEKRRAGPPVRSEESKDDDSSVADFLNSDEEEDRVSLQNLKNLGAPFRGVCRLLFR
FT                   NRGTIPEEGFLRLDVFSAQVTCCCSKRWLFSRPPYAACTRGSSSTTWLAAATS"
FT   CDS             complement(join(6576213..6576394,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581087))
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_a"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT11722.2
FT                   protein_id=mCP11634.2 isoform=CRA_a"
FT                   /protein_id="EDL15750.1"
FT                   /translation="MASLNCRTAVCVVCLEKPKYRCPTCRVPYCSVPCFQKHKEQCSSE
FT                   ARPVEKRRAGPPVRSEESKDDDSSVADFLNSDEEEDRVSLQNLKNLGESETLRSLLLNP
FT                   HLRQLMISLDQGDNKAKLMRACMQEPLFVEFADCCLGIVEPSQKRDS"
FT   CDS             complement(join(6576213..6576394,6577968..6578048,
FT                   6578957..6579077))
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_b"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT180851.1
FT                   protein_id=mCP103772.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5FW88"
FT                   /db_xref="MGI:MGI:3051596"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FW88"
FT                   /protein_id="EDL15751.1"
FT                   /translation="MEGCVWLCLKFVSLSEQCSSEARPVEKRRAGPPVRSEESKDDDSS
FT                   VADFLNSDEEEDRVSLQNLKNLGESETLRSLLLNPHLRQLMISLDQGDNKAKLMRACMQ
FT                   EPLFVEFADCCLGIVEPSQKRDS"
FT   CDS             complement(6576213..6576341)
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_d"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT180850.1
FT                   protein_id=mCP103773.1 isoform=CRA_d"
FT                   /protein_id="EDL15753.1"
FT                   /translation="MISLDQGDNKAKLMRACMQEPLFVEFADCCLGIVEPSQKRDS"
FT   mRNA            complement(join(6576262..6576640,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581116))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT185826"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT185826.0 created
FT                   on 16-JUN-2003"
FT   CDS             complement(join(6576597..6576640,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581087))
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_e"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT185826.0
FT                   protein_id=mCP107084.0 isoform=CRA_e"
FT                   /protein_id="EDL15754.1"
FT                   /translation="MASLNCRTAVCVVCLEKPKYRCPTCRVPYCSVPCFQKHKEQCSSE
FT                   ARPVEKRRAGPPVRSEESKDDDSSVADFLNSDEEEDRVSLQNLKNLGFLCVALAVLELT
FT                   L"
FT   gene            6622549..6630807
FT                   /gene="Car4"
FT                   /locus_tag="mCG_11273"
FT                   /note="gene_id=mCG11273.2"
FT   mRNA            join(6622549..6622705,6627149..6627202,6628101..6628256,
FT                   6628856..6629001,6629111..6629191,6629298..6629364,
FT                   6629476..6629639,6630374..6630807)
FT                   /gene="Car4"
FT                   /locus_tag="mCG_11273"
FT                   /product="carbonic anhydrase 4"
FT                   /note="gene_id=mCG11273.2 transcript_id=mCT11712.2 created
FT                   on 01-AUG-2002"
FT   CDS             join(6622651..6622705,6627149..6627202,6628101..6628256,
FT                   6628856..6629001,6629111..6629191,6629298..6629364,
FT                   6629476..6629639,6630374..6630568)
FT                   /codon_start=1
FT                   /gene="Car4"
FT                   /locus_tag="mCG_11273"
FT                   /product="carbonic anhydrase 4"
FT                   /note="gene_id=mCG11273.2 transcript_id=mCT11712.2
FT                   protein_id=mCP11665.1"
FT                   /protein_id="EDL15755.1"
FT                   /translation="MQLLLALLALAYVAPSTEDSGWCYEIQTKDPRSSCLGPEKWPGAC
FT                   KENQQSPINIVTARTKVNPRLTPFILVGYDQKQQWPIKNNQHTVEMTLGGGACIIGGDL
FT                   PARYEAVQLHLHWSNGNDNGSEHSIDGRHFAMEMHIVHKKLTSSKEDSKDKFAVLAFMI
FT                   EVGDKVNKGFQPLVEALPSISKPHSTSTVRESSLQDMLPPSTKMYTYFRYNGSLTTPNC
FT                   DETVIWTVYKQPIKIHKNQFLEFSKNLYYDEDQKLNMKDNVRPLQPLGKRQVFKSHAPG
FT                   QLLSLPLPTLLVPTLTCLVANFLQ"
FT   gene            complement(6650897..>6807969)
FT                   /locus_tag="mCG_11277"
FT                   /note="gene_id=mCG11277.1"
FT   mRNA            complement(join(6650897..6653048,6653734..6653826,
FT                   6654803..6655227,6658922..6659210,6660855..6661046,
FT                   6672277..6672397,6673462..6673548,6676428..6676612,
FT                   6684142..6684353,6686277..6686388,6688668..6688819,
FT                   6689243..6689417,6692031..6692204,6693288..6693393,
FT                   6693613..6693751,6695573..6695647,6696995..6697076,
FT                   6698581..6698735,6703131..6703248,6705810..6705950,
FT                   6707302..6707477,6709795..6709987,6712017..6712119,
FT                   6717694..6717755,6718498..6718581,6721241..6721356,
FT                   6726462..6726593,6744616..6744775,6771248..6771375,
FT                   6807912..>6807969))
FT                   /locus_tag="mCG_11277"
FT                   /product="mCG11277"
FT                   /note="gene_id=mCG11277.1 transcript_id=mCT11716.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(6652875..6653048,6653734..6653826,
FT                   6654803..6655227,6658922..6659210,6660855..6661046,
FT                   6672277..6672397,6673462..6673548,6676428..6676612,
FT                   6684142..6684353,6686277..6686388,6688668..6688819,
FT                   6689243..6689417,6692031..6692204,6693288..6693393,
FT                   6693613..6693751,6695573..6695647,6696995..6697076,
FT                   6698581..6698735,6703131..6703248,6705810..6705950,
FT                   6707302..6707477,6709795..6709987,6712017..6712119,
FT                   6717694..6717755,6718498..6718581,6721241..6721356,
FT                   6726462..6726593,6744616..6744775,6771248..6771375,
FT                   6807912..6807969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11277"
FT                   /product="mCG11277"
FT                   /note="gene_id=mCG11277.1 transcript_id=mCT11716.2
FT                   protein_id=mCP11640.2"
FT                   /protein_id="EDL15756.1"
FT                   /translation="MGAKESRIGFLSYEEALRRVTDVELKRLKDAFKRTCGLSYYMSQH
FT                   CFIREVLGDGVPPKVAEGEKVNYEKFRNWLLLNKDAFTFSRWLLSGGVYVTLTDDSDTP
FT                   TFYQTLAGVTHLEESDIIDLEKRYWLLKAQSRTGRFDLETFGPLVSPPIRPSLSEVCFK
FT                   VFDVDRDGVLSRVELKDMVVALLEVWKDNRTDDIPVGHLTLEDYQIWSVKNVLANEFLN
FT                   LLFQVCHIVLGLRPATPEEEGQIIRGWLERESRYGLQPGHNWFIISMQWWQQWKEYVKY
FT                   DASPVVIEPSSVLNGGKFSFGTAAHPIEHGEDRISNNLGYMNTTEEKYSDNISSASEAS
FT                   ESTGSGFLYSGTPGADMCFARQHNTSDNNNQCLLGANGNILLHLNPQKPGAIDNQPLVT
FT                   QEPVKATSLTLEGGRLKRTPQLIHGRDYEMVPEPVWRALYHWYGSNLALPRPVIKNSKT
FT                   DIPELELFPRYLLFLRQQPATRTQQSNIWVNMGNVPSPNAPLKRVLAYTGCFSRMQTIK
FT                   EIHEYLSQRLRIKEEDMRLWLYNSENYLTLLDDEDHRLEYLKIQDEQHLVIEVRNKDMS
FT                   WPEEMSFIANSSKIDRHKVPTEKGATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGRH
FT                   LYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKNVAPLKLRWTIAKYAPRFNGFQQQDS
FT                   QELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWEVAAEAWDNHLRRNRSIVVDLFHG
FT                   QLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMHLEITVIKLDGTTPIRYGLRLNMDE
FT                   KYTGLKKQLSDLCGLKSEQILFAEVHSSNIKNFPQDNQKVRLSVSGFLCAFEIPIPASP
FT                   VSACSPIQTDCSSSPSTNGLFTLTTNGDLPRPIFIPNGMPNTVVPCGTEKNVTNGIVNG
FT                   HMPPLPDDPFTGYIIAVHRKMMRTELYFLSSQKNRPSLFGMPLIVPCTVHTRKKDLYDA
FT                   VWIQVSRLASPLPPQEASNHAQDCDDSMGYQYPFTLRVVQKDGNSCAWCPWYRFCRGCK
FT                   IDCGEDRAFIGNACIAVDWDPTALHLRYQTSQERVVEEHESVEQSRRAQAEPINLDSCL
FT                   RAFTSEEELGENEMYYCSKCKTHCLATKKLDLWRLPPILIIHLKRFQFVNGRWIKSQKI
FT                   VKFPRESFDPSAFLVPRDPTLCQHKPLTPQGDDFSELRIPAGDVKKVDIQSSAGEEDVL
FT                   LSKSPSSLSANVTSSPKGSPSSSRKSGASCPSSKNSSPNSSPRTLGRNKGRLRLPQIGS
FT                   KNKLSNSKENLDTSKENGAGQICELADTLNRRHVLGGSQPELVTPLDHEITLANGFLYE
FT                   HEACGNGYSNGQLGNHSEEDSTDDQREETHSKPIYNLYAISCHSGILGGGHYVTYAKNP
FT                   NCKWYCYNDSSCKELHPDEIDTDSAYILFYEQQGIDCAQFLPKTDGKKMADTSSMDEDF
FT                   ESDYKKYCVLQ"
FT   gene            6739797..>6740049
FT                   /locus_tag="mCG_48967"
FT                   /note="gene_id=mCG48967.2"
FT   mRNA            6739797..>6740049
FT                   /locus_tag="mCG_48967"
FT                   /product="mCG48967"
FT                   /note="gene_id=mCG48967.2 transcript_id=mCT49150.2 created
FT                   on 08-APR-2003"
FT   CDS             6739824..>6740049
FT                   /codon_start=1
FT                   /locus_tag="mCG_48967"
FT                   /product="mCG48967"
FT                   /note="gene_id=mCG48967.2 transcript_id=mCT49150.2
FT                   protein_id=mCP33419.2"
FT                   /protein_id="EDL15757.1"
FT                   /translation="MGVDIRHNKDRKVQRKEPKSQDIYLRLLVKLYRFLARQTNSTFQS
FT                   GCAEEVVMSRTNRPPLSLSRMIQKMKLPCG"
FT   gene            6778442..6779179
FT                   /pseudo
FT                   /locus_tag="mCG_11281"
FT                   /note="gene_id=mCG11281.2"
FT   mRNA            6778442..6779179
FT                   /pseudo
FT                   /locus_tag="mCG_11281"
FT                   /note="gene_id=mCG11281.2 transcript_id=mCT11720.2 created
FT                   on 18-OCT-2002"
FT   gene            6838871..6849574
FT                   /locus_tag="mCG_11262"
FT                   /note="gene_id=mCG11262.2"
FT   mRNA            join(6838871..6838905,6841261..6841362,6841615..6841790,
FT                   6842444..6842543,6846686..6846881,6849315..6849573)
FT                   /locus_tag="mCG_11262"
FT                   /product="mCG11262, transcript variant mCT11199"
FT                   /note="gene_id=mCG11262.2 transcript_id=mCT11199.2 created
FT                   on 05-MAR-2003"
FT   mRNA            join(6838872..6838901,6841261..6841362,6842444..6842543,
FT                   6846686..6846881,6849315..6849574)
FT                   /locus_tag="mCG_11262"
FT                   /product="mCG11262, transcript variant mCT180849"
FT                   /note="gene_id=mCG11262.2 transcript_id=mCT180849.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(6842445..6842543,6846686..6846881,6849315..6849400)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11262"
FT                   /product="mCG11262, isoform CRA_a"
FT                   /note="gene_id=mCG11262.2 transcript_id=mCT11199.2
FT                   protein_id=mCP11638.2 isoform=CRA_a"
FT                   /protein_id="EDL15758.1"
FT                   /translation="MLWRFVSLFSELEAKQLRRLYKYTKTNQTAKFLAALCPLDAPERS
FT                   LLANQEDCLPRLCSAWGLHGNISGMKERLSKMQAPGQEVVMLEEPRSSHCSRGDSLRKL
FT                   PQKPKLKKKRIKERLESPKSCS"
FT   CDS             join(6842445..6842543,6846686..6846881,6849315..6849400)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11262"
FT                   /product="mCG11262, isoform CRA_a"
FT                   /note="gene_id=mCG11262.2 transcript_id=mCT180849.0
FT                   protein_id=mCP103771.0 isoform=CRA_a"
FT                   /protein_id="EDL15759.1"
FT                   /translation="MLWRFVSLFSELEAKQLRRLYKYTKTNQTAKFLAALCPLDAPERS
FT                   LLANQEDCLPRLCSAWGLHGNISGMKERLSKMQAPGQEVVMLEEPRSSHCSRGDSLRKL
FT                   PQKPKLKKKRIKERLESPKSCS"
FT   gene            complement(6860976..>6906502)
FT                   /gene="Appbp2"
FT                   /locus_tag="mCG_11263"
FT                   /note="gene_id=mCG11263.1"
FT   mRNA            complement(join(6860976..6861711,6864387..6864552,
FT                   6865869..6866059,6868323..6868408,6870551..6870675,
FT                   6871673..6871778,6871860..6871927,6874494..6874583,
FT                   6880199..6880367,6885594..6885717,6886468..6886619,
FT                   6887794..6887882,6906035..>6906502))
FT                   /gene="Appbp2"
FT                   /locus_tag="mCG_11263"
FT                   /product="amyloid beta precursor protein (cytoplasmic tail)
FT                   binding protein 2"
FT                   /note="gene_id=mCG11263.1 transcript_id=mCT11200.1 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(6861458..6861711,6864387..6864552,
FT                   6865869..6866059,6868323..6868408,6870551..6870675,
FT                   6871673..6871778,6871860..6871927,6874494..6874583,
FT                   6880199..6880367,6885594..6885717,6886468..6886619,
FT                   6887794..6887882,6906035..6906502))
FT                   /codon_start=1
FT                   /gene="Appbp2"
FT                   /locus_tag="mCG_11263"
FT                   /product="amyloid beta precursor protein (cytoplasmic tail)
FT                   binding protein 2"
FT                   /note="gene_id=mCG11263.1 transcript_id=mCT11200.1
FT                   protein_id=mCP11642.1"
FT                   /protein_id="EDL15760.1"
FT                   /translation="MTHTRSPAHAELRAWTELGSLSCWECEALGTVVVCVRPDLPWPPL
FT                   PPLPPAPSALRPRAHAEARQPGPRGARTPARPRGRRPSEASGASHGFATEGGGGLREEA
FT                   EEERGKMAAVELEWIPETLYNTAISAVVDNYIRSRRDIRSLPENIQFDVYYKLYQQGRL
FT                   CQLGSEFCELEVFAKVLRALDKRHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESD
FT                   AAVKEKAIQVGFVLGGFLSDAGWYSDAEKVFLSCLQLCTLHDEMLHWFRAVECCVRLLH
FT                   VRNGNCKYHLGEETFKLAQTYMDKLSKHGQQANRAALYGELCALLFAKSHYDEAYKWCV
FT                   EAMKEITAGLPVKVVVDVLRQASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSD
FT                   TLLDYGFYLLNVDNICQSVAIYQAALDIRQSVFGGKNIHVATAHEDLAYSSYVHQYSSG
FT                   KFDNALFHAERAIGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQEAH
FT                   DLHLSSLQLAKKAFGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQE
FT                   DYEVALSVGHLASLYNYDMNQYENAEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYN
FT                   SIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDVSSSPQSTEEVVQSFLMAQNVEGPS
FT                   C"
FT   gene            6887981..6889921
FT                   /pseudo
FT                   /locus_tag="mCG_1031952"
FT                   /note="gene_id=mCG1031952.1"
FT   mRNA            6887981..6889921
FT                   /pseudo
FT                   /locus_tag="mCG_1031952"
FT                   /note="gene_id=mCG1031952.1 transcript_id=mCT149656.1
FT                   created on 11-NOV-2002"
FT   gene            6906552..6909666
FT                   /locus_tag="mCG_1032075"
FT                   /note="gene_id=mCG1032075.1"
FT   mRNA            join(6906552..6906695,6908504..6908611,6908775..6908878,
FT                   6909408..6909666)
FT                   /locus_tag="mCG_1032075"
FT                   /product="mCG1032075"
FT                   /note="gene_id=mCG1032075.1 transcript_id=mCT149779.1
FT                   created on 24-MAR-2003"
FT   CDS             join(6908601..6908611,6908775..6908878,6909408..6909460)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032075"
FT                   /product="mCG1032075"
FT                   /note="gene_id=mCG1032075.1 transcript_id=mCT149779.1
FT                   protein_id=mCP85429.1"
FT                   /protein_id="EDL15761.1"
FT                   /translation="MQILPLDSFMALKQKMLLKHARCPWEPWSRGHSLGHRRGEGDMLE
FT                   RAAQACHPSY"
FT   gene            complement(6977773..6979723)
FT                   /locus_tag="mCG_147534"
FT                   /note="gene_id=mCG147534.0"
FT   mRNA            complement(6977773..6979723)
FT                   /locus_tag="mCG_147534"
FT                   /product="mCG147534"
FT                   /note="gene_id=mCG147534.0 transcript_id=mCT187797.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(6978840..6979316)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147534"
FT                   /product="mCG147534"
FT                   /note="gene_id=mCG147534.0 transcript_id=mCT187797.0
FT                   protein_id=mCP109300.0"
FT                   /protein_id="EDL15762.1"
FT                   /translation="MARRRREWGSPATRAPAAVPAPACPPQPARAPPRSELRPPCTSSR
FT                   PGPRRRSLPASTAPPWPAARDPAVPTQPAEFRGGRHTRRSPANYCLSSTKPRVKRRRSP
FT                   RRWGGARDVGTCPRELGRSSRGREEPSSCACALNSLPARPRPPYKSDVLSPPFS"
FT   gene            6978951..7012558
FT                   /gene="Ppm1d"
FT                   /locus_tag="mCG_140757"
FT                   /note="gene_id=mCG140757.0"
FT   mRNA            join(6978951..6978972,6979054..6979590,6997835..6998017,
FT                   7002661..7002858,7003342..7003532,7005822..7006064,
FT                   7011890..7012558)
FT                   /gene="Ppm1d"
FT                   /locus_tag="mCG_140757"
FT                   /product="protein phosphatase 1D magnesium-dependent, delta
FT                   isoform"
FT                   /note="gene_id=mCG140757.0 transcript_id=mCT171282.0
FT                   created on 01-AUG-2002"
FT   CDS             join(7002789..7002858,7003342..7003532,7005822..7006064,
FT                   7011890..7012447)
FT                   /codon_start=1
FT                   /gene="Ppm1d"
FT                   /locus_tag="mCG_140757"
FT                   /product="protein phosphatase 1D magnesium-dependent, delta
FT                   isoform"
FT                   /note="gene_id=mCG140757.0 transcript_id=mCT171282.0
FT                   protein_id=mCP94201.0"
FT                   /protein_id="EDL15763.1"
FT                   /translation="MVPPQDAISMCQDQEEKKYLMVRSDLWSYDFFSGKFVVSPEPDTS
FT                   VHTLDPRKHKYIILGSDGLWNMVPPQDAISMCQDQEEKKYLMGEQGQSCAKMLVNRALG
FT                   RWRQRMLRADNTSAIVICISPEVDNQGNFTNEDELFLNLTDSPTYNSQETCVMTSSPSS
FT                   TPPIKSPEEDAWPRLSSKDHIPALVRSNAFSEKFLEVPAEIARGNIQTVVMTSKDSETL
FT                   EENCPKALTLRIHDSLNNTLSVGLIPTNSTNTIMDQKNLKMSTPGQMKAQEVERTPPAN
FT                   FKRTLEESNSGPLMKKHRRNGLSRSSGAQASSLPTASQRRHSVKLTLRRRLRGQRKMGN
FT                   PLLHQHRKTVCVC"
FT   gene            7021377..7496928
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /note="gene_id=mCG117205.1"
FT   mRNA            join(7021377..7021446,7034265..7034340,7039764..7039870,
FT                   7063488..7063569,7083842..7083914,7120124..7120231,
FT                   7126332..7126408,7134629..7134705,7139223..7139306,
FT                   7145118..7145288,7151123..7151216,7164308..7164441,
FT                   7178228..7178492,7200590..7200740,7222937..7223061,
FT                   7226066..7226231,7227814..7227914,7245541..7245641,
FT                   7249780..7249976,7252639..7252736,7271597..7271897)
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, transcript
FT                   variant mCT171266"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT171266.0
FT                   created on 24-MAR-2003"
FT   mRNA            join(7021377..7021437,7028172..7028226,7034265..7034340,
FT                   7039764..7039870,7063488..7063569,7083842..7083914,
FT                   7120124..7120231,7126332..7126408,7134629..7134705,
FT                   7139223..7139306,7145118..7145288,7151123..7151216,
FT                   7164308..7164441,7178228..7178492,7200590..7200740,
FT                   7222937..7223061,7226066..7226231,7227814..7227914,
FT                   7245541..7245641,7249780..7249976,7252639..7252736,
FT                   7271597..7271897)
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, transcript
FT                   variant mCT118341"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT118341.1
FT                   created on 24-MAR-2003"
FT   mRNA            join(7022799..7022886,7034265..7034340,7039764..7039870,
FT                   7063488..7063569,7083842..7083914,7120124..7120231,
FT                   7126332..7126408,7134629..7134705,7139223..7139306,
FT                   7145118..7145288,7151123..7151216,7164308..7164441,
FT                   7178228..7178492,7200590..7200740,7212677..7212721,
FT                   7222937..7223061,7226066..7226231,7227814..7227914,
FT                   7245541..7245641,7249780..7249976,7252639..7252736,
FT                   7472245..7472412,7496073..7496922)
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, transcript
FT                   variant mCT181501"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT181501.0
FT                   created on 24-MAR-2003"
FT   CDS             join(7028185..7028226,7034265..7034340,7039764..7039870,
FT                   7063488..7063569,7083842..7083914,7120124..7120231,
FT                   7126332..7126408,7134629..7134705,7139223..7139306,
FT                   7145118..7145288,7151123..7151216,7164308..7164441,
FT                   7178228..7178492,7200590..7200740,7222937..7223061,
FT                   7226066..7226231,7227814..7227914,7245541..7245641,
FT                   7249780..7249976,7252639..7252736,7271597..7271601)
FT                   /codon_start=1
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT118341.1
FT                   protein_id=mCP85147.1 isoform=CRA_a"
FT                   /protein_id="EDL15764.1"
FT                   /translation="MESVVTFLQDVVPQAYSGSPLTEEKEKIVWVRFENADLNDTSRNL
FT                   EFHELHSTGNEPPLLVMIGYSDGMQVWGIPISGEAQELFSVRHGPVRAARILPAPQLGA
FT                   QKCDNFAEKRPLLGVCKSIGSSGTTPPYCCVDLYSLRTGEMVKSIQFKTPIYDLHCNKR
FT                   ILVVVLQEKIAAFDSCTFTKKFFVTSCYPCPGPNMNPIALGSRWLAYAENKLIRCHQSR
FT                   GGACGDNIQSYTATVLSAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVALHCNSRRSP
FT                   LVPGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTL
FT                   GHDFHVFQILTHPWSSSQCAVHHLYTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHV
FT                   FPINPYGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPS
FT                   GSPLHGKLTSQDSYNNFTNNNPGNPRLSPLPSLMVVTPLAQIKQPMTLGTITKRTGKVK
FT                   SPPQISPSKSMGGEFCVAAVFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCYGTLV
FT                   EHMIEPRPISTAPKISDDTPLEIMTSPRASWTLVRTPQWNELQPPFNANHPLLLAAEAV
FT                   QYYQLLLAGSLPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMG
FT                   PQFHFKTIQTSGQTTVISTSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPV
FT                   SMPGSSRAVSDRRGVSTVTDAASV"
FT   CDS             join(7039829..7039870,7063488..7063569,7083842..7083914,
FT                   7120124..7120231,7126332..7126408,7134629..7134705,
FT                   7139223..7139306,7145118..7145288,7151123..7151216,
FT                   7164308..7164441,7178228..7178492,7200590..7200740,
FT                   7212677..7212721,7222937..7223061,7226066..7226231,
FT                   7227814..7227914,7245541..7245641,7249780..7249976,
FT                   7252639..7252736,7472245..7472412,7496073..7496221)
FT                   /codon_start=1
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT181501.0
FT                   protein_id=mCP104423.0 isoform=CRA_g"
FT                   /protein_id="EDL15770.1"
FT                   /translation="MIGYSDGMQVWGIPISGEAQELFSVRHGPVRAARILPAPQLGAQK
FT                   CDNFAEKRPLLGVCKSIGSSGTTPPYCCVDLYSLRTGEMVKSIQFKTPIYDLHCNKRIL
FT                   VVVLQEKIAAFDSCTFTKKFFVTSCYPCPGPNMNPIALGSRWLAYAENKLIRCHQSRGG
FT                   ACGDNIQSYTATVLSAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVALHCNSRRSPLV
FT                   PGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGH
FT                   DFHVFQILTHPWSSSQCAVHHLYTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFP
FT                   INPYGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGS
FT                   PLHGKLTSQDSYNNFTNNNPGNPRLSPLPSLMVVTPLAQIKQPMTLGTITKRTGPYLFG
FT                   AGCFSIKAPCKVKSPPQISPSKSMGGEFCVAAVFGTSRSWFANNAGLKREKDQSKQVVV
FT                   ESLYIISCYGTLVEHMIEPRPISTAPKISDDTPLEIMTSPRASWTLVRTPQWNELQPPF
FT                   NANHPLLLAAEAVQYYQLLLAGSLPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEI
FT                   VTHTGPHRRLWMGPQFHFKTIQTSGQTTVISTSSSVLQSHGPSDTPQPLLDFDTDDLDL
FT                   NSLRIQPVRSDPVSMPGSSRAVSDRRGVSTVTDAASGTFDRSVTLLEVCGSWPEGFGLR
FT                   HMSSMEHSEEGLRERLADAMAESPSRDVVGSGTELQREGSIETLSNSSGSTSGSIPRNF
FT                   DGYRSPLPTNESQPLSLFPTGFP"
FT   CDS             join(7039829..7039870,7063488..7063569,7083842..7083914,
FT                   7120124..7120231,7126332..7126408,7134629..7134705,
FT                   7139223..7139306,7145118..7145288,7151123..7151216,
FT                   7164308..7164441,7178228..7178492,7200590..7200740,
FT                   7222937..7223061,7226066..7226231,7227814..7227914,
FT                   7245541..7245641,7249780..7249976,7252639..7252736,
FT                   7271597..7271601)
FT                   /codon_start=1
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, isoform
FT                   CRA_h"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT171266.0
FT                   protein_id=mCP94185.0 isoform=CRA_h"
FT                   /protein_id="EDL15771.1"
FT                   /translation="MIGYSDGMQVWGIPISGEAQELFSVRHGPVRAARILPAPQLGAQK
FT                   CDNFAEKRPLLGVCKSIGSSGTTPPYCCVDLYSLRTGEMVKSIQFKTPIYDLHCNKRIL
FT                   VVVLQEKIAAFDSCTFTKKFFVTSCYPCPGPNMNPIALGSRWLAYAENKLIRCHQSRGG
FT                   ACGDNIQSYTATVLSAAKTLKSGLTMVGKVVTQLTGTLPSGVTEDDVALHCNSRRSPLV
FT                   PGIITVIDTETVGEGQVLVSEDSDSDGIVAHFPAHEKPVCCMAFNTSGMLLVTTDTLGH
FT                   DFHVFQILTHPWSSSQCAVHHLYTLHRGETEAKVQDICFSHDCRWVVVSTLRGTSHVFP
FT                   INPYGGQPCVRTHMSPRVVNRMSRFQKSAGLEEIEQELTSKQGGRCSPVPGLSSSPSGS
FT                   PLHGKLTSQDSYNNFTNNNPGNPRLSPLPSLMVVTPLAQIKQPMTLGTITKRTGKVKSP
FT                   PQISPSKSMGGEFCVAAVFGTSRSWFANNAGLKREKDQSKQVVVESLYIISCYGTLVEH
FT                   MIEPRPISTAPKISDDTPLEIMTSPRASWTLVRTPQWNELQPPFNANHPLLLAAEAVQY
FT                   YQLLLAGSLPPGSPGPITRHGSYDSLASDHSGQEDEEWLSQVEIVTHTGPHRRLWMGPQ
FT                   FHFKTIQTSGQTTVISTSSSVLQSHGPSDTPQPLLDFDTDDLDLNSLRIQPVRSDPVSM
FT                   PGSSRAVSDRRGVSTVTDAASV"
FT   mRNA            join(7249779..7249976,7252639..7252736,7472245..7472412,
FT                   7484829..7484894,7492893..7492983,7496073..7496928)
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, transcript
FT                   variant mCT13395"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT13395.2 created
FT                   on 24-MAR-2003"
FT   CDS             join(7249822..7249976,7252639..7252736,7472245..7472412,
FT                   7484829..7484894,7492893..7492983,7496073..7496109)
FT                   /codon_start=1
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT13395.2
FT                   protein_id=mCP5873.2 isoform=CRA_b"
FT                   /protein_id="EDL15765.1"
FT                   /translation="MGPQFHFKTIQTSGQTTVISTSSSVLQSHGPSDTPQPLLDFDTDD
FT                   LDLNSLRIQPVRSDPVSMPGSSRAVSDRRGVSTVTDAASGTFDRSVTLLEVCGSWPEGF
FT                   GLRHMSSMEHSEEGLRERLADAMAESPSRDVVGSGTDTALDVAVKNSTPERPMAVKCLG
FT                   KKKGKKKQCQQPSVREQPNSNKACVRDGGRTSARGKHRDSE"
FT   mRNA            join(7249952..7249976,7252639..7252736,7472245..7472412,
FT                   7492893..7492983,7496073..7496261)
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, transcript
FT                   variant mCT180855"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT180855.0
FT                   created on 24-MAR-2003"
FT   CDS             join(7252670..7252736,7472245..7472412,7492893..7492983,
FT                   7496073..7496109)
FT                   /codon_start=1
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT180855.0
FT                   protein_id=mCP103779.0 isoform=CRA_d"
FT                   /protein_id="EDL15767.1"
FT                   /translation="MPGSSRAVSDRRGVSTVTDAASGTFDRSVTLLEVCGSWPEGFGLR
FT                   HMSSMEHSEEGLRERLADAMAESPSRDVVGSGTGKKKGKKKQCQQPSVREQPNSNKACV
FT                   RDGGRTSARGKHRDSE"
FT   mRNA            join(7309521..7309594,7472245..7472412,7484829..7484894,
FT                   7492893..7492983,7496073..7496378)
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, transcript
FT                   variant mCT180856"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT180856.0
FT                   created on 24-MAR-2003"
FT   gene            complement(7372667..>7390180)
FT                   /locus_tag="mCG_145252"
FT                   /note="gene_id=mCG145252.0"
FT   mRNA            complement(join(7372667..7372969,7374892..7375026,
FT                   7375166..7375252,7376629..7376714,7377170..7379648,
FT                   7390131..>7390180))
FT                   /locus_tag="mCG_145252"
FT                   /product="mCG145252"
FT                   /note="gene_id=mCG145252.0 transcript_id=mCT184676.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(7378040..>7378351)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145252"
FT                   /product="mCG145252"
FT                   /note="gene_id=mCG145252.0 transcript_id=mCT184676.0
FT                   protein_id=mCP105668.0"
FT                   /protein_id="EDL15772.1"
FT                   /translation="DLSLAHPGMLKFLEQKFLSSLGSRRRGQENTLTSSEVTSKTPAWR
FT                   QISFSGHTSCRAQAQTSQGRTVAIWTGYLTPSPHPNFRFFYLSRSSLGLGPQQICNRP"
FT   mRNA            join(7410394..7410453,7472245..7472412,7484829..7484894,
FT                   7492893..>7492963)
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, transcript
FT                   variant mCT180857"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT180857.0
FT                   created on 24-MAR-2003"
FT   gene            complement(<7437269..>7446149)
FT                   /locus_tag="mCG_146191"
FT                   /note="gene_id=mCG146191.0"
FT   mRNA            complement(join(<7437269..7437509,7437999..7438269,
FT                   7446003..>7446149))
FT                   /locus_tag="mCG_146191"
FT                   /product="mCG146191"
FT                   /note="gene_id=mCG146191.0 transcript_id=mCT186294.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(<7437269..>7437495)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146191"
FT                   /product="mCG146191"
FT                   /note="gene_id=mCG146191.0 transcript_id=mCT186294.0
FT                   protein_id=mCP107521.0"
FT                   /protein_id="EDL15773.1"
FT                   /translation="QLNQINCDTFKSIKIATSLPKKKAGALFSRKDTKSSPGDQETNIH
FT                   SMPVHPPAPPPFSSMLPSPPGKKKGLKISAP"
FT   gene            complement(7462120..>7503082)
FT                   /locus_tag="mCG_146188"
FT                   /note="gene_id=mCG146188.0"
FT   mRNA            complement(join(7462120..7463696,7466614..7466744,
FT                   7472249..7472473,7476220..7476391,7503039..>7503082))
FT                   /locus_tag="mCG_146188"
FT                   /product="mCG146188"
FT                   /note="gene_id=mCG146188.0 transcript_id=mCT186291.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(7466652..7466744,7472249..7472473,
FT                   7476220..>7476222))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146188"
FT                   /product="mCG146188"
FT                   /note="gene_id=mCG146188.0 transcript_id=mCT186291.0
FT                   protein_id=mCP107519.0"
FT                   /protein_id="EDL15774.1"
FT                   /translation="QLNANRLQSQPSQATSLLTPLPVPDPTTSRLGDSAMASASRSRRP
FT                   SSECSMEDICRSPKPSGQLPHTSSRVTLRSKAGSQRNSIHPPHNVEDGVPRVNGIGQPI
FT                   IK"
FT   mRNA            join(7472245..7472412,7484829..7484894,7492647..>7492894)
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, transcript
FT                   variant mCT180854"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT180854.0
FT                   created on 24-MAR-2003"
FT   CDS             join(7472316..7472412,7484829..7484894,7492893..7492983,
FT                   7496073..7496109)
FT                   /codon_start=1
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT180856.0
FT                   protein_id=mCP103777.0 isoform=CRA_e"
FT                   /protein_id="EDL15768.1"
FT                   /translation="MSSMEHSEEGLRERLADAMAESPSRDVVGSGTDTALDVAVKNSTP
FT                   ERPMAVKCLGKKKGKKKQCQQPSVREQPNSNKACVRDGGRTSARGKHRDSE"
FT   CDS             join(7472316..7472412,7484829..7484894,7492893..>7492963)
FT                   /codon_start=1
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT180857.0
FT                   protein_id=mCP103778.0 isoform=CRA_f"
FT                   /protein_id="EDL15769.1"
FT                   /translation="MSSMEHSEEGLRERLADAMAESPSRDVVGSGTDTALDVAVKNSTP
FT                   ERPMAVKCLGKKKGKKKQCQQPSVREQPNSNKA"
FT   CDS             join(7472316..7472412,7484829..7484894,7492647..>7492894)
FT                   /codon_start=1
FT                   /gene="Bcas3"
FT                   /locus_tag="mCG_117205"
FT                   /product="breast carcinoma amplified sequence 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG117205.1 transcript_id=mCT180854.0
FT                   protein_id=mCP103776.0 isoform=CRA_c"
FT                   /protein_id="EDL15766.1"
FT                   /translation="MSSMEHSEEGLRERLADAMAESPSRDVVGSGTDTALDVAVKNSTP
FT                   ERPMAVKCLDSQHFCLWARPSMTSQPPAASRACQCPGQQSVPARPPFARVSPLHLPPPP
FT                   PPACGDPCTSGALSRSLKENTEKDSSMLFFPKG"
FT   gene            7503949..7511999
FT                   /gene="Tbx2"
FT                   /locus_tag="mCG_12695"
FT                   /note="gene_id=mCG12695.2"
FT   mRNA            join(7503949..7504372,7505491..7505758,7506661..7506807,
FT                   7507919..7507995,7508102..7508255,7508710..7508989,
FT                   7511845..7511999)
FT                   /gene="Tbx2"
FT                   /locus_tag="mCG_12695"
FT                   /product="T-box 2, transcript variant mCT171267"
FT                   /note="gene_id=mCG12695.2 transcript_id=mCT171267.0 created
FT                   on 02-AUG-2002"
FT   mRNA            join(7503949..7504372,7505491..7505758,7506661..7506807,
FT                   7507919..7507995,7508092..7508255,7508710..7509347,
FT                   7511434..7511996)
FT                   /gene="Tbx2"
FT                   /locus_tag="mCG_12695"
FT                   /product="T-box 2, transcript variant mCT13393"
FT                   /note="gene_id=mCG12695.2 transcript_id=mCT13393.1 created
FT                   on 02-AUG-2002"
FT   CDS             join(7503978..7504372,7505491..7505758,7506661..7506807,
FT                   7507919..7507995,7508092..7508255,7508710..7509347,
FT                   7511434..7511880)
FT                   /codon_start=1
FT                   /gene="Tbx2"
FT                   /locus_tag="mCG_12695"
FT                   /product="T-box 2, isoform CRA_a"
FT                   /note="gene_id=mCG12695.2 transcript_id=mCT13393.1
FT                   protein_id=mCP5857.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q60707"
FT                   /db_xref="InterPro:IPR001699"
FT                   /db_xref="InterPro:IPR002070"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR018186"
FT                   /db_xref="InterPro:IPR022582"
FT                   /db_xref="MGI:MGI:98494"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60707"
FT                   /protein_id="EDL15775.1"
FT                   /translation="MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPP
FT                   GALGKPLPDPGLAGAAAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDD
FT                   PKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDC
FT                   RYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFT
FT                   ILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPF
FT                   AKGFRDTGNGRREKRKQLTLPTLRLYEEHCKPERDGAESDASSCDPPPAREPPPSPSAA
FT                   PSPLRLHRARAEEKPGAADSDPEPERTGEERSAAPLGRSPSRDASPARLTEPERSRERR
FT                   SPERCSKEPTEGGGDGPFSLRSLEKERPEARRKDEGRKDVGEGKEPSLAPLVVQTDSAS
FT                   PLGAGHLPGLAFSSHLHGQQFFGPLGAGQPLFLHPGQFAMGPGAFSAMGMGHLLASVAG
FT                   GSGSSGGAGPGTAAGLDAGGLGPAASAASTAAPFPFHLSQHMLASQGIPMPTFGGLFPY
FT                   PYTYMAAAAAAASALPATSAAAAAAAAAGSLSRSPFLGSARPRLRFSPYQIPVTIPPST
FT                   SLLTTGLAAEGSKGGNSREPSPLPELALRKVGGPSRGALSPSGSAKEAASELQSIQRLV
FT                   SGLESQRALSPGRESPK"
FT   CDS             join(7503978..7504372,7505491..7505758,7506661..7506807,
FT                   7507919..7507995,7508102..7508255,7508710..7508826)
FT                   /codon_start=1
FT                   /gene="Tbx2"
FT                   /locus_tag="mCG_12695"
FT                   /product="T-box 2, isoform CRA_b"
FT                   /note="gene_id=mCG12695.2 transcript_id=mCT171267.0
FT                   protein_id=mCP94186.0 isoform=CRA_b"
FT                   /protein_id="EDL15776.1"
FT                   /translation="MREPALAASAMAYHPFHAPRPADFPMSAFLAAAQPSFFPALALPP
FT                   GALGKPLPDPGLAGAAAAAAAAAAAAEAGLHVSALGPHPPAAHLRSLKSLEPEDEVEDD
FT                   PKVTLEAKELWDQFHKLGTEMVITKSGRRMFPPFKVRVSGLDKKAKYILLMDIVAADDC
FT                   RYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMAKPVAFHKLKLTNNISDKHGFT
FT                   ILNSMHKYQPRFHIVRANDILKLPYSTFRTYVFPETDFIAVTAYQNDKITQLKIDNNPF
FT                   AKGFRDTGNGRREKRRCPLSVCMRSTVSRSVMALNPMPRPATLRLRENHRPPPAQRPAL
FT                   CAYTGPEPRRSRAQPTAILSRSGRGRSAPQRPWAAALRGTPAPLA"
FT   gene            7558292..7587989
FT                   /gene="Tbx4"
FT                   /locus_tag="mCG_12705"
FT                   /note="gene_id=mCG12705.2"
FT   mRNA            join(7558292..7558434,7561932..7562135,7562729..7562823,
FT                   7570382..7570501,7571640..7571787,7582997..7583149,
FT                   7583826..7583914,7583996..7584231,7586019..7587989)
FT                   /gene="Tbx4"
FT                   /locus_tag="mCG_12705"
FT                   /product="T-box 4"
FT                   /note="gene_id=mCG12705.2 transcript_id=mCT13402.2 created
FT                   on 18-OCT-2002"
FT   CDS             join(7561935..7562135,7562729..7562823,7570382..7570501,
FT                   7571640..7571787,7582997..7583149,7583826..7583914,
FT                   7583996..7584231,7586019..7586635)
FT                   /codon_start=1
FT                   /gene="Tbx4"
FT                   /locus_tag="mCG_12705"
FT                   /product="T-box 4"
FT                   /note="gene_id=mCG12705.2 transcript_id=mCT13402.2
FT                   protein_id=mCP5926.2"
FT                   /db_xref="GOA:P70325"
FT                   /db_xref="InterPro:IPR001699"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR018186"
FT                   /db_xref="MGI:MGI:102556"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70325"
FT                   /protein_id="EDL15777.1"
FT                   /translation="MLQDKGLSESEEAFRAPGPALGEASNTSTTNAPEPALATPGLSGA
FT                   ALSSPPGQGADVAAAAAAAAEQTIENIKVGLHEKELWKKFHEAGTEMIITKAGRRMFPS
FT                   YKVKVTGMNPKTKYILLIDIVPADDHRYKFCDNKWMVAGKAEPAMPGRLYVHPDSPATG
FT                   AHWMRQLVSFQKLKLTNNHLDPFGHIILNSMHKYQPRLHIVKADENNAFGSKNTAFCTH
FT                   VFPETSFISVTSYQNHKITQLKIENNPFAKGFRGSDDSDLRVARLQSKEYPVISKSIMR
FT                   QRLVSSQLSAKPDVSPLHSAHQALQHYQYENGAHMQFAAAEPQDLPLNTFPTQRDSSLF
FT                   YHCLKRRDSARHLDLPCKRSYLETPSSVGDDHYFRSPPPYDQQMLSPSYCSEVTPREAC
FT                   MYSSSGPEIAGVSAVDDLPPPPLSCNMWTSVSPYTSYSVQTMETVPYQPFPAHFTATTV
FT                   MPRLPTIAAQSAQPPGNAHFSVYNQLSQSQVRERGPSASFPRERGLPGMCERKPPSPHL
FT                   NTANEFLYSQSFSLTRESSLQYHSGMGTVENWTDG"
FT   gene            7622371..7622885
FT                   /locus_tag="mCG_50378"
FT                   /note="gene_id=mCG50378.1"
FT   mRNA            7622371..7622885
FT                   /locus_tag="mCG_50378"
FT                   /product="mCG50378"
FT                   /note="gene_id=mCG50378.1 transcript_id=mCT50561.1 created
FT                   on 11-NOV-2002"
FT   CDS             7622383..7622706
FT                   /codon_start=1
FT                   /locus_tag="mCG_50378"
FT                   /product="mCG50378"
FT                   /note="gene_id=mCG50378.1 transcript_id=mCT50561.1
FT                   protein_id=mCP28490.0"
FT                   /protein_id="EDL15778.1"
FT                   /translation="MTNTKGKRKGTRYMFSRPFRKHRVLPLATYIQIYKKGDIVDIEGM
FT                   GTVQKGMPHKCYRGKTGRVYNVTQHAVGIVNKQIRARFRPRGSMSRLSTSSTQRAGRAS
FT                   GSG"
FT   gene            complement(7732510..7866060)
FT                   /gene="Brip1"
FT                   /locus_tag="mCG_117201"
FT                   /note="gene_id=mCG117201.0"
FT   mRNA            complement(join(7732510..7733953,7736686..7737009,
FT                   7746199..7746281,7749777..7749889,7780685..7780785,
FT                   7782261..7782420,7807177..7807338,7810681..7810821,
FT                   7810932..7811124,7815180..7815334,7817985..7818117,
FT                   7820281..7820480,7824523..7824744,7829526..7829816,
FT                   7851811..7851939,7854578..7854705,7857661..7857834,
FT                   7862715..7862826,7863718..7863840,7865953..7866060))
FT                   /gene="Brip1"
FT                   /locus_tag="mCG_117201"
FT                   /product="BRCA1 interacting protein C-terminal helicase 1,
FT                   transcript variant mCT118337"
FT                   /note="gene_id=mCG117201.0 transcript_id=mCT118337.1
FT                   created on 28-OCT-2002"
FT   mRNA            complement(join(7733112..7733953,7736686..7737009,
FT                   7746199..7746281,7749777..7749889,7780685..7780806,
FT                   7782261..7782420,7807177..7807338,7810681..7810821,
FT                   7810932..7811097,7815180..7815334,7817985..7818117,
FT                   7820281..7820480,7824523..7824744,7829526..7829816,
FT                   7851811..7851939,7854578..7854705,7857661..7857834,
FT                   7862715..7862826,7863718..7863840,7865953..>7866010))
FT                   /gene="Brip1"
FT                   /locus_tag="mCG_117201"
FT                   /product="BRCA1 interacting protein C-terminal helicase 1,
FT                   transcript variant mCT191006"
FT                   /note="gene_id=mCG117201.0 transcript_id=mCT191006.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(7733337..7733953,7736686..7737009,
FT                   7746199..7746281,7749777..7749889,7780685..7780806,
FT                   7782261..7782420,7807177..7807338,7810681..7810821,
FT                   7810932..7811097,7815180..7815334,7817985..7818117,
FT                   7820281..7820480,7824523..7824744,7829526..7829816,
FT                   7851811..7851939,7854578..7854705,7857661..7857834,
FT                   7862715..7862826,7863718..>7863828))
FT                   /codon_start=1
FT                   /gene="Brip1"
FT                   /locus_tag="mCG_117201"
FT                   /product="BRCA1 interacting protein C-terminal helicase 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG117201.0 transcript_id=mCT191006.0
FT                   protein_id=mCP111960.0 isoform=CRA_b"
FT                   /protein_id="EDL15780.1"
FT                   /translation="SREEGRMSSVLSDYTIGGVKIHFPCRAYPAQLAMMNSIVRGLNSS
FT                   QHCLLESPTGSGKSLALLCSALAWQQSLSEKPVDEGLNKKPEAPPSCSCACHSKNFTYS
FT                   DTNLDTSPHFNSPSKPSSGRNGVSTPCQDSPEKNTLAAKLSAKKQASIHRDEDDDFQVE
FT                   KKRIRPLETTQQIRKRHCLEKDVHHVDARLASEKRVKPESPIGKSFSDRKDSFQNVDGL
FT                   CSRCCCSAKQGNNQEPANTVKKDHGGQCKRPKIYFGTRTHKQIAQITRELRKTAYSGVP
FT                   MTILSSRDHSCVHPEVVGNFNRKEKCMELLDGKHGKSCYFYHGVHKISNQQTLQHLQGM
FT                   SRAWDIEELVSLGRKLKACPYYTARELIEDADIVFCPYNYLLDSQIRETMDIKLKGQVV
FT                   ILDEAHNIEDCARESASYSVTEVQLRFARDELDSLINGNIRKKSHEPLRDVCYNLINWL
FT                   ETNSKHLVERGYESSCKIWSGNEMLLNLYRMGITTATFPVLQRHLSAVLQKEEKVTPIH
FT                   GKEEAIQIPIISASTQVVLKGLFMVLDYLFRENSRFADDYKVAIQQTYSWTNQIAIFDK
FT                   TGVLAVPKNKKHSRQKIGVNALNFWCLNPAVAFSDINDKVRTIVLTSGTLSPLKSFSSE
FT                   LGVTFSIQLEANHVISNSQVWVGTVGSGPKGRNLCATFQHTETFEFQDEVGMLLLSVCQ
FT                   TVSQGILCFLPSYKLLEKLRERWIFTGLWHSLESVKTVIAEPQGGEKTDFDELLQVYYD
FT                   AIKFKGEKDGALLIAVCRGKVSEGLDFSDDNARAVITVGIPFPNVKDLQVELKRQYNDH
FT                   HSKSRGLLPGRQWYEIQAYRALNQALGRCIRHKNDWGALILVDDRFNNNPNRYISGLSK
FT                   WVRQQIQHHSSFASALESLTEFSRRHQKVTNRSKKDEKCTKDNEPTLEVACLEDSTFTS
FT                   VSESSHQSPENSTEEAEVCVQELQCPQVATKSPSVASHGVSRRKKSDPGLRGESLQTMK
FT                   TEKNEISRSSSPTFGKQTEPVNWPIFNSLRRHFNSKVKNCTPVLKSSKNRAPGSSTFNK
FT                   TALPLTGNCVPSNETADTSLGPCLQSEVIISPVKIEATPATNYSKQVFCCEKDLLPDTE
FT                   LSPGTEEAKCPSSNKAAETEVDDDSECFTPELFDPVDTNEENGELVETDRSSHSSDCFS
FT                   AEELFETATGFGQK"
FT   CDS             complement(join(7733337..7733953,7736686..7737009,
FT                   7746199..7746281,7749777..7749889,7780685..7780785,
FT                   7782261..7782420,7807177..7807338,7810681..7810821,
FT                   7810932..7811124,7815180..7815334,7817985..7818117,
FT                   7820281..7820480,7824523..7824744,7829526..7829627))
FT                   /codon_start=1
FT                   /gene="Brip1"
FT                   /locus_tag="mCG_117201"
FT                   /product="BRCA1 interacting protein C-terminal helicase 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG117201.0 transcript_id=mCT118337.1
FT                   protein_id=mCP85400.1 isoform=CRA_a"
FT                   /protein_id="EDL15779.1"
FT                   /translation="MTILSSRDHSCVHPEVVGNFNRKEKCMELLDGKHGKSCYFYHGVH
FT                   KISNQQTLQHLQGMSRAWDIEELVSLGRKLKACPYYTARELIEDADIVFCPYNYLLDSQ
FT                   IRETMDIKLKGQVVILDEAHNIEDCARESASYSVTEVQLRFARDELDSLINGNIRKKSH
FT                   EPLRDVCYNLINWLETNSKHLVERGYESSCKIWSGNEMLLNLYRMGITTATFPVLQRHL
FT                   SAVLQKEEKVTPIHGKEEAIQIPIISASTQVVLKGLFMVLDYLFRENSSSISIVFPFRF
FT                   ADDYKVAIQQTYSWTNQIAIFDKTGVLAVPKNKKHSRQKIGVNALNFWCLNPAVAFSDI
FT                   NDKVRTIVLTSGTLSPLKSFSSELGVTFSIQLEANHVISNSQVWVGTVGSGPKGRNLCA
FT                   TFQHTETFEFQDEVGMLLLSVCQTVSQGILCFLPSYKLLEKLRERWIFTGLWHSLESVK
FT                   TVIAEPQGGEKTDFDELLQVYYDAIKFKGEKVCRGKVSEGLDFSDDNARAVITVGIPFP
FT                   NVKDLQVELKRQYNDHHSKSRGLLPGRQWYEIQAYRALNQALGRCIRHKNDWGALILVD
FT                   DRFNNNPNRYISGLSKWVRQQIQHHSSFASALESLTEFSRRHQKVTNRSKKDEKCTKDN
FT                   EPTLEVACLEDSTFTSVSESSHQSPENSTEEAEVCVQELQCPQVATKSPSVASHGVSRR
FT                   KKSDPGLRGESLQTMKTEKNEISRSSSPTFGKQTEPVNWPIFNSLRRHFNSKVKNCTPV
FT                   LKSSKNRAPGSSTFNKTALPLTGNCVPSNETADTSLGPCLQSEVIISPVKIEATPATNY
FT                   SKQVFCCEKDLLPDTELSPGTEEAKCPSSNKAAETEVDDDSECFTPELFDPVDTNEENG
FT                   ELVETDRSSHSSDCFSAEELFETATGFGQK"
FT   gene            7850162..7850583
FT                   /pseudo
FT                   /locus_tag="mCG_117198"
FT                   /note="gene_id=mCG117198.0"
FT   mRNA            7850162..7850583
FT                   /pseudo
FT                   /locus_tag="mCG_117198"
FT                   /note="gene_id=mCG117198.0 transcript_id=mCT118334.0
FT                   created on 18-OCT-2002"
FT   gene            <7866226..7969132
FT                   /locus_tag="mCG_145959"
FT                   /note="gene_id=mCG145959.0"
FT   mRNA            join(<7866226..7866396,7871797..7872155,7948826..7948922,
FT                   7949757..7949958,7951128..7951594,7955823..7955909,
FT                   7967909..7969132)
FT                   /locus_tag="mCG_145959"
FT                   /product="mCG145959"
FT                   /note="gene_id=mCG145959.0 transcript_id=mCT186067.0
FT                   created on 04-JUL-2003"
FT   CDS             join(<7871834..7872155,7948826..7948830)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145959"
FT                   /product="mCG145959"
FT                   /note="gene_id=mCG145959.0 transcript_id=mCT186067.0
FT                   protein_id=mCP107514.0"
FT                   /protein_id="EDL15781.1"
FT                   /translation="SQLAAAYEPDTPKTSHQFEVGDSFYVRQHRAQRLEPHWKGSYLVL
FT                   LTTPTAVKVDGIAAWIHASHVKPAPLAETRIPGNHPVWKAQATENPLKVKIVKGSKDAS
FT                   PSPA"
FT   gene            complement(7876948..7922256)
FT                   /gene="Ints2"
FT                   /locus_tag="mCG_12694"
FT                   /note="gene_id=mCG12694.1"
FT   mRNA            complement(join(7876948..7877645,7877735..7877911,
FT                   7879759..7879864,7879992..7880099,7880395..7880646,
FT                   7882584..7882782,7886958..7887083,7889794..7889995,
FT                   7891489..7891653,7894052..7894156,7896816..7896924,
FT                   7897914..7898090,7899399..7899533,7901250..7901318,
FT                   7902970..7903084,7903176..7903247,7907624..7907749,
FT                   7909114..7909340,7913511..7913684,7913923..7914053,
FT                   7915669..7915782,7916958..7917060,7920044..7920182,
FT                   7920721..7921027,7921902..7922256))
FT                   /gene="Ints2"
FT                   /locus_tag="mCG_12694"
FT                   /product="integrator complex subunit 2, transcript variant
FT                   mCT13392"
FT                   /note="gene_id=mCG12694.1 transcript_id=mCT13392.2 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(7876950..7877645,7877735..7877911,
FT                   7879759..7879864,7879992..7880099,7880395..7880646,
FT                   7882584..7882782,7886958..7887083,7889794..7889995,
FT                   7891489..7891653,7894052..7894156,7896816..7896924,
FT                   7897914..7898090,7899399..7899533,7901250..7901318,
FT                   7902970..7903084,7903176..7903247,7907624..7907749,
FT                   7909114..7909340,7913511..7913684,7913923..7914053,
FT                   7915669..7915782,7916958..7917060,7920044..7920182,
FT                   7920721..>7921244))
FT                   /gene="Ints2"
FT                   /locus_tag="mCG_12694"
FT                   /product="integrator complex subunit 2, transcript variant
FT                   mCT191028"
FT                   /note="gene_id=mCG12694.1 transcript_id=mCT191028.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(7877476..7877645,7877735..7877911,
FT                   7879759..7879864,7879992..7880099,7880395..7880646,
FT                   7882584..7882782,7886958..7887083,7889794..7889995,
FT                   7891489..7891653,7894052..7894156,7896816..7896924,
FT                   7897914..7898090,7899399..7899533,7901250..7901318,
FT                   7902970..7903084,7903176..7903247,7907624..7907749,
FT                   7909114..7909340,7913511..7913684,7913923..7914053,
FT                   7915669..7915782,7916958..7917060,7920044..7920182,
FT                   7920721..>7921091))
FT                   /codon_start=1
FT                   /gene="Ints2"
FT                   /locus_tag="mCG_12694"
FT                   /product="integrator complex subunit 2, isoform CRA_b"
FT                   /note="gene_id=mCG12694.1 transcript_id=mCT191028.0
FT                   protein_id=mCP111963.0 isoform=CRA_b"
FT                   /protein_id="EDL15783.1"
FT                   /translation="RRLSYMWEVDTDFHFVVLDSLGSRAMTPEGTGLQFVSPFAFEAMQ
FT                   KVDVVRLASLSDPELRLLLPCLVRMALCAPADQSQSWAQDKKLILRLLSGVEAVNSIVA
FT                   LLSVDFHALEQDASKEQQLRHKLGGGSGESILVSQLQHGLTLEFEHSDSPRRLRLVLSE
FT                   LLAIMNKVSECNGEFFFKSSELFESAVYLEEAADVLCILQAELPSLLPIVDVAEALLRV
FT                   RNGAWFLCLLVANVPDSFNEVCRGLIKNGERQDEESLGGRRRTDALRFLCRMNPSQALK
FT                   VRGMVVEECHLPGLGVALTLDHTKTEACEDGVSDLVCFVSGLLLGTNAKVRTWFGTFIR
FT                   NGQQRKRETSGSVLWQMRRQLLLELMGILPTVRSTRIVEEADVEMEPTVSVYSGLKEEH
FT                   VVKASALLRLYCALMGIAGLKPTEEEAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFS
FT                   TLVSTPEQEQLMVLWLSWMIKEEAYFESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLV
FT                   CSTLGMKIVIKPSSLSRMKTIFTQEIFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIY
FT                   QLLRSRSFTKHKVSIKDWIYRQLCETSTPLHPQLLPLIDVYINSILTPASKSNPEATNQ
FT                   PVTEQEILNLFQEVIGGDSVRLTQRFSITAQLLVLYYILSYEEALLANTKTLASMQRKP
FT                   KSYSSSLMDQIPIKFLIRQAQGLQQELGGLHSALLRLLATNYPHLCIVDDWICEEEITG
FT                   TDALLRRMLLTSNAKTHSPKQLQEAFSAVPVSHTQVMQIMEHLTLLSASELIPYAEVLT
FT                   SNMNQLLNSGVPRRILQTVNKLWMVLNTVMPRRLWVMTVNALQPSIKFIRQQKYTQNDL
FT                   MIDPLIVLRCDRRVHRCPPLMDVTLHMLNGYLLASKAYLSAHLKETAEQDRPSPNNTVG
FT                   LVGQTDAPEVTREELKNALLAAQDSAAVQILLEICLPTEEEKAKGANSDISLRNTQGVT
FT                   TISTPSKETEEGEDNLLCNLREVQCLICCLLHQMYIADPNIAKLVHFQGYPCELLPLTV
FT                   AGIPSMHICLDFIPELIAQPELEKQIFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLL
FT                   TVLTQAKRYSFFMPTLPSLVSFCRAFPPLYEDIMSLLIQIGQVCASDVATQTRDIDPII
FT                   TRLQQIKEKPSGWSQICKDPSYKNGSRDTGSMDPDVQLCHCIESTIIEIINMSVSGI"
FT   CDS             complement(join(7877476..7877645,7877735..7877911,
FT                   7879759..7879864,7879992..7880099,7880395..7880646,
FT                   7882584..7882782,7886958..7887083,7889794..7889995,
FT                   7891489..7891653,7894052..7894156,7896816..7896924,
FT                   7897914..7898090,7899399..7899533,7901250..7901318,
FT                   7902970..7903084,7903176..7903247,7907624..7907749,
FT                   7909114..7909340,7913511..7913684,7913923..7914053,
FT                   7915669..7915782,7916958..7917060,7920044..7920182,
FT                   7920721..7921016))
FT                   /codon_start=1
FT                   /gene="Ints2"
FT                   /locus_tag="mCG_12694"
FT                   /product="integrator complex subunit 2, isoform CRA_a"
FT                   /note="gene_id=mCG12694.1 transcript_id=mCT13392.2
FT                   protein_id=mCP6003.2 isoform=CRA_a"
FT                   /protein_id="EDL15782.1"
FT                   /translation="MTPEGTGLQFVSPFAFEAMQKVDVVRLASLSDPELRLLLPCLVRM
FT                   ALCAPADQSQSWAQDKKLILRLLSGVEAVNSIVALLSVDFHALEQDASKEQQLRHKLGG
FT                   GSGESILVSQLQHGLTLEFEHSDSPRRLRLVLSELLAIMNKVSECNGEFFFKSSELFES
FT                   AVYLEEAADVLCILQAELPSLLPIVDVAEALLRVRNGAWFLCLLVANVPDSFNEVCRGL
FT                   IKNGERQDEESLGGRRRTDALRFLCRMNPSQALKVRGMVVEECHLPGLGVALTLDHTKT
FT                   EACEDGVSDLVCFVSGLLLGTNAKVRTWFGTFIRNGQQRKRETSGSVLWQMRRQLLLEL
FT                   MGILPTVRSTRIVEEADVEMEPTVSVYSGLKEEHVVKASALLRLYCALMGIAGLKPTEE
FT                   EAEQLLQLMTSRPPATPAGVRFVSLSFCMLLAFSTLVSTPEQEQLMVLWLSWMIKEEAY
FT                   FESTSGVSASFGEMLLLVAMYFHSNQLSAIIDLVCSTLGMKIVIKPSSLSRMKTIFTQE
FT                   IFTEQVVTAHAVRVPVTSNLSANITGFLPIHCIYQLLRSRSFTKHKVSIKDWIYRQLCE
FT                   TSTPLHPQLLPLIDVYINSILTPASKSNPEATNQPVTEQEILNLFQEVIGGDSVRLTQR
FT                   FSITAQLLVLYYILSYEEALLANTKTLASMQRKPKSYSSSLMDQIPIKFLIRQAQGLQQ
FT                   ELGGLHSALLRLLATNYPHLCIVDDWICEEEITGTDALLRRMLLTSNAKTHSPKQLQEA
FT                   FSAVPVSHTQVMQIMEHLTLLSASELIPYAEVLTSNMNQLLNSGVPRRILQTVNKLWMV
FT                   LNTVMPRRLWVMTVNALQPSIKFIRQQKYTQNDLMIDPLIVLRCDRRVHRCPPLMDVTL
FT                   HMLNGYLLASKAYLSAHLKETAEQDRPSPNNTVGLVGQTDAPEVTREELKNALLAAQDS
FT                   AAVQILLEICLPTEEEKAKGANSDISLRNTQGVTTISTPSKETEEGEDNLLCNLREVQC
FT                   LICCLLHQMYIADPNIAKLVHFQGYPCELLPLTVAGIPSMHICLDFIPELIAQPELEKQ
FT                   IFAIQLLSHLCIQYALPKSLSVARLAVNVMGTLLTVLTQAKRYSFFMPTLPSLVSFCRA
FT                   FPPLYEDIMSLLIQIGQVCASDVATQTRDIDPIITRLQQIKEKPSGWSQICKDPSYKNG
FT                   SRDTGSMDPDVQLCHCIESTIIEIINMSVSGI"
FT   gene            complement(7935112..7996719)
FT                   /locus_tag="mCG_12704"
FT                   /note="gene_id=mCG12704.1"
FT   mRNA            complement(join(7935112..7935820,7937165..7937265,
FT                   7940076..7940249,7941522..7941670,7943159..7943344,
FT                   7943453..7943611,7944280..7944422,7947887..7948110,
FT                   7948438..7948629,7949800..7950019,7951121..7951577,
FT                   7952778..7952967,7953620..7953843,7955730..7955891,
FT                   7962967..7963883,7965337..7965533,7965817..7966031,
FT                   7966152..7966242,7968221..7968342,7971668..7971746,
FT                   7973383..7973596,7984037..7984720,7992487..7992597,
FT                   7993132..7993294,7993856..7994050,7995674..7995871,
FT                   7996569..7996719))
FT                   /locus_tag="mCG_12704"
FT                   /product="mCG12704"
FT                   /note="gene_id=mCG12704.1 transcript_id=mCT13401.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(7935688..7935820,7937165..7937265,
FT                   7940076..7940249,7941522..7941670,7943159..7943344,
FT                   7943453..7943611,7944280..7944422,7947887..7948110,
FT                   7948438..7948629,7949800..7950019,7951121..7951577,
FT                   7952778..7952967,7953620..7953843,7955730..7955891,
FT                   7962967..7963883,7965337..7965533,7965817..7966031,
FT                   7966152..7966242,7968221..7968342,7971668..7971746,
FT                   7973383..7973596,7984037..7984720,7992487..7992597,
FT                   7993132..7993294,7993856..7994050,7995674..7995818))
FT                   /codon_start=1
FT                   /locus_tag="mCG_12704"
FT                   /product="mCG12704"
FT                   /note="gene_id=mCG12704.1 transcript_id=mCT13401.2
FT                   protein_id=mCP5922.2"
FT                   /protein_id="EDL15784.1"
FT                   /translation="MSDSATKKLIGEWKQFYPISCGLKEMSEEKQDDMDWEDDSLAAVE
FT                   VLVAGVRMIYPACFVLVPQSDIPAPSSVGASHCSASCLGIHQVPASTRDPAMSSVTLTP
FT                   PTSPEEVQTVDPQSAQKWVKFSSVSDGFSTDSTSHHGGKIPRKLANHVVDRVWQECNMN
FT                   RLQNKRKYSATSSGLCEEETADKIGCWDFVEATQRTSCSCLRHKSLKTRNTGQQGQAPS
FT                   LGQQQQVLPKHKTNEKQDKSEKPQKRPLTPFHHRVSVSDEIGMDTDSASQRLVISAADS
FT                   QVRFSNIRTNDVAKTPQMHGTELANSPQPPPLSPHPCDVVDEGVTKTPSTPQSQHFYQM
FT                   PTPDPLVPTKPMEDRIDSLSQSFPPPFQEAVEPTVYVGTAVSLEEDEANVAWKYYKVPK
FT                   KKDVEFLPPQLPNDKFKDDPVGPFGQESVTSVTELMVQCKKPLKVSDEIVQQYQIKNQY
FT                   LSAIASDTEQEPKIDPYAFVEGDEEFIFTDKKDRQNSEREAGKKHKVEDGTSAVTVLSH
FT                   EEDAMSLFSPSKQDAPRPTNHARPPSTSLIYDSDLAVSYTDLDNLFNSDEDELTPGSKK
FT                   SASGSDDKASSKESKTGNLDPLSCISTADLHKMYPTPPSLEQHIMGFSPMNMNNKEYGS
FT                   VDTAPGGTVLEGNSSSVGTQFRIEVEEGFCSPKPSEIKDFSYVYKPENCQVLVGCSMFA
FT                   PLKTLPSHCLPPIKLPEECVYRQSWTVGKLDLLPSGPSMPFIKEGDGSNLDQDYGPAYT
FT                   PQTHASFGMPPSSAPPSNGGAGILPSPSTPRFPTPRTPRTPRTPRGAGGPASAQGSVKY
FT                   ENSDLYSPASTPSTCRPLNSVEPATVPSIPEAHSLYVNLILSESVMNLFKDCNFDSCCI
FT                   CVCNMNIKGADVGVYIPDPTQEAQYRCTCGFSAVMNRKFGNNSGLFLEDELDIIGRNTD
FT                   CGKEAEKRFEALRASSVENVNGGLKESEKVPDELILLLQDQCTNLFSPFGAADQDPFPK
FT                   VGISSNWVRVEERDCCSDCCLALEHGRQFMDNMSGGKVDEALVRSSCLHPWAKQNDASV
FT                   QCSQDILRMLLSLQPVLQDAIQKKRTVRPWGVQGPLTWQQFHKMAGRGSYGTDESPEPL
FT                   PIPTFLLGYDYDFLVLSPFALPYWEKLMLEPYGSQRDIAYVVLCPENEALLNGARSFFR
FT                   DLTAIYESCRLGQHRPISRLLTDGIMKVGATASKKLSEKFVTEWFSQAADGNNEAFSKL
FT                   KLYAQVCRYDLGPYLASQPLDSSLLSQPNLVAPPNQSLVTAPQMTNTGNANAPSATLAS
FT                   AASSTMTMTSGVPISTSVATANSTLTTTSSSSSSSLSSGVSSNKLPSFPPFGSMNTSGT
FT                   GSMSAQASTVQSGQLGGQQSSSLQAAGISGESASLPTQPHPDVSESTMDRDKVGIPTDG
FT                   DSHAITYPPAIVVYIIDPFTYENKDESTNSSNVWTLGLLRCFLEMVQTLPPHIKSTVSV
FT                   QIVPCQYLLQPVKHDDRQIYSQHLKSLAFSVFTQCRRPLPTSTNVKTLTGFGPGLAMET
FT                   ALKSPDRPECIRLYTPPFILAPVKDKQTELGETFGEAGQKYNVLFVGYCLSHDQRWILA
FT                   SCTDLYGELLETCIINIDVPNRARRKKGSARRFGLQKLWEWCLGLVQMSSLPWRVVIGR
FT                   LGRIGHGELKDWSCLLSRRNLQSLSKRLKDMCRMCGISAADSPSILSACLVAMEPQGSF
FT                   VIMPDSVSTGSVFGRSTTLNMQTPQLNTPQDTSCTHILVFPTSASVQVASATYTTENLD
FT                   LAFNPNNDGADGMGIFDLLDTGDDLDPDIINILPASPTASPVHSPGSHYPHGGDAGKGQ
FT                   GTDRLLSTESHDEVTNILQQPLALGYFVSTAKAGPLPDWFWSACPQAQYQCPLFLKASL
FT                   HLHVPSVQSDELLHSKHSHPLDSNQTSDVLRFVLEQYNALSWLTCDPAVQDRRSCLPVH
FT                   FVVLNQLYNFIMNML"
FT   gene            complement(8010587..8020236)
FT                   /locus_tag="mCG_9026"
FT                   /note="gene_id=mCG9026.1"
FT   mRNA            complement(join(8010587..8010756,8020002..8020236))
FT                   /locus_tag="mCG_9026"
FT                   /product="mCG9026"
FT                   /note="gene_id=mCG9026.1 transcript_id=mCT8952.1 created on
FT                   11-NOV-2002"
FT   CDS             complement(join(8010664..8010756,8020002..8020112))
FT                   /codon_start=1
FT                   /locus_tag="mCG_9026"
FT                   /product="mCG9026"
FT                   /note="gene_id=mCG9026.1 transcript_id=mCT8952.1
FT                   protein_id=mCP5916.2"
FT                   /protein_id="EDL15785.1"
FT                   /translation="MYLVFGGEIKDLEEENCGYFGGVKIPILLTLFTMTYQKRKMEYGR
FT                   MAFPMNAVLCFSKQFTICWSDV"
FT   gene            8145207..8159627
FT                   /gene="0610013E23Rik"
FT                   /locus_tag="mCG_9032"
FT                   /note="gene_id=mCG9032.2"
FT   mRNA            join(8145207..8145351,8146614..8147058,8147209..8147285,
FT                   8149484..8149584,8150774..8150927,8152095..8152253,
FT                   8153577..8153642,8155646..8155747,8156239..8159097,
FT                   8159298..8159627)
FT                   /gene="0610013E23Rik"
FT                   /locus_tag="mCG_9032"
FT                   /product="RIKEN cDNA 0610013E23, transcript variant
FT                   mCT8956"
FT                   /note="gene_id=mCG9032.2 transcript_id=mCT8956.3 created on
FT                   10-JUN-2003"
FT   mRNA            join(8145208..8145351,8145504..8145770,8146614..8147058,
FT                   8147209..8147285,8149484..8149584,8150774..8150927,
FT                   8152095..8152253,8153577..8153642,8155646..8155747,
FT                   8156239..8159097,8159298..8159627)
FT                   /gene="0610013E23Rik"
FT                   /locus_tag="mCG_9032"
FT                   /product="RIKEN cDNA 0610013E23, transcript variant
FT                   mCT185676"
FT                   /note="gene_id=mCG9032.2 transcript_id=mCT185676.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(8146665..8147058,8147209..8147285,8149484..8149584,
FT                   8150774..8150927,8152095..8152253,8153577..8153642,
FT                   8155646..8155747,8156239..8156373)
FT                   /codon_start=1
FT                   /gene="0610013E23Rik"
FT                   /locus_tag="mCG_9032"
FT                   /product="RIKEN cDNA 0610013E23, isoform CRA_a"
FT                   /note="gene_id=mCG9032.2 transcript_id=mCT185676.0
FT                   protein_id=mCP106934.0 isoform=CRA_a"
FT                   /protein_id="EDL15786.1"
FT                   /translation="MQASCNQLHDPPGTAHEDAAASPCGHSRSTEGSLHPGDVHIQINS
FT                   GPKEYSENPSSRNPRSGVCTCAHGCVHGRFRSYSHSEARPPDDFATESGEHGSGSFSEF
FT                   RYLFKWLQKSLPYILILGIKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRERSSKL
FT                   RCAWLLVFLAGSSVLLYYTFHSQSLHYSLIFLNPTLEQLSFWEVLWIVGITDFILKFFF
FT                   MGLKCLILLVPSFIMPFKSKGYWYMLLEELCQYYRIFVPIPVWFRYLISYGEFGNVTTW
FT                   SLGILLALLYLILKLLDFFGHLRTFRQVLRVFFTRPSYGVPASKRQCSDMDGICTICQA
FT                   EFQKPVLLFCQHIFCEECITLWFNREKTCPLCRTVISECINKWKDGATSSHLQMY"
FT   CDS             join(8146665..8147058,8147209..8147285,8149484..8149584,
FT                   8150774..8150927,8152095..8152253,8153577..8153642,
FT                   8155646..8155747,8156239..8156373)
FT                   /codon_start=1
FT                   /gene="0610013E23Rik"
FT                   /locus_tag="mCG_9032"
FT                   /product="RIKEN cDNA 0610013E23, isoform CRA_a"
FT                   /note="gene_id=mCG9032.2 transcript_id=mCT8956.3
FT                   protein_id=mCP5937.2 isoform=CRA_a"
FT                   /protein_id="EDL15787.1"
FT                   /translation="MQASCNQLHDPPGTAHEDAAASPCGHSRSTEGSLHPGDVHIQINS
FT                   GPKEYSENPSSRNPRSGVCTCAHGCVHGRFRSYSHSEARPPDDFATESGEHGSGSFSEF
FT                   RYLFKWLQKSLPYILILGIKLVMQHITGISLGIGLLTTFMYANKSIVNQVFLRERSSKL
FT                   RCAWLLVFLAGSSVLLYYTFHSQSLHYSLIFLNPTLEQLSFWEVLWIVGITDFILKFFF
FT                   MGLKCLILLVPSFIMPFKSKGYWYMLLEELCQYYRIFVPIPVWFRYLISYGEFGNVTTW
FT                   SLGILLALLYLILKLLDFFGHLRTFRQVLRVFFTRPSYGVPASKRQCSDMDGICTICQA
FT                   EFQKPVLLFCQHIFCEECITLWFNREKTCPLCRTVISECINKWKDGATSSHLQMY"
FT   gene            complement(8160764..8205160)
FT                   /gene="Rps6kb1"
FT                   /locus_tag="mCG_9027"
FT                   /note="gene_id=mCG9027.1"
FT   mRNA            complement(join(8160764..8163587,8164890..8165002,
FT                   8167415..8167522,8172215..8172292,8172451..8172513,
FT                   8173433..8173540,8173928..8174018,8174175..8174265,
FT                   8176718..8176818,8178210..8178267,8180519..8180666,
FT                   8193176..8193244,8194430..8194550,8195816..8195865,
FT                   8204970..8205160))
FT                   /gene="Rps6kb1"
FT                   /locus_tag="mCG_9027"
FT                   /product="ribosomal protein S6 kinase, polypeptide 1"
FT                   /note="gene_id=mCG9027.1 transcript_id=mCT8957.2 created on
FT                   10-SEP-2002"
FT   CDS             complement(join(8163350..8163587,8164890..8165002,
FT                   8167415..8167522,8172215..8172292,8172451..8172513,
FT                   8173433..8173540,8173928..8174018,8174175..8174265,
FT                   8176718..8176818,8178210..8178267,8180519..8180666,
FT                   8193176..8193244,8194430..8194550,8195816..8195865,
FT                   8204970..8205110))
FT                   /codon_start=1
FT                   /gene="Rps6kb1"
FT                   /locus_tag="mCG_9027"
FT                   /product="ribosomal protein S6 kinase, polypeptide 1"
FT                   /note="gene_id=mCG9027.1 transcript_id=mCT8957.2
FT                   protein_id=mCP5981.2"
FT                   /db_xref="GOA:Q8BSK8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016238"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR017892"
FT                   /db_xref="MGI:MGI:1270849"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BSK8"
FT                   /protein_id="EDL15788.1"
FT                   /translation="MRRRRRRDGFYLAPDFRHREAEDMAGVFDIDLDQPEDAGSEDELE
FT                   EGGQLNESMDHGGVGPYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGK
FT                   VFQVRKVTGANTGKIFAMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQ
FT                   TGGKLYLILEYLSGGELFMQLEREGIFMEDTACFYLAEISMALGHLHQKGIIYRDLKPE
FT                   NIMLNHQGHVKLTDFGLCKESIHDGTVTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGA
FT                   LMYDMLTGAPPFTGENRKKTIDKILKCKLNLPPYLTQEARDLLKKLLKRNAASRLGAGP
FT                   GDAGEVQAHPFFRHINWEELLARKVEPPFKPLLQSEEDVSQFDSKFTRQTPVDSPDDST
FT                   LSESANQVFLGFTYVAPSVLESVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWG
FT                   RGASASTANPQTPVEYPMETSGIEQMDVTVSGEASAPLPIRQPNSGPYKKQAFPMISKR
FT                   PEHLRMNL"
FT   gene            <8205395..8227573
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /note="gene_id=mCG9031.4"
FT   mRNA            join(<8205395..8205740,8209185..8209404,8209726..8209873,
FT                   8212982..8213198,8215267..8215498,8216889..8216981,
FT                   8217919..8218083,8221435..8221575,8225896..8226079,
FT                   8227251..8227573)
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, transcript variant mCT191038"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT191038.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<8205412..8205634,8209185..8209404,8209726..8209873,
FT                   8212982..8213198,8215267..8215498,8217919..8218083,
FT                   8221435..8221575,8225896..8226079,8227251..8227573)
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, transcript variant mCT191039"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT191039.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(8205595..8205634,8209185..8209404,8209726..8209873,
FT                   8212982..8213198,8215267..8215498,8216889..8216981,
FT                   8217919..8218083,8221435..8221575,8225896..8226079,
FT                   8227251..8227557)
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, transcript variant mCT171280"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT171280.0 created
FT                   on 03-JAN-2003"
FT   mRNA            join(8205662..8205740,8209185..8209404,8209726..8209873,
FT                   8212982..8213198,8215267..8215498,8217919..8218083,
FT                   8221435..8221575,8225896..8226079,8227251..8227414)
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, transcript variant mCT8958"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT8958.1 created on
FT                   03-JAN-2003"
FT   CDS             join(<8209209..8209404,8209726..8209873,8212982..8213198,
FT                   8215267..8215498,8216889..8216981,8217919..8218083,
FT                   8221435..8221575,8225896..8226079,8227251..8227359)
FT                   /codon_start=1
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, isoform CRA_b"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT191038.0
FT                   protein_id=mCP111996.0 isoform=CRA_b"
FT                   /protein_id="EDL15790.1"
FT                   /translation="TKPPLWLGMSIVTVQLGQCGNQIGFEVFDALFRDSHCSQGLCSKR
FT                   DNEAYQASCRERFFREEENGVPVARAVLVDMEPKVINQTLSKAAQSGRWNYGQHTSFCQ
FT                   KQGSGNNWAYGYSVHGPKHEESIMNLIQTEVEKCDSLSGFFIIMSMAGGTGSGLGAFVT
FT                   QKLQDQYSSSLKMNQIIWPYGTGEVIVQNYNSILTLSHLYRSSDALLIHENDAVHKICA
FT                   KRMNIKQISFRDLNQVLAHQLGSVFQPTYSEDSSFHYRRNPLDSGTVGPQACLMPRIFV
FT                   WSLSATNLSFYPQTGDLMEHLVPHPEFKMLGVRNIPQMSAASLAYSAFTWAGLLKHLRQ
FT                   MLISSAKMEEGINWQVRPPLSGLPPIGKASAHKEHHFNTSLANLVVLRGREVHSADVEG
FT                   FKDPALYTSWLEPVDAFSVWKTQRAFDKYEKSAALVSNSQLLVKPLDMIVGKAWNMFSS
FT                   KAFIHQYTKFGMEEEDFLDSFALLEQVVASYGSLGP"
FT   CDS             join(<8209209..8209404,8209726..8209873,8212982..8213198,
FT                   8215267..8215498,8217919..8218083,8221435..8221575,
FT                   8225896..8226079,8227251..8227359)
FT                   /codon_start=1
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, isoform CRA_c"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT191039.0
FT                   protein_id=mCP111997.0 isoform=CRA_c"
FT                   /protein_id="EDL15791.1"
FT                   /translation="TKPPLWLGMSIVTVQLGQCGNQIGFEVFDALFRDSHCSQGLCSKR
FT                   DNEAYQASCRERFFREEENGVPVARAVLVDMEPKVINQTLSKAAQSGRWNYGQHTSFCQ
FT                   KQGSGNNWAYGYSVHGPKHEESIMNLIQTEVEKCDSLSGFFIIMSMAGGTGSGLGAFVT
FT                   QKLQDQYSSSLKMNQIIWPYGTGEVIVQNYNSILTLSHLYRSSDALLIHENDAVHKICA
FT                   KRMNIKQISFRDLNQVLAHQLGSVFQPTYSEDSSFHYRRNPLGDLMEHLVPHPEFKMLG
FT                   VRNIPQMSAASLAYSAFTWAGLLKHLRQMLISSAKMEEGINWQVRPPLSGLPPIGKASA
FT                   HKEHHFNTSLANLVVLRGREVHSADVEGFKDPALYTSWLEPVDAFSVWKTQRAFDKYEK
FT                   SAALVSNSQLLVKPLDMIVGKAWNMFSSKAFIHQYTKFGMEEEDFLDSFALLEQVVASY
FT                   GSLGP"
FT   CDS             join(8209233..8209404,8209726..8209873,8212982..8213198,
FT                   8215267..8215498,8216889..8216981,8217919..8218083,
FT                   8221435..8221575,8225896..8226079,8227251..8227359)
FT                   /codon_start=1
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, isoform CRA_a"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT171280.0
FT                   protein_id=mCP94199.0 isoform=CRA_a"
FT                   /protein_id="EDL15789.1"
FT                   /translation="MSIVTVQLGQCGNQIGFEVFDALFRDSHCSQGLCSKRDNEAYQAS
FT                   CRERFFREEENGVPVARAVLVDMEPKVINQTLSKAAQSGRWNYGQHTSFCQKQGSGNNW
FT                   AYGYSVHGPKHEESIMNLIQTEVEKCDSLSGFFIIMSMAGGTGSGLGAFVTQKLQDQYS
FT                   SSLKMNQIIWPYGTGEVIVQNYNSILTLSHLYRSSDALLIHENDAVHKICAKRMNIKQI
FT                   SFRDLNQVLAHQLGSVFQPTYSEDSSFHYRRNPLDSGTVGPQACLMPRIFVWSLSATNL
FT                   SFYPQTGDLMEHLVPHPEFKMLGVRNIPQMSAASLAYSAFTWAGLLKHLRQMLISSAKM
FT                   EEGINWQVRPPLSGLPPIGKASAHKEHHFNTSLANLVVLRGREVHSADVEGFKDPALYT
FT                   SWLEPVDAFSVWKTQRAFDKYEKSAALVSNSQLLVKPLDMIVGKAWNMFSSKAFIHQYT
FT                   KFGMEEEDFLDSFALLEQVVASYGSLGP"
FT   CDS             join(8209233..8209404,8209726..8209873,8212982..8213198,
FT                   8215267..8215498,8217919..8218083,8221435..8221575,
FT                   8225896..8226079,8227251..8227359)
FT                   /codon_start=1
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, isoform CRA_d"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT8958.1
FT                   protein_id=mCP5867.2 isoform=CRA_d"
FT                   /protein_id="EDL15792.1"
FT                   /translation="MSIVTVQLGQCGNQIGFEVFDALFRDSHCSQGLCSKRDNEAYQAS
FT                   CRERFFREEENGVPVARAVLVDMEPKVINQTLSKAAQSGRWNYGQHTSFCQKQGSGNNW
FT                   AYGYSVHGPKHEESIMNLIQTEVEKCDSLSGFFIIMSMAGGTGSGLGAFVTQKLQDQYS
FT                   SSLKMNQIIWPYGTGEVIVQNYNSILTLSHLYRSSDALLIHENDAVHKICAKRMNIKQI
FT                   SFRDLNQVLAHQLGSVFQPTYSEDSSFHYRRNPLGDLMEHLVPHPEFKMLGVRNIPQMS
FT                   AASLAYSAFTWAGLLKHLRQMLISSAKMEEGINWQVRPPLSGLPPIGKASAHKEHHFNT
FT                   SLANLVVLRGREVHSADVEGFKDPALYTSWLEPVDAFSVWKTQRAFDKYEKSAALVSNS
FT                   QLLVKPLDMIVGKAWNMFSSKAFIHQYTKFGMEEEDFLDSFALLEQVVASYGSLGP"
FT   mRNA            join(8215389..8215498,8217919..8218083,8225896..8226079,
FT                   8227251..8227573)
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, transcript variant mCT171281"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT171281.1 created
FT                   on 03-JAN-2003"
FT   CDS             join(8217927..8218083,8225896..8226079,8227251..8227359)
FT                   /codon_start=1
FT                   /gene="Tubd1"
FT                   /locus_tag="mCG_9031"
FT                   /product="tubulin, delta 1, isoform CRA_e"
FT                   /note="gene_id=mCG9031.4 transcript_id=mCT171281.1
FT                   protein_id=mCP94200.1 isoform=CRA_e"
FT                   /protein_id="EDL15793.1"
FT                   /translation="MEHLVPHPEFKMLGVRNIPQMSAASLAYSAFTWAGLLKHLRQMLI
FT                   SSAKMEEEGFKDPALYTSWLEPVDAFSVWKTQRAFDKYEKSAALVSNSQLLVKPLDMIV
FT                   GKAWNMFSSKAFIHQYTKFGMEEEDFLDSFALLEQVVASYGSLGP"
FT   gene            8227790..8228992
FT                   /locus_tag="mCG_147549"
FT                   /note="gene_id=mCG147549.0"
FT   mRNA            join(8227790..8227850,8228066..8228992)
FT                   /locus_tag="mCG_147549"
FT                   /product="mCG147549"
FT                   /note="gene_id=mCG147549.0 transcript_id=mCT187812.0
FT                   created on 13-JAN-2004"
FT   CDS             8228436..8228591
FT                   /codon_start=1
FT                   /locus_tag="mCG_147549"
FT                   /product="mCG147549"
FT                   /note="gene_id=mCG147549.0 transcript_id=mCT187812.0
FT                   protein_id=mCP109315.0"
FT                   /protein_id="EDL15794.1"
FT                   /translation="MCVYIYMCVCVCVCVCVCMRVCSCVHVDMYEATHGGQREHRCFGA
FT                   GDASGF"
FT   gene            complement(8244020..8343815)
FT                   /gene="Tmem49"
FT                   /locus_tag="mCG_9034"
FT                   /note="gene_id=mCG9034.3"
FT   mRNA            complement(join(8244020..8245894,8246920..8247022,
FT                   8262417..8262478,8267594..8267710,8271739..8271819,
FT                   8295347..8295478,8303690..8303857,8321328..8321438,
FT                   8323673..8323763,8324844..8324979,8325967..8326068,
FT                   8343717..8343815))
FT                   /gene="Tmem49"
FT                   /locus_tag="mCG_9034"
FT                   /product="transmembrane protein 49"
FT                   /note="gene_id=mCG9034.3 transcript_id=mCT175877.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(8245751..8245894,8246920..8247022,
FT                   8262417..8262478,8267594..8267710,8271739..8271819,
FT                   8295347..8295478,8303690..8303857,8321328..8321438,
FT                   8323673..8323763,8324844..8324979,8325967..8326042))
FT                   /codon_start=1
FT                   /gene="Tmem49"
FT                   /locus_tag="mCG_9034"
FT                   /product="transmembrane protein 49"
FT                   /note="gene_id=mCG9034.3 transcript_id=mCT175877.0
FT                   protein_id=mCP98799.0"
FT                   /protein_id="EDL15795.1"
FT                   /translation="MAENGKNCDQRRIAMSKDQHNGSLTDPSSVHEKKRRDREERQNIV
FT                   LWRQPLITLQYFSLETLVVLKEWTSKLWHRQSIVVSFLLLLAALVATYYVEGAHQQYVQ
FT                   RIEKQFLLYAYWIGLGILSSVGLGTGLHTFLLYLGPHIASVTLAAYECNSVNFPEPPYP
FT                   DQIICPEEEGAEGAISLWSIISKVRIEACMWGIGTAIGELPPYFMARAARLSGAEPDDE
FT                   EYQEFEEMLEHAEAAQDFASRAKLAVQKLVQKVGFFGILACASIPNPLFDLAGITCGHF
FT                   LVPFWTFFGATLIGKAIIKMHIQKIFVIVTFSKHIVEQMVTFIGAVPGIGPSLQKPFQE
FT                   YLEAQRQKLHHRSEAGTPQGENWLSWMFEKLVVAMVCYFVLSIINSMAQNYAKRIQQRL
FT                   NSEEKTK"
FT   gene            complement(8290797..8291452)
FT                   /pseudo
FT                   /locus_tag="mCG_9033"
FT                   /note="gene_id=mCG9033.0"
FT   mRNA            complement(8290797..8291452)
FT                   /pseudo
FT                   /locus_tag="mCG_9033"
FT                   /note="gene_id=mCG9033.0 transcript_id=mCT8959.1 created on
FT                   18-OCT-2002"
FT   gene            8343890..8352417
FT                   /gene="Ptrh2"
FT                   /locus_tag="mCG_50860"
FT                   /note="gene_id=mCG50860.1"
FT   mRNA            join(8343890..8344100,8349525..8352417)
FT                   /gene="Ptrh2"
FT                   /locus_tag="mCG_50860"
FT                   /product="peptidyl-tRNA hydrolase 2, transcript variant
FT                   mCT51043"
FT                   /note="gene_id=mCG50860.1 transcript_id=mCT51043.1 created
FT                   on 18-OCT-2002"
FT   mRNA            join(8343960..8344100,8348001..8348093,8349525..8352417)
FT                   /gene="Ptrh2"
FT                   /locus_tag="mCG_50860"
FT                   /product="peptidyl-tRNA hydrolase 2, transcript variant
FT                   mCT174522"
FT                   /note="gene_id=mCG50860.1 transcript_id=mCT174522.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(8348091..8348093,8349525..8350070)
FT                   /codon_start=1
FT                   /gene="Ptrh2"
FT                   /locus_tag="mCG_50860"
FT                   /product="peptidyl-tRNA hydrolase 2, isoform CRA_a"
FT                   /note="gene_id=mCG50860.1 transcript_id=mCT174522.0
FT                   protein_id=mCP97441.0 isoform=CRA_a"
FT                   /protein_id="EDL15796.1"
FT                   /translation="MMLSKFLTMEYLVHPGTLSLAAGVACGMCLGWGLRSHLGMFPQNS
FT                   TSEANRDTETGTEASILGESGEYKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQTQRRS
FT                   PQVLKEWEYCGQPKVVVKAPDEDTLIQLLTHAKTLGLTVSLIQDAGRTQIEPGSRTVLG
FT                   IGPGPVELIDEVTGHLKLY"
FT   CDS             8349525..8350070
FT                   /codon_start=1
FT                   /gene="Ptrh2"
FT                   /locus_tag="mCG_50860"
FT                   /product="peptidyl-tRNA hydrolase 2, isoform CRA_b"
FT                   /note="gene_id=mCG50860.1 transcript_id=mCT51043.1
FT                   protein_id=mCP31462.2 isoform=CRA_b"
FT                   /protein_id="EDL15797.1"
FT                   /translation="MLSKFLTMEYLVHPGTLSLAAGVACGMCLGWGLRSHLGMFPQNST
FT                   SEANRDTETGTEASILGESGEYKMILVVRTDLKMGKGKVAAQCSHAAVSAYKQTQRRSP
FT                   QVLKEWEYCGQPKVVVKAPDEDTLIQLLTHAKTLGLTVSLIQDAGRTQIEPGSRTVLGI
FT                   GPGPVELIDEVTGHLKLY"
FT   gene            complement(8354321..8420624)
FT                   /gene="Cltc"
FT                   /locus_tag="mCG_4243"
FT                   /note="gene_id=mCG4243.1"
FT   mRNA            complement(join(8354321..8355658,8357236..8357311,
FT                   8362191..8362412,8362583..8362753,8363646..8363756,
FT                   8363853..8363984,8364062..8364211,8364628..8364795,
FT                   8364876..8364983,8365134..8365298,8365961..8366118,
FT                   8366655..8366847,8367040..8367223,8367458..8367603,
FT                   8368938..8369060,8371333..8371567,8371839..8371981,
FT                   8372573..8372698,8379511..8379674,8380799..8380979,
FT                   8381072..8381236,8381863..8382000,8383188..8383310,
FT                   8383788..8383940,8388146..8388346,8389330..8389527,
FT                   8393285..8393458,8393792..8393905,8395579..8395740,
FT                   8396650..8396918,8400145..8400352,8420381..8420624))
FT                   /gene="Cltc"
FT                   /locus_tag="mCG_4243"
FT                   /product="clathrin, heavy polypeptide (Hc), transcript
FT                   variant mCT2979"
FT                   /note="gene_id=mCG4243.1 transcript_id=mCT2979.1 created on
FT                   10-SEP-2002"
FT   mRNA            complement(join(8354321..8355658,8357236..8357311,
FT                   8362191..8362412,8362583..8362753,8363646..8363756,
FT                   8363853..8363984,8364062..8364211,8364628..8364795,
FT                   8364876..8364983,8365134..8365298,8365961..8366118,
FT                   8366655..8366847,8367046..8367223,8367458..8367603,
FT                   8368938..8369060,8371333..8371567,8371839..8371981,
FT                   8372573..8372698,8379511..8379674,8380799..8380979,
FT                   8381072..8381236,8381863..8382000,8383188..8383310,
FT                   8383788..8383940,8388146..8388346,8389330..8389527,
FT                   8393285..8393357,8420426..8420623))
FT                   /gene="Cltc"
FT                   /locus_tag="mCG_4243"
FT                   /product="clathrin, heavy polypeptide (Hc), transcript
FT                   variant mCT173042"
FT                   /note="gene_id=mCG4243.1 transcript_id=mCT173042.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(8355534..8355658,8357236..8357311,
FT                   8362191..8362412,8362583..8362753,8363646..8363756,
FT                   8363853..8363984,8364062..8364211,8364628..8364795,
FT                   8364876..8364983,8365134..8365298,8365961..8366118,
FT                   8366655..8366847,8367040..8367223,8367458..8367603,
FT                   8368938..8369060,8371333..8371567,8371839..8371981,
FT                   8372573..8372698,8379511..8379674,8380799..8380979,
FT                   8381072..8381236,8381863..8382000,8383188..8383310,
FT                   8383788..8383940,8388146..8388346,8389330..8389527,
FT                   8393285..8393458,8393792..8393905,8395579..8395740,
FT                   8396650..8396918,8400145..8400352,8420381..8420422))
FT                   /codon_start=1
FT                   /gene="Cltc"
FT                   /locus_tag="mCG_4243"
FT                   /product="clathrin, heavy polypeptide (Hc), isoform CRA_b"
FT                   /note="gene_id=mCG4243.1 transcript_id=mCT2979.1
FT                   protein_id=mCP9326.1 isoform=CRA_b"
FT                   /protein_id="EDL15799.1"
FT                   /translation="MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVG
FT                   EQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTM
FT                   TDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQK
FT                   WLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRG
FT                   QAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGY
FT                   IHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN
FT                   VLQNPDLALRMAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIR
FT                   RFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLE
FT                   CSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFL
FT                   LRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPS
FT                   EGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYD
FT                   IKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYHEQLS
FT                   TQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICRESNC
FT                   YDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRL
FT                   PVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIHEGCE
FT                   EPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQCDLEL
FT                   INVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALSETQDPEEVS
FT                   VTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYINRLD
FT                   NYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHIGNLDRAYEFAERCNEPAV
FT                   WSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANASGNWEELVKYLQMARKKARE
FT                   SYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSNFG
FT                   RLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADELE
FT                   ELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWSRV
FT                   NIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVANVE
FT                   LYYKAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHNNK
FT                   SVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGNNR
FT                   WKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLLRP
FT                   DVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQPQ
FT                   LMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM"
FT   CDS             complement(join(8355534..8355658,8357236..8357311,
FT                   8362191..8362412,8362583..8362753,8363646..8363756,
FT                   8363853..8363984,8364062..8364211,8364628..8364795,
FT                   8364876..8364983,8365134..8365298,8365961..8366118,
FT                   8366655..8366847,8367046..8367223,8367458..8367603,
FT                   8368938..8369060,8371333..8371567,8371839..8371981,
FT                   8372573..8372698,8379511..8379674,8380799..8380979,
FT                   8381072..8381236,8381863..8382000,8383188..8383310,
FT                   8383788..8383940,8388146..8388346,8389330..8389446))
FT                   /codon_start=1
FT                   /gene="Cltc"
FT                   /locus_tag="mCG_4243"
FT                   /product="clathrin, heavy polypeptide (Hc), isoform CRA_a"
FT                   /note="gene_id=mCG4243.1 transcript_id=mCT173042.0
FT                   protein_id=mCP95961.0 isoform=CRA_a"
FT                   /protein_id="EDL15798.1"
FT                   /translation="MAVRNNLAGAEELFARKFNALFAQGNYSEAAKVAANAPKGILRTP
FT                   DTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKE
FT                   DKLECSEELGDLVKSVDPTLALSVYLRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPD
FT                   WIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQIVDVFMEYNLIQQCTAFLLDALKN
FT                   NRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYDRAHIAQLCEKAGLLQRALEHFT
FT                   DLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRAMLSANIRQNLQICVQVASKYH
FT                   EQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHFKYIQAACKTGQIKEVERICR
FT                   ESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVLYLYRNNLQKYIEIYVQKVN
FT                   PSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEVEKRNRLKLLLPWLEARIH
FT                   EGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYCEKRDPHLACVAYERGQC
FT                   DLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRPLIDQVVQTALSETQDP
FT                   EEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLILTAIKADRTRVMEYI
FT                   NRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVLIEHIGNLDRAYEFAERCNEP
FT                   AVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANASGNWEELVKYLQMARKKA
FT                   RESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEKMYDAAKLLYNNVSN
FT                   FGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLAQMCGLHIVVHADE
FT                   LEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKPQKMREHLELFWS
FT                   RVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEGQFKDIITKVAN
FT                   VELYYKAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVKPYLRSVQNHN
FT                   NKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRRIAAYLFKGN
FT                   NRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGACLFTCYDLL
FT                   RPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESLRKEEEQATETQPIVYGQ
FT                   PQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM"
FT   gene            complement(8432881..8470890)
FT                   /gene="Dhx40"
FT                   /locus_tag="mCG_4240"
FT                   /note="gene_id=mCG4240.1"
FT   mRNA            complement(join(8432881..8433469,8434239..8434467,
FT                   8435103..8435172,8437020..8437114,8438591..8438699,
FT                   8439546..8439660,8447818..8447975,8448696..8448776,
FT                   8452101..8452283,8452420..8452506,8456351..8456450,
FT                   8460770..8460901,8462069..8462135,8462567..8462794,
FT                   8464116..8464235,8467404..8467549,8469599..8469766,
FT                   8470577..8470890))
FT                   /gene="Dhx40"
FT                   /locus_tag="mCG_4240"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 40,
FT                   transcript variant mCT2986"
FT                   /note="gene_id=mCG4240.1 transcript_id=mCT2986.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(8433330..8433469,8434239..8434467,
FT                   8435103..8435172,8437020..8437114,8438591..8438699,
FT                   8439546..8439660,8447818..8447975,8448696..8448776,
FT                   8452101..8452283,8452420..8452506,8456351..8456450,
FT                   8460770..8460901,8462069..8462135,8462567..8462794,
FT                   8464116..8464235,8467404..8467549,8469599..8469766,
FT                   8470577..8470688))
FT                   /codon_start=1
FT                   /gene="Dhx40"
FT                   /locus_tag="mCG_4240"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 40,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG4240.1 transcript_id=mCT2986.2
FT                   protein_id=mCP9363.2 isoform=CRA_b"
FT                   /protein_id="EDL15801.1"
FT                   /translation="MSRFPAVAGRAPRRQEEGERPIELQEERPSAVRIADREEKGCTSQ
FT                   EGGTTPTFPIQKQRKKLIQAVRDNSFLIVTGNTGSGKTTQLPKYLYEAGFSQHGMIGVT
FT                   QPRKVAAISVAQRVAEEMKCTLGSKVGYQVRFDDCSSKETAIKYMTDGCLLKHILGDPN
FT                   LSKFSVIILDEAHERTLTTDILFGLLKKLFQDKSPNRKEHLKVVVMSATMELAKLSAFF
FT                   GNCPIFDIPGRLYPVREKFCNLIGPRDRENTAYIQAIVKVTMDIHLNEMAGDILVFLTG
FT                   QFEIEKSCELLFQMAESVDYDYDVQDTTLDGLLILPCYGSMTTDQQRRIFLPPPPGIRK
FT                   CVISTNISATSLTIDGIRYVVDGGFVKQLNHNPRLGLDILEVVPISKSEALQRSGRAGR
FT                   TASGKCFRIYSKEFWSQCMPDHVIPEIKRTSLTSVVLTLKCLAIHDVIRFPYLDPPNER
FT                   LILEALKQLYQCDAIDRSGHVTRLGLSMVEFPLPPHLTCAVIRAASLDCEDLLLPIAAM
FT                   LSVENVFIRPVDPEYQKEAEQRHRELAAKAGGFNDFATLAVIFEQCKSSGAPASWCQKH
FT                   WIHWRCLFSAFRVEAQLRELIRKLKQQSDFPRETFEGPKHEVLRRCLCAGYFKNVARRS
FT                   VGRTFCTMDGRGSPVHIHPSSALHEQETKLEWIIFHEVLVTTKVYARIVCPIRYEWVRD
FT                   LLPKLHELNAHDLSSVARREMREDARRKWTNKENVKQLKDGISKEVLKKMQRRNDDKSI
FT                   SDARARFLERKQQRIQDHSDTLKETG"
FT   mRNA            complement(join(8434302..8434467,8435103..8435172,
FT                   8437020..8437114,8438591..8438699,8439546..8439603,
FT                   8467506..8467549,8469599..8469766,8470577..8470715))
FT                   /gene="Dhx40"
FT                   /locus_tag="mCG_4240"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 40,
FT                   transcript variant mCT173041"
FT                   /note="gene_id=mCG4240.1 transcript_id=mCT173041.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(8439574..8439603,8467506..8467549,
FT                   8469599..8469766,8470577..8470688))
FT                   /codon_start=1
FT                   /gene="Dhx40"
FT                   /locus_tag="mCG_4240"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 40,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG4240.1 transcript_id=mCT173041.0
FT                   protein_id=mCP95960.0 isoform=CRA_a"
FT                   /protein_id="EDL15800.1"
FT                   /translation="MSRFPAVAGRAPRRQEEGERPIELQEERPSAVRIADREEKGCTSQ
FT                   EGGTTPTFPIQKQRKKLIQAVRDNSFLIVTGNTGSGKTTQLPKYLYEAGFSQHGMIGVT
FT                   QPRKLEDLMTLQL"
FT   gene            complement(8584729..8639617)
FT                   /gene="Ypel2"
FT                   /locus_tag="mCG_4238"
FT                   /note="gene_id=mCG4238.1"
FT   mRNA            complement(join(8584729..8586308,8590201..8590309,
FT                   8591561..8591604,8617687..8618000,8639475..8639617))
FT                   /gene="Ypel2"
FT                   /locus_tag="mCG_4238"
FT                   /product="yippee-like 2 (Drosophila)"
FT                   /note="gene_id=mCG4238.1 transcript_id=mCT2984.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(8586219..8586308,8590201..8590309,
FT                   8591561..8591604,8617687..8617803))
FT                   /codon_start=1
FT                   /gene="Ypel2"
FT                   /locus_tag="mCG_4238"
FT                   /product="yippee-like 2 (Drosophila)"
FT                   /note="gene_id=mCG4238.1 transcript_id=mCT2984.2
FT                   protein_id=mCP9359.2"
FT                   /db_xref="GOA:Q0VA86"
FT                   /db_xref="InterPro:IPR004910"
FT                   /db_xref="MGI:MGI:1925114"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VA86"
FT                   /protein_id="EDL15802.1"
FT                   /translation="MVKMTRSKTFQAYLPSCHRTYSCIHCRAHLANHDELISKSFQGSQ
FT                   GRAYLFNSVVNVGCGPAEERVLLTGLHAVADIYCENCKTTLGWKYEHAFESSQKYKEGK
FT                   YIIELAHMIKDNGWD"
FT   gene            complement(8679886..8720732)
FT                   /gene="Gdpd1"
FT                   /locus_tag="mCG_4234"
FT                   /note="gene_id=mCG4234.1"
FT   mRNA            complement(join(8679886..8681313,8681610..8681661,
FT                   8683849..8683908,8687894..8688027,8691229..8691318,
FT                   8691858..8691976,8702985..8703030,8705639..8705774,
FT                   8710292..8710334,8720477..8720732))
FT                   /gene="Gdpd1"
FT                   /locus_tag="mCG_4234"
FT                   /product="glycerophosphodiester phosphodiesterase domain
FT                   containing 1"
FT                   /note="gene_id=mCG4234.1 transcript_id=mCT2997.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(8681191..8681313,8681610..8681661,
FT                   8683849..8683908,8687894..8688027,8691229..8691318,
FT                   8691858..8691976,8702985..8703030,8705639..8705774,
FT                   8710292..8710334,8720477..8720618))
FT                   /codon_start=1
FT                   /gene="Gdpd1"
FT                   /locus_tag="mCG_4234"
FT                   /product="glycerophosphodiester phosphodiesterase domain
FT                   containing 1"
FT                   /note="gene_id=mCG4234.1 transcript_id=mCT2997.2
FT                   protein_id=mCP9329.1"
FT                   /protein_id="EDL15803.1"
FT                   /translation="MSSTAAFCLLSTLGGYLVTSFLLLKYPALLHQRKKQRFLSRHISH
FT                   RGGAGENLENTMAAFQHAVTIGTDMLELDCHITKDEQVVVSHDANLKRSTGVNVNVSDL
FT                   KYCELPPYLCKLDVPFQRACKCEGKDTRIPLLKEVFEAFPETPINIDIKVNNNVLIKKV
FT                   SELVKQYKREHLTVWGNANSEIVDKCYKENSDIPILFSLQRVLLILGLFFTGLLPFVPI
FT                   REQFFEIPMPSIILKLKEPHTISKGHKFLIWLSDTLLMRKALFDHLTARGIQVYVWVLN
FT                   EEYEYKRAFDLGATGVMTDYPTKLKDFLNNFSA"
FT   gene            complement(8720898..8721601)
FT                   /locus_tag="mCG_1032084"
FT                   /note="gene_id=mCG1032084.0"
FT   mRNA            complement(join(8720898..8721047,8721363..8721601))
FT                   /locus_tag="mCG_1032084"
FT                   /product="mCG1032084"
FT                   /note="gene_id=mCG1032084.0 transcript_id=mCT149788.0
FT                   created on 29-MAY-2003"
FT   CDS             complement(8720945..8721013)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032084"
FT                   /product="mCG1032084"
FT                   /note="gene_id=mCG1032084.0 transcript_id=mCT149788.0
FT                   protein_id=mCP85485.1"
FT                   /protein_id="EDL15804.1"
FT                   /translation="MHISQLRQIFPEGYPGLRAFSA"
FT   gene            complement(8724374..>8733209)
FT                   /gene="1200011M11Rik"
FT                   /locus_tag="mCG_129558"
FT                   /note="gene_id=mCG129558.0"
FT   mRNA            complement(join(8724374..8724792,8726808..8727680,
FT                   8730245..8730390,8731828..>8733209))
FT                   /gene="1200011M11Rik"
FT                   /locus_tag="mCG_129558"
FT                   /product="RIKEN cDNA 1200011M11, transcript variant
FT                   mCT130872"
FT                   /note="gene_id=mCG129558.0 transcript_id=mCT130872.0
FT                   created on 16-SEP-2002"
FT   mRNA            complement(join(8724396..8724792,8727467..8727680,
FT                   8730245..8730390,8731828..>8732215))
FT                   /gene="1200011M11Rik"
FT                   /locus_tag="mCG_129558"
FT                   /product="RIKEN cDNA 1200011M11, transcript variant
FT                   mCT191044"
FT                   /note="gene_id=mCG129558.0 transcript_id=mCT191044.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(8724595..8724792,8726808..8727680,
FT                   8730245..8730390,8731828..>8733208))
FT                   /codon_start=1
FT                   /gene="1200011M11Rik"
FT                   /locus_tag="mCG_129558"
FT                   /product="RIKEN cDNA 1200011M11, isoform CRA_b"
FT                   /note="gene_id=mCG129558.0 transcript_id=mCT130872.0
FT                   protein_id=mCP85473.0 isoform=CRA_b"
FT                   /protein_id="EDL15806.1"
FT                   /translation="RAEPGPQDFSLLQAYYNQESKVLYLILTSICDNSQLLRACRALQS
FT                   GEAGGGLSLPHAETHEFWKHQEKLQCLSLLYLFSVCHILLLVHPTCSFDITYDRVFRAL
FT                   DGLRQKVLPLLKTAIKDCPVGKDWKLNCRPCPPRLLFLFQLNGALKVEPPRSQDTAHPD
FT                   KPKKHSPKRRLQHALEDQIYRIFRKSRVLTNQSINCLFTVPANQAFVYIVPGSQEEDPI
FT                   GMLLDQLRSHCTVKDPESLLVPAPLSGPRRYQAMRQHSRQQLSFHIDSSTSSSSGQLVD
FT                   FTLREFLWQHVELVLSKKGFDDSVGRNPQPSHFELPTYQKWISAAAKLYEVAIDGKEED
FT                   LGSPTGELTSKILSSIKVLEGFLDIDTKFSENRCQKALPMAHSAYQSNLPHNYTMTVHK
FT                   NQLAQALRVYSQHARGPAFHKYAMQLHEDCYKFWSNGHQLCEERSLTDQHCVHKFHSLP
FT                   KSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPRDDPFDIKAANYDFYQLLEEKCCG
FT                   KLDHINFPVFEPSTPDPAPAKNEPSPAPPDSDAEKLKEKEPQTQGESTSLSLALSLGQS
FT                   TDSLGTYPADPQAGGDNPEVHGQGEGKSEKRPNLVDRQASTVEYLPGMLHSNCPKGLLP
FT                   KFSSWSLVKLGPAKSYNFHTGLDQQGFVPGTNYLMPWDIVIRTRAEDEGDLDTNSWPAP
FT                   NKAIPGKRSAVVMGRGRRRDDIARAFVGFEYEDSRGRRFMCSGPDKVMKVMGSGPKESA
FT                   LKALNSDMPLYILSSSQGRGLKPHYAQLMRLFVVVPDAPLQIILMPQVQPGPPPCPVFY
FT                   PEKQEITLPPDGLWVLRFPYAYVTERGPCFPPKENVQLMSYKVLRGVLKAVTQ"
FT   CDS             complement(join(8724725..8724792,8727467..8727680,
FT                   8730245..8730390,8731828..>8732215))
FT                   /codon_start=1
FT                   /gene="1200011M11Rik"
FT                   /locus_tag="mCG_129558"
FT                   /product="RIKEN cDNA 1200011M11, isoform CRA_a"
FT                   /note="gene_id=mCG129558.0 transcript_id=mCT191044.0
FT                   protein_id=mCP112002.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q99LS6"
FT                   /db_xref="InterPro:IPR019354"
FT                   /db_xref="InterPro:IPR028802"
FT                   /db_xref="MGI:MGI:1921383"
FT                   /db_xref="UniProtKB/TrEMBL:Q99LS6"
FT                   /protein_id="EDL15805.1"
FT                   /translation="VAIDGKEEDLGSPTGELTSKILSSIKVLEGFLDIDTKFSENRCQK
FT                   ALPMAHSAYQSNLPHNYTMTVHKNQLAQALRVYSQHARGPAFHKYAMQLHEDCYKFWSN
FT                   GHQLCEERSLTDQHCVHKFHSLPKSGEKPEADRNPPVLYHNSRARSTGACNCGRKQAPR
FT                   DDPFDIKAANYDFYQLLEEKCCGKLDHINFPVFEPSTPDPAPAKNEPSPAPPDSDAEKL
FT                   KEKEPQTQGESTSLSLALSLGQSTDSLGSTRPTTMSSILPRKTRNHSPT"
FT   gene            8725429..8725926
FT                   /pseudo
FT                   /locus_tag="mCG_4231"
FT                   /note="gene_id=mCG4231.2"
FT   mRNA            8725429..8725926
FT                   /pseudo
FT                   /locus_tag="mCG_4231"
FT                   /note="gene_id=mCG4231.2 transcript_id=mCT2994.2 created on
FT                   18-OCT-2002"
FT   gene            complement(8736844..8755244)
FT                   /gene="Prr11"
FT                   /locus_tag="mCG_4244"
FT                   /note="gene_id=mCG4244.1"
FT   mRNA            complement(join(8736844..8738545,8743658..8743754,
FT                   8743830..8743889,8745366..8745481,8746078..8746176,
FT                   8747888..8748151,8749695..8749817,8750048..8750198,
FT                   8752560..8752692,8755192..8755244))
FT                   /gene="Prr11"
FT                   /locus_tag="mCG_4244"
FT                   /product="proline rich 11"
FT                   /note="gene_id=mCG4244.1 transcript_id=mCT2980.2 created on
FT                   18-OCT-2002"
FT   CDS             complement(join(8738477..8738545,8743658..8743754,
FT                   8743830..8743889,8745366..8745481,8746078..8746176,
FT                   8747888..8748151,8749695..8749817,8750048..8750198,
FT                   8752560..8752687))
FT                   /codon_start=1
FT                   /gene="Prr11"
FT                   /locus_tag="mCG_4244"
FT                   /product="proline rich 11"
FT                   /note="gene_id=mCG4244.1 transcript_id=mCT2980.2
FT                   protein_id=mCP9349.2"
FT                   /protein_id="EDL15807.1"
FT                   /translation="MPKYKQRRRKLKAKAKRMSKKKEAAVVSPKLLTPSPPLPEPERVV
FT                   TSAADIPQSRNWLRPSWNLRFPNIKDAINLWTNRAWCIYSCCQTCVAQSLEVLKDAFFP
FT                   SRVYHRELHSLKQQLCVLKRELCKLRENLKSISENSSCSSCCHKCCPSDKLTTVPACAP
FT                   TTNGESQTVLSSTQPQPANHPPSPPPLPPPPPPPPPLPPPPPPLAPLLLRKSGTTKALQ
FT                   VEPLKKDGPMHITVKDLLTVKLKKTQSVDERKKLVPSPPEERTPLVTVSDLQHVTLKPN
FT                   SRVSATRIKNVLITPGKSQIDLRKLLRKVQVERSPGGTPLNNKENMDTGTGLTPVMTRA
FT                   LRRKFQLAHPQSPTQSLPLSTSSFDEQN"
FT   gene            8755811..8770876
FT                   /locus_tag="mCG_4232"
FT                   /note="gene_id=mCG4232.2"
FT   mRNA            join(8755811..8755855,8762655..8762741,8764219..8764395,
FT                   8768535..8769575)
FT                   /locus_tag="mCG_4232"
FT                   /product="mCG4232, transcript variant mCT2995"
FT                   /note="gene_id=mCG4232.2 transcript_id=mCT2995.0 created on
FT                   02-AUG-2002"
FT   CDS             join(8755823..8755855,8762655..8762741,8764219..8764395,
FT                   8768535..8768600)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4232"
FT                   /product="mCG4232, isoform CRA_b"
FT                   /note="gene_id=mCG4232.2 transcript_id=mCT2995.0
FT                   protein_id=mCP9327.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CR46"
FT                   /db_xref="InterPro:IPR026762"
FT                   /db_xref="MGI:MGI:1913390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CR46"
FT                   /protein_id="EDL15809.1"
FT                   /translation="MEAEVDKLELMFQKADSDLDYLQYRLEYEVKTNHPHSAGEKNAVT
FT                   VLKELSAIKSRYQALCARFKAVSVEQKETKSCICATLNKTMTMIQELQKQTNLELTLLT
FT                   EEEKAATEPLKSHMPD"
FT   mRNA            join(8755830..8755855,8764219..8764395,8768535..8768800,
FT                   8770858..8770876)
FT                   /locus_tag="mCG_4232"
FT                   /product="mCG4232, transcript variant mCT171272"
FT                   /note="gene_id=mCG4232.2 transcript_id=mCT171272.0 created
FT                   on 02-AUG-2002"
FT   CDS             join(8755853..8755855,8764219..8764395,8768535..8768600)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4232"
FT                   /product="mCG4232, isoform CRA_a"
FT                   /note="gene_id=mCG4232.2 transcript_id=mCT171272.0
FT                   protein_id=mCP94191.0 isoform=CRA_a"
FT                   /protein_id="EDL15808.1"
FT                   /translation="MKNAVTVLKELSAIKSRYQALCARFKAVSVEQKETKSCICATLNK
FT                   TMTMIQELQKQTNLELTLLTEEEKAATEPLKSHMPD"
FT   gene            complement(8768166..>8773508)
FT                   /locus_tag="mCG_145960"
FT                   /note="gene_id=mCG145960.0"
FT   mRNA            complement(join(8768166..8768764,8770334..8770432,
FT                   8773085..>8773508))
FT                   /locus_tag="mCG_145960"
FT                   /product="mCG145960"
FT                   /note="gene_id=mCG145960.0 transcript_id=mCT186068.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(8768443..8768764,8770334..>8770404))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145960"
FT                   /product="mCG145960"
FT                   /note="gene_id=mCG145960.0 transcript_id=mCT186068.0
FT                   protein_id=mCP107515.0"
FT                   /protein_id="EDL15810.1"
FT                   /translation="DPVLKNKRRLKKWLSTCCSSRRPSHRTSTLLTISSSEMHHDPLGQ
FT                   GKCQASSSAPPLDVSPNLCSWSSFHQPSSLTFFISPAYEILMALLQLSLLQSVELARKT
FT                   NNKMFISKPSKVVKRVKFCFIAQTFS"
FT   gene            8773707..8897264
FT                   /gene="Trim37"
FT                   /locus_tag="mCG_4236"
FT                   /note="gene_id=mCG4236.1"
FT   mRNA            join(8773707..8773979,8774023..8774095,8776317..8776418,
FT                   8784053..8784093,8786948..8787064,8789591..8789678,
FT                   8791928..8792050,8793399..8793522,8795685..8795752,
FT                   8806153..8806277,8810164..8810214,8812947..8813028,
FT                   8813785..8813861,8824194..8824373,8828767..8828881,
FT                   8831255..8831473,8832750..8832886,8836445..8836530,
FT                   8843194..8843388,8847691..8847999,8852320..8852442,
FT                   8853151..8853340,8856156..8856274,8862824..8862934,
FT                   8864640..8864718,8896979..8897264)
FT                   /gene="Trim37"
FT                   /locus_tag="mCG_4236"
FT                   /product="tripartite motif protein 37"
FT                   /note="gene_id=mCG4236.1 transcript_id=mCT2982.2 created on
FT                   16-SEP-2002"
FT   CDS             join(8773909..8773979,8774023..8774095,8776317..8776418,
FT                   8784053..8784093,8786948..8787064,8789591..8789678,
FT                   8791928..8792050,8793399..8793522,8795685..8795752,
FT                   8806153..8806277,8810164..8810214,8812947..8813028,
FT                   8813785..8813861,8824194..8824373,8828767..8828881,
FT                   8831255..8831473,8832750..8832886,8836445..8836530,
FT                   8843194..8843388,8847691..8847999,8852320..8852442,
FT                   8853151..8853340,8856156..8856274,8862824..8862934,
FT                   8864640..8864718,8896979..8897123)
FT                   /codon_start=1
FT                   /gene="Trim37"
FT                   /locus_tag="mCG_4236"
FT                   /product="tripartite motif protein 37"
FT                   /note="gene_id=mCG4236.1 transcript_id=mCT2982.2
FT                   protein_id=mCP9344.2"
FT                   /protein_id="EDL15811.1"
FT                   /translation="MRGSRWGTRRDGARRWHCCGSLLSADTDSEGRRGPRREPEAMDEQ
FT                   SVESIAEVFRCFICMEKLRDARLCPHCSKLCCFSCIRRWLTEQRAQCPHCRAPLQLREL
FT                   VNCRWAEEVTQQLDTLQLCSLTKHEENEKDKCENHHEKLSVFCWTCKKCICHQCALWGG
FT                   MHGGHTFKPLAEIYEQHVTKVNEEVAKLRRRLMELISLVQEVERNVEAVRNAKDERVRE
FT                   IRNAVEMMIARLDTQLKNKLITLMGQKTSLTQETELLESLLQEVEHQLRSCSKSELISK
FT                   SSEILMMFQQVHRKPMASFVTTPVPPDFTSELVPSYDSATFVLENFSTLRQRADPVYSP
FT                   PLQVSGLCWRLKVYPDGNGVVRGYYLSVFLELSAGLPETSKYEYRVEMVHQSCNDPTKN
FT                   IIREFASDFEVGECWGYNRFFRLDLLANEGYLNRQNDTVILRFQVRSPTFFQKCRDQHW
FT                   YITQLEAAQTGYIQQINNLKERLTIELSRTQKSRDLSPPDNHLSPQNDDSPETRTKKAG
FT                   SCSDMLLEGGPTCASVRETKEDEDEEEKIQNEDYHHELSDGDLDLDLVGEDEVNHLDGS
FT                   SSSASSTATSNTEENDIDEETMSGENDVEYNSMELEEGELMEDAAAAGPPGSSHSYVGA
FT                   SSRMSRRTHLCSAATSSLLDIDPLILIHLLDLKDRSSMENLWGLQPRPSASLLQPTASY
FT                   SRKDKDQRKQQAMWRVPSDLKMLKRLKTQMAEVRCMKTDVKTTLSDIKGSSVASTDMQT
FT                   NLFCADQAALTTCGPENSGRLQDLGMELLAKSSVAGCYIRNPTNKKNSPKSARAIAGSL
FT                   SLRRAVDSGENSRSKGDCQVLAEGSSGSSQSGSRHSSPRALTHGIIGDLLPKSEDRQCK
FT                   ALDSDAVVVAVFNGLPTVEKRRKMVTLGTNAKGGRLEGMQMADLESHSEAGEVQPTLPE
FT                   GASAAPEEGMSSDSDIECDTENEEQEEHTSMGAFNDPFLAQPPDEDSHSSFPDGEQIDP
FT                   ENLHFNPDEGGGRLLVLGTQQPYCEEVQTSQPGETACTGSHGYELRPLAPANSHHQLSD
FT                   V"
FT   gene            complement(9003825..9005643)
FT                   /locus_tag="mCG_1031972"
FT                   /note="gene_id=mCG1031972.1"
FT   mRNA            complement(9003825..9005643)
FT                   /locus_tag="mCG_1031972"
FT                   /product="mCG1031972"
FT                   /note="gene_id=mCG1031972.1 transcript_id=mCT149676.1
FT                   created on 23-APR-2003"
FT   CDS             complement(9005042..9005497)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031972"
FT                   /product="mCG1031972"
FT                   /note="gene_id=mCG1031972.1 transcript_id=mCT149676.1
FT                   protein_id=mCP85425.1"
FT                   /protein_id="EDL15812.1"
FT                   /translation="MAGCIPEEKTYRRFLELFLGEFRGPCGGGEPEPEPESEPEPEPEA
FT                   ELVAAEAAEASGEEPGEDAATVEATEEGEQDQDPEPEDEAVEEETATEGEEEEEEEAAA
FT                   PGHSAVPPPPQPQLPPLPPLPRPLSERITREEVEGESLDLCLQQLYK"
FT   gene            complement(9024976..>9051376)
FT                   /gene="Rad51c"
FT                   /locus_tag="mCG_4235"
FT                   /note="gene_id=mCG4235.3"
FT   mRNA            complement(join(9024976..9025909,9027254..9027314,
FT                   9035041..9035101,9036256..9036322,9041687..9041818,
FT                   9044045..9044178,9047812..9047978,9049020..9049278,
FT                   9050726..>9050843))
FT                   /gene="Rad51c"
FT                   /locus_tag="mCG_4235"
FT                   /product="Rad51 homolog c (S. cerevisiae), transcript
FT                   variant mCT2987"
FT                   /note="gene_id=mCG4235.3 transcript_id=mCT2987.2 created on
FT                   02-AUG-2002"
FT   mRNA            complement(join(9024979..9025909,9027254..9027314,
FT                   9035041..9035101,9036256..9036322,9041687..9041818,
FT                   9044045..9044178,9047812..9047978,9049020..9049278,
FT                   9051017..>9051376))
FT                   /gene="Rad51c"
FT                   /locus_tag="mCG_4235"
FT                   /product="Rad51 homolog c (S. cerevisiae), transcript
FT                   variant mCT191032"
FT                   /note="gene_id=mCG4235.3 transcript_id=mCT191032.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(9025808..9025909,9027254..9027314,
FT                   9035041..9035101,9036256..9036322,9041687..9041818,
FT                   9044045..9044178,9047812..9047978,9049020..9049278,
FT                   9051017..>9051194))
FT                   /codon_start=1
FT                   /gene="Rad51c"
FT                   /locus_tag="mCG_4235"
FT                   /product="Rad51 homolog c (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG4235.3 transcript_id=mCT191032.0
FT                   protein_id=mCP111989.0 isoform=CRA_a"
FT                   /protein_id="EDL15813.1"
FT                   /translation="GNMLYRVHLAWLPSPRLRPLFLFLCSLSGYIRNVTRTSETRRQPY
FT                   MKPVCGISSAAARPQVGISKEEALETLQILRRECLTNKPRCAGTSVANEKCTALELLEQ
FT                   EHTQGFIITFCSALDNILGGGIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPECFGGVA
FT                   GEAVFIDTEGSFMVDRVVSLATACIQHLHLIAGTHTEEEHQKALKDFTLENILSHIYYF
FT                   RCHDYTELLAQVYLLPDFLSDHPKVQLVIIDGIAFPFRHDLEDLSLRTRLLNGLAQQMI
FT                   SLANNHRLAVILTNQMTTKIDKNQALLVPALGESWGHAATIRLIFHWEQKQRFATLYKS
FT                   PSQKESTIPFQITPQGFRDAVVTAASSQTESSLNFRKRSREPEEEC"
FT   CDS             complement(join(9025808..9025909,9027254..9027314,
FT                   9035041..9035101,9036256..9036322,9041687..9041818,
FT                   9044045..9044178,9047812..9047978,9049020..9049278,
FT                   9050726..9050843))
FT                   /codon_start=1
FT                   /gene="Rad51c"
FT                   /locus_tag="mCG_4235"
FT                   /product="Rad51 homolog c (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG4235.3 transcript_id=mCT2987.2
FT                   protein_id=mCP9323.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q924H5"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:2150020"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q924H5"
FT                   /protein_id="EDL15814.1"
FT                   /translation="MQRELVGYPLSPAVRGKLVAAGFQTAEDVLEVKPSELSKEVGISK
FT                   EEALETLQILRRECLTNKPRCAGTSVANEKCTALELLEQEHTQGFIITFCSALDNILGG
FT                   GIPLMKTTEVCGVPGVGKTQLCMQLAVDVQIPECFGGVAGEAVFIDTEGSFMVDRVVSL
FT                   ATACIQHLHLIAGTHTEEEHQKALKDFTLENILSHIYYFRCHDYTELLAQVYLLPDFLS
FT                   DHPKVQLVIIDGIAFPFRHDLEDLSLRTRLLNGLAQQMISLANNHRLAVILTNQMTTKI
FT                   DKNQALLVPALGESWGHAATIRLIFHWEQKQRFATLYKSPSQKESTIPFQITPQGFRDA
FT                   VVTAASSQTESSLNFRKRSREPEEEC"
FT   gene            9053339..>9124742
FT                   /locus_tag="mCG_147533"
FT                   /note="gene_id=mCG147533.0"
FT   mRNA            join(9053339..9053359,9073636..9073772,9114380..9114494,
FT                   9124676..>9124742)
FT                   /locus_tag="mCG_147533"
FT                   /product="mCG147533"
FT                   /note="gene_id=mCG147533.0 transcript_id=mCT187796.0
FT                   created on 13-JAN-2004"
FT   CDS             join(9073637..9073772,9114380..9114494,9124676..>9124742)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147533"
FT                   /product="mCG147533"
FT                   /note="gene_id=mCG147533.0 transcript_id=mCT187796.0
FT                   protein_id=mCP109299.0"
FT                   /protein_id="EDL15815.1"
FT                   /translation="MSRGAPFPVPCPVLLGTFTDDSLEAQLHEYAKQGNCVKLKKILKK
FT                   GVCVDAVNTQGQSALFVAALLGHVKLVDVLVDYGSDPNHRCFDGSTPVHAAAFSGNQWI
FT                   LS"
FT   gene            9099981..9100404
FT                   /locus_tag="mCG_1032085"
FT                   /note="gene_id=mCG1032085.0"
FT   mRNA            join(9099981..9100203,9100239..9100404)
FT                   /locus_tag="mCG_1032085"
FT                   /product="mCG1032085"
FT                   /note="gene_id=mCG1032085.0 transcript_id=mCT149789.0
FT                   created on 24-MAR-2003"
FT   CDS             join(9100032..9100203,9100239..9100342)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032085"
FT                   /product="mCG1032085"
FT                   /note="gene_id=mCG1032085.0 transcript_id=mCT149789.0
FT                   protein_id=mCP85491.1"
FT                   /protein_id="EDL15816.1"
FT                   /translation="MSILKKWVWEGYKERVWCRYSNSGLARLRLLGRFSDSFSATNITN
FT                   TWQWASSVGTHMGSRSGQSIVHLYFSKSVKLVLLTMTSILPISGLL"
FT   gene            9126254..9195725
FT                   /gene="Tex14"
FT                   /locus_tag="mCG_4239"
FT                   /note="gene_id=mCG4239.1"
FT   mRNA            join(9126254..9126357,9133012..9133093,9134924..9135054,
FT                   9136172..9136285,9137802..9137925,9139458..9139636,
FT                   9149471..9149622,9151328..9151518,9152036..9152186,
FT                   9153845..9154764,9156571..9156677,9159558..9159640,
FT                   9160541..9160822,9162398..9162498,9167747..9167813,
FT                   9172250..9172331,9173442..9173504,9175436..9175563,
FT                   9176598..9176803,9178469..9178565,9178899..9178973,
FT                   9182393..9182470,9183187..9183280,9189335..9189427,
FT                   9191434..9191543,9194831..9194882,9195387..9195725)
FT                   /gene="Tex14"
FT                   /locus_tag="mCG_4239"
FT                   /product="testis expressed gene 14"
FT                   /note="gene_id=mCG4239.1 transcript_id=mCT2985.1 created on
FT                   05-AUG-2002"
FT   CDS             join(9134942..9135054,9136172..9136285,9137802..9137925,
FT                   9139458..9139636,9149471..9149622,9151328..9151518,
FT                   9152036..9152186,9153845..9154764,9156571..9156677,
FT                   9159558..9159640,9160541..9160822,9162398..9162498,
FT                   9167747..9167813,9172250..9172331,9173442..9173504,
FT                   9175436..9175563,9176598..9176803,9178469..9178565,
FT                   9178899..9178973,9182393..9182470,9183187..9183280,
FT                   9189335..9189427,9191434..9191543,9194831..9194882,
FT                   9195387..9195423)
FT                   /codon_start=1
FT                   /gene="Tex14"
FT                   /locus_tag="mCG_4239"
FT                   /product="testis expressed gene 14"
FT                   /note="gene_id=mCG4239.1 transcript_id=mCT2985.1
FT                   protein_id=mCP9334.2"
FT                   /protein_id="EDL15817.1"
FT                   /translation="MQLTYPGSLPVIGEKEVVQADDEPTFSFFSGPYMVMTNLVWNRSR
FT                   VTVKELNLPTRPHCSRLRLADLLIAEQEHSSNLRHPNLLQLMAVCLSRDLEKIRLVYER
FT                   ITVGTLFSVLHERRSQFPVLHMEVIVHLLLQVADALIYLHSRGFIHRSLSSYAVHIVSA
FT                   GEARLTNLEYLTESQDSGAHRNVTRMPLPTQLYNWAAPEVVLQKAATVKSDIYSFSVII
FT                   QEILTDSIPWNGLDGSLVKETIALGNYLEADVRLPEPYYDIVKSGIHAKQKNRTMNLQD
FT                   IRYILKNDLKEFIGAQKTQPTESPRGQSYEPHPDVNICLGLTSEYQKDPPDLDIKELKE
FT                   MGSQPHSPTDHSFLTVKPTLAPQTLDSSLSAQKPDNANVPSPPAACLAEEVRSPTASQD
FT                   SLCSFEINEIYSGCLTLGTDKEEECLGTAASPEGDRPNQGDELPSLEEELDKMERELHC
FT                   FCEEDKSISEVDTDLLFEDDDWQSDSLGSLNLPEPTREAKGKTSSWSKTDEYVSKCVLN
FT                   LKISQVMMQQSAEWLRKLEQEVEELEWAQKELDSQCSSLRDASLKFANAKFQPAVGPPS
FT                   LAYLPPVMQLPGLKQPENGGTWLTLARSPGNEREFQEGHFSKKPEKLSACGWKPFTQVS
FT                   EESRGDCSELNNQLPTLRGPGKQSTGEQLPSTQEARESLEKNTNQNSRSMASVSSEIYA
FT                   TKSRNNEDNGEAHLKWRLAVKEMAEKAVSGQLLLPPWNPQSSAPFESKVENESTPLPRP
FT                   PIRGPESTEWQHILEYQRENDEPKGNTKFGKMDNSDCDKNKHSRWTGLQRFTGIRYPFF
FT                   RNHEQPEQNEASQASCDTSVGTEKFYSTSSPIGDDFERFQDSFAQRQGYVEENFQIREI
FT                   FEKNAEILTKPQFQAIQCAEDKQDETLGETPKELKEKNTSLTDIQDLSSITYDQDGYFK
FT                   ETSYKTPKLKHAPTSASTPLSPESISSAASHYEDCLENTTFHVKRGSTFCWNGQEAMRT
FT                   LSAKFTTVRERAKSLESLLASSKSLPAKLTDSKRLCMLSETGSSNVSAAFVTSTHATKR
FT                   KSLPRELAEATSQQHLDELPPPAQELLDEIEQLKQQQVSSLASHENTARDLSVTNKDKK
FT                   HLEEQETNSSKDSSFLSSREIQDLEDTERAHSSLDEDLERFLQSPEENTALLDPTKGST
FT                   REKKNKDQDVVEQKRKKKESIKPERRESDSSLGTLEEDELKPCFWKRLGWSEPSRIIVL
FT                   DQSDLSD"
FT   gene            9218355..9230420
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /note="gene_id=mCG4230.2"
FT   mRNA            join(9218355..9218388,9228849..9228966,9229056..9229157,
FT                   9229349..9229445,9229537..9229699,9229837..9229936,
FT                   9230197..9230418)
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, transcript variant mCT171453"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT171453.0 created
FT                   on 06-AUG-2002"
FT   mRNA            join(9218382..9218421,9223785..9223895,9224280..9224366,
FT                   9224999..9225122,9228599..9228733,9228849..9228930,
FT                   9229050..9229157,9229349..9229445,9229537..9229699,
FT                   9229837..9229936,9230197..9230418)
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, transcript variant mCT171452"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT171452.0 created
FT                   on 06-AUG-2002"
FT   mRNA            join(<9218831..9218931,9223802..9223895,9224280..9224366,
FT                   9224999..9225122,9228599..9228733,9228849..9228966,
FT                   9229056..>9229155)
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, transcript variant mCT191025"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT191025.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<9218833..9218931,9223802..9223895,9224280..9224366,
FT                   9224999..9225122,9228599..9228733,9228849..9228966,
FT                   9229056..>9229155)
FT                   /codon_start=1
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, isoform CRA_d"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT191025.0
FT                   protein_id=mCP111987.0 isoform=CRA_d"
FT                   /protein_id="EDL15821.1"
FT                   /translation="WKTQRKSVNTASLTRRDDDRMTHIPWTFLGEEEDDKEYVGFATLP
FT                   NQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITK
FT                   HAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQ
FT                   DNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIRE
FT                   EIEHFGIKIYQFPDCDSDEDEDFKLQDQAL"
FT   mRNA            join(9221034..9221128,9223199..9223495,9223802..9223895,
FT                   9224280..9224366,9224999..9225122,9228599..9228733,
FT                   9228849..9228966,9229056..9229157,9229349..9229445,
FT                   9229537..9229699,9229837..9229936,9230197..9230420)
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, transcript variant mCT2992"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT2992.1 created on
FT                   05-AUG-2002"
FT   CDS             join(9221069..9221128,9223199..9223495,9223802..9223895,
FT                   9224280..9224366,9224999..9225122,9228599..9228733,
FT                   9228849..9228966,9229056..9229157,9229349..9229445,
FT                   9229537..9229699,9229837..9229936,9230197..9230256)
FT                   /codon_start=1
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, isoform CRA_e"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT2992.1
FT                   protein_id=mCP9370.1 isoform=CRA_e"
FT                   /db_xref="GOA:P28661"
FT                   /db_xref="InterPro:IPR000038"
FT                   /db_xref="InterPro:IPR016491"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1270156"
FT                   /db_xref="UniProtKB/Swiss-Prot:P28661"
FT                   /protein_id="EDL15822.1"
FT                   /translation="MDHSLGWQGNSVPEDGTEAGIKHFLEDSSDDAELSKFVKDFPGSE
FT                   PYHSAESKTRVARPQILEPRPQSPDLCDDDVEFRGSLWPQPSDSQQYFSAPAPLSPSSR
FT                   PRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNS
FT                   LFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECW
FT                   KPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQR
FT                   VNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKE
FT                   SIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVT
FT                   RETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDPETEKLIREKDE
FT                   ELRRMQEMLHKIQRQMKETH"
FT   mRNA            join(9222110..9222178,9223199..9223495,9223802..9223895,
FT                   9224280..9224366,9224999..9225122,9228599..9228664,
FT                   9228849..9228966,9229056..9229157,9229349..9229445,
FT                   9229537..9229597,9229837..9229936,9230197..9230395)
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, transcript variant mCT171451"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT171451.0 created
FT                   on 06-AUG-2002"
FT   CDS             join(9222149..9222178,9223199..9223495,9223802..9223895,
FT                   9224280..9224366,9224999..9225122,9228599..9228664,
FT                   9228849..9228966,9229056..9229157,9229349..9229445,
FT                   9229537..9229597,9229837..9229936,9230197..9230256)
FT                   /codon_start=1
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, isoform CRA_a"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT171451.0
FT                   protein_id=mCP94371.0 isoform=CRA_a"
FT                   /protein_id="EDL15818.1"
FT                   /translation="MKLMAMGELRIKHFLEDSSDDAELSKFVKDFPGSEPYHSAESKTR
FT                   VARPQILEPRPQSPDLCDDDVEFRGSLWPQPSDSQQYFSAPAPLSPSSRPRSPWGKLDP
FT                   YDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDR
FT                   KLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQ
FT                   FEQYFRDESGLLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFG
FT                   IKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVE
FT                   NPGHCDFVKLRTMLVRTHIKLTRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEM
FT                   LHKIQRQMKETH"
FT   CDS             join(9223886..9223895,9224280..9224366,9224999..9225122,
FT                   9228599..9228733,9228849..9228930,9229050..9229157,
FT                   9229349..9229445,9229537..9229699,9229837..9229936,
FT                   9230197..9230256)
FT                   /codon_start=1
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, isoform CRA_b"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT171452.0
FT                   protein_id=mCP94370.0 isoform=CRA_b"
FT                   /protein_id="EDL15819.1"
FT                   /translation="MVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHA
FT                   VDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDN
FT                   RVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTCQIREEIEHFGIKIYQF
FT                   PDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCD
FT                   FVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPI
FT                   PAVPPGTDPETEKLIREKDEELRRMQEMLHKIQRQMKETH"
FT   CDS             join(9228874..9228966,9229056..9229157,9229349..9229445,
FT                   9229537..9229699,9229837..9229936,9230197..9230256)
FT                   /codon_start=1
FT                   /gene="Sept4"
FT                   /locus_tag="mCG_4230"
FT                   /product="septin 4, isoform CRA_c"
FT                   /note="gene_id=mCG4230.2 transcript_id=mCT171453.0
FT                   protein_id=mCP94372.0 isoform=CRA_c"
FT                   /protein_id="EDL15820.1"
FT                   /translation="MKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQ
FT                   FPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHC
FT                   DFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFP
FT                   IPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQRQMKETH"
FT   gene            9232080..9255059
FT                   /gene="Mtmr4"
FT                   /locus_tag="mCG_4233"
FT                   /note="gene_id=mCG4233.3"
FT   mRNA            join(9232080..9232131,9233281..9233314,9237077..9237166,
FT                   9237496..9237612,9238744..9238826,9240385..9240545,
FT                   9240655..9240751,9240940..9241053,9242289..9242485,
FT                   9242661..9242789,9243269..9243380,9243868..9244063,
FT                   9244299..9244484,9244563..9244733,9244877..9245031,
FT                   9250814..9252197,9253303..9253413,9253653..9253741,
FT                   9253957..9254311)
FT                   /gene="Mtmr4"
FT                   /locus_tag="mCG_4233"
FT                   /product="myotubularin related protein 4, transcript
FT                   variant mCT2996"
FT                   /note="gene_id=mCG4233.3 transcript_id=mCT2996.2 created on
FT                   07-AUG-2002"
FT   mRNA            join(<9232100..9232131,9233270..9233314,9237077..9237166,
FT                   9237496..9237612,9238744..9238826,9240385..9240545,
FT                   9240655..9240751,9240940..9241053,9242289..9242485,
FT                   9242661..9242789,9243269..9243380,9243868..9244063,
FT                   9244299..9244484,9244877..9245031,9250814..9252197,
FT                   9253303..9253413,9253653..9253741,9253957..9255059)
FT                   /gene="Mtmr4"
FT                   /locus_tag="mCG_4233"
FT                   /product="myotubularin related protein 4, transcript
FT                   variant mCT191030"
FT                   /note="gene_id=mCG4233.3 transcript_id=mCT191030.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<9233273..9233314,9237077..9237166,9237496..9237612,
FT                   9238744..9238826,9240385..9240545,9240655..9240751,
FT                   9240940..9241053,9242289..9242485,9242661..9242789,
FT                   9243269..9243380,9243868..9244063,9244299..9244484,
FT                   9244877..9245031,9250814..9252197,9253303..9253413,
FT                   9253653..9253741,9253957..9254134)
FT                   /codon_start=1
FT                   /gene="Mtmr4"
FT                   /locus_tag="mCG_4233"
FT                   /product="myotubularin related protein 4, isoform CRA_a"
FT                   /note="gene_id=mCG4233.3 transcript_id=mCT191030.0
FT                   protein_id=mCP111988.0 isoform=CRA_a"
FT                   /protein_id="EDL15823.1"
FT                   /translation="RAGAGSQDPRQGRMGEEGPPSLEYIQAKDLFPPKELVKEEENLQV
FT                   PFTVLQGEGVEFLGRATDALIAISNYRLHIKFKDSVINVPLRMIDSVESRDMFQLHIAC
FT                   KDSKVVRCHFSTFKQCQEWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHTHLCQ
FT                   PGEHIRCRQEAELARMGFDLQNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELENVAS
FT                   FRSWKRIPVVVYRHLRNGAAIARCSQPEISWWGWRNADDEYLVTSIAKACALDPGTRAS
FT                   GGSLSTGTNDASEACDTDFDSSLTACSGVESTAAPQKLLILDARSYTAAVANRAKGGGC
FT                   ECEEYYPNCEVLFMGMANIHAIRNSFQYLRAVCSQMPDPSNWLSALESTKWLQHLSVML
FT                   KAAVLVANTVDREGRPVLVHCSDGWDRTPQIVALAKILLDPYYRTLEGFQVLVESDWLD
FT                   FGHKFGDRCGHQENAEDQNEQCPVFLQWLDSVHQLLKQFPCLFEFNEAFLVLHPVCHVR
FT                   ALHLWTAVYLPASSPCTLGEENMDLYLSPVAQSQEFSGRSLDRLPKTRSMDDLLSACDT
FT                   SSPLTRTSSDPNLNNHSQEVRGSLEPWHSSPEGAETVIDSGVGSPQLTVGEMGLPPPLP
FT                   SSQKEYLSNKPFKGHKSCSLSYKLLNTSVSWEMKSNTSDIKVLEETEALAPDPSAQEEQ
FT                   GRTSDGLGKPPEQFLEKEAVSSLCSVSSKCGGACDFPEPPQDPLTGTPQQPHLDSMQIS
FT                   PSRCTPDHSQGSLCNPPSVASQTPEPNTDLLSQDPPGSTASISHQEQPSSVPDLIYKKE
FT                   DAGKRGSKNGQLLENPRFGKMPLELARKPISQSQISEFSFLGSNWDSFQGMMTSFPSGE
FT                   TTPRRLLAYGCCSKRPSNKHIRAAGPCLGGQWAQREGMKSPVCSSHSNGHCTGPGGKNN
FT                   RMWFSSHPKQVSSTKPSLLSCPSPVPPLYLDDDGLPFPTDVIQHRLRQIEAGYRQEVEQ
FT                   LRRQVRELQMRLDIRHCCAPPAEPPMDYEDDFTCLKESDGSDTEDFGSDHSEDCLSEAS
FT                   WEPVDKKETEVTRWVPDHMASHCFNCDCEFWLAKRRHHCRNCGNVFCAGCCHLKLPIPD
FT                   QQLYDPVLVCNSCYEHIQVSRARELMSQHLKKPIATASS"
FT   CDS             join(9233312..9233314,9237077..9237166,9237496..9237612,
FT                   9238744..9238826,9240385..9240545,9240655..9240751,
FT                   9240940..9241053,9242289..9242485,9242661..9242789,
FT                   9243269..9243380,9243868..9244063,9244299..9244484,
FT                   9244563..9244733,9244877..9245031,9250814..9252197,
FT                   9253303..9253413,9253653..9253741,9253957..9254134)
FT                   /codon_start=1
FT                   /gene="Mtmr4"
FT                   /locus_tag="mCG_4233"
FT                   /product="myotubularin related protein 4, isoform CRA_b"
FT                   /note="gene_id=mCG4233.3 transcript_id=mCT2996.2
FT                   protein_id=mCP9362.2 isoform=CRA_b"
FT                   /protein_id="EDL15824.1"
FT                   /translation="MGEEGPPSLEYIQAKDLFPPKELVKEEENLQVPFTVLQGEGVEFL
FT                   GRATDALIAISNYRLHIKFKDSVINVPLRMIDSVESRDMFQLHIACKDSKVVRCHFSTF
FT                   KQCQEWLSRLSRATARPAKPEDLFAFAYHAWCLGLTEEDQHTHLCQPGEHIRCRQEAEL
FT                   ARMGFDLQNVWRVSHINSNYKLCPSYPQKLLVPVWITDKELENVASFRSWKRIPVVVYR
FT                   HLRNGAAIARCSQPEISWWGWRNADDEYLVTSIAKACALDPGTRASGGSLSTGTNDASE
FT                   ACDTDFDSSLTACSGVESTAAPQKLLILDARSYTAAVANRAKGGGCECEEYYPNCEVLF
FT                   MGMANIHAIRNSFQYLRAVCSQMPDPSNWLSALESTKWLQHLSVMLKAAVLVANTVDRE
FT                   GRPVLVHCSDGWDRTPQIVALAKILLDPYYRTLEGFQVLVESDWLDFGHKFGDRCGHQE
FT                   NAEDQNEQCPVFLQWLDSVHQLLKQFPCLFEFNEAFLVKLVQHTYSCLYGTFLANNPCE
FT                   REKRNIYKRTCSVWALLRAGNKNFHNFLYTPGSDVVLHPVCHVRALHLWTAVYLPASSP
FT                   CTLGEENMDLYLSPVAQSQEFSGRSLDRLPKTRSMDDLLSACDTSSPLTRTSSDPNLNN
FT                   HSQEVRGSLEPWHSSPEGAETVIDSGVGSPQLTVGEMGLPPPLPSSQKEYLSNKPFKGH
FT                   KSCSLSYKLLNTSVSWEMKSNTSDIKVLEETEALAPDPSAQEEQGRTSDGLGKPPEQFL
FT                   EKEAVSSLCSVSSKCGGACDFPEPPQDPLTGTPQQPHLDSMQISPSRCTPDHSQGSLCN
FT                   PPSVASQTPEPNTDLLSQDPPGSTASISHQEQPSSVPDLIYKKEDAGKRGSKNGQLLEN
FT                   PRFGKMPLELARKPISQSQISEFSFLGSNWDSFQGMMTSFPSGETTPRRLLAYGCCSKR
FT                   PSNKHIRAAGPCLGGQWAQREGMKSPVCSSHSNGHCTGPGGKNNRMWFSSHPKQVSSTK
FT                   PSLLSCPSPVPPLYLDDDGLPFPTDVIQHRLRQIEAGYRQEVEQLRRQVRELQMRLDIR
FT                   HCCAPPAEPPMDYEDDFTCLKESDGSDTEDFGSDHSEDCLSEASWEPVDKKETEVTRWV
FT                   PDHMASHCFNCDCEFWLAKRRHHCRNCGNVFCAGCCHLKLPIPDQQLYDPVLVCNSCYE
FT                   HIQVSRARELMSQHLKKPIATASS"
FT   gene            9275765..9297918
FT                   /locus_tag="mCG_4241"
FT                   /note="gene_id=mCG4241.1"
FT   mRNA            join(9275765..9275938,9277876..9278050,9297103..9297918)
FT                   /locus_tag="mCG_4241"
FT                   /product="mCG4241"
FT                   /note="gene_id=mCG4241.1 transcript_id=mCT2977.1 created on
FT                   18-OCT-2002"
FT   CDS             join(9275819..9275938,9277876..9278050,9297103..9297173)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4241"
FT                   /product="mCG4241"
FT                   /note="gene_id=mCG4241.1 transcript_id=mCT2977.1
FT                   protein_id=mCP9337.2"
FT                   /protein_id="EDL15825.1"
FT                   /translation="MQESATIQQTHVKLKEQLNHNPSPSSVVFVQEGLPFSTPQVDSSI
FT                   KCQTNPSENILPSEQMGFLISEMGPANKSTKDTGLSTPARYRERRSNSQGKSPDLHLLV
FT                   DVACKQEHFPKEEELKE"
FT   gene            9303941..9375610
FT                   /gene="Rnf43"
FT                   /locus_tag="mCG_4242"
FT                   /note="gene_id=mCG4242.1"
FT   mRNA            join(9303941..9304643,9358341..9358463,9367222..9367296,
FT                   9367408..9367539,9368098..9368202,9369472..9369633,
FT                   9370204..9370306,9371099..9372457,9374228..9375610)
FT                   /gene="Rnf43"
FT                   /locus_tag="mCG_4242"
FT                   /product="ring finger protein 43"
FT                   /note="gene_id=mCG4242.1 transcript_id=mCT2978.2 created on
FT                   18-OCT-2002"
FT   CDS             join(9304422..9304643,9358341..9358463,9367222..9367296,
FT                   9367408..9367539,9368098..9368202,9369472..9369633,
FT                   9370204..9370306,9371099..9372457,9374228..9374271)
FT                   /codon_start=1
FT                   /gene="Rnf43"
FT                   /locus_tag="mCG_4242"
FT                   /product="ring finger protein 43"
FT                   /note="gene_id=mCG4242.1 transcript_id=mCT2978.2
FT                   protein_id=mCP9321.2"
FT                   /protein_id="EDL15826.1"
FT                   /translation="MSGGHQLQLAVLWPWLLMATLHAGFGHTGRVLAAAVESERSAEQK
FT                   AVIRVIPLKMDPTGKLNLTLEGVFAGVAESHPLYLCNASDDDNLEPGFISIVKLESPRR
FT                   APRPCLSLASKARMAGERGANAVLFDITEDRSAAEQLQQPLGLTKPVVLIWGSDAAKLM
FT                   EFVYKNRKAYVWIELKEPPAGANYDVWILLTVVGTVFVIILASVLRIRCRPHHSRPDPL
FT                   QQRTARAISQLATRRYQAGCRRARAEWPDSGSSCSSTPVCAICLEEFSEGQELRVISCL
FT                   HEFHRTCVDPWLYQHRTCPLCMFNIVEGDSFSQAPAASPSYQEPGRRLHLIRQHPGHAH
FT                   YHLPSAYLLGPSRTSVARTPRPRPFLPSQEPSMGSRHQRLPRTSHLRAPEEQQHLAVSP
FT                   HPYAQGWGLNRLRCTSQHPAACPVALRRARPHESSGSGESYCTERSGYLADGPASDSSS
FT                   GPCHGSSSDSVVNCTDVSLQGIHGSSSTFRSSLSSDFDPLVYCSPEGDLQGKGIQPSVT
FT                   SRPRSLDSVVPRGETQVSSHIHYHRHRHHHYKRQFQWHGRKPGPETGIPQSMPAASHTQ
FT                   LEPSLPDQQLITPNPTASSMLPNPQRPRALTEPAPGLAEASSPSPSPKPNPSGLLNLQK
FT                   SSLTVRHPHRKRRGGPSEPLPTSLPPDLTVHTACPVFPHYSPRLAYPWPPEVHPLMFRP
FT                   PGPDRRLLHEVPGPCYSSSQPVWLYLNPCQPLGPCLPGEGHSKWTFDSPEGRRCPYSHC
FT                   QVLPAQPGSEEELEELCEQAV"
FT   gene            9341350..9345286
FT                   /locus_tag="mCG_147542"
FT                   /note="gene_id=mCG147542.0"
FT   mRNA            join(9341350..9341601,9344701..9345286)
FT                   /locus_tag="mCG_147542"
FT                   /product="mCG147542"
FT                   /note="gene_id=mCG147542.0 transcript_id=mCT187805.0
FT                   created on 13-JAN-2004"
FT   CDS             9341415..9341561
FT                   /codon_start=1
FT                   /locus_tag="mCG_147542"
FT                   /product="mCG147542"
FT                   /note="gene_id=mCG147542.0 transcript_id=mCT187805.0
FT                   protein_id=mCP109308.0"
FT                   /protein_id="EDL15827.1"
FT                   /translation="MLGIFAHTCAFRMRSHIDTLQAGWAAGPWEAETEAGSDDHGLHAY
FT                   QLF"
FT   gene            9377624..9383700
FT                   /locus_tag="mCG_7669"
FT                   /note="gene_id=mCG7669.2"
FT   mRNA            join(9377624..9377740,9378239..9378345,9380577..9380718,
FT                   9382868..9382923,9383130..9383183,9383318..9383700)
FT                   /locus_tag="mCG_7669"
FT                   /product="mCG7669, transcript variant mCT171455"
FT                   /note="gene_id=mCG7669.2 transcript_id=mCT171455.0 created
FT                   on 07-AUG-2002"
FT   mRNA            join(9377624..9377740,9378239..9378345,9382868..9382923,
FT                   9383130..9383183,9383318..9383689)
FT                   /locus_tag="mCG_7669"
FT                   /product="mCG7669, transcript variant mCT6381"
FT                   /note="gene_id=mCG7669.2 transcript_id=mCT6381.1 created on
FT                   07-AUG-2002"
FT   mRNA            join(9377624..9377740,9378239..9378345,9382780..9382923,
FT                   9383130..9383183,9383318..9383686)
FT                   /locus_tag="mCG_7669"
FT                   /product="mCG7669, transcript variant mCT171454"
FT                   /note="gene_id=mCG7669.2 transcript_id=mCT171454.0 created
FT                   on 07-AUG-2002"
FT   CDS             join(9377672..9377740,9378239..9378345,9382868..9382923,
FT                   9383130..9383183,9383318..9383385)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7669"
FT                   /product="mCG7669, isoform CRA_c"
FT                   /note="gene_id=mCG7669.2 transcript_id=mCT6381.1
FT                   protein_id=mCP9354.1 isoform=CRA_c"
FT                   /db_xref="GOA:P63271"
FT                   /db_xref="InterPro:IPR009287"
FT                   /db_xref="InterPro:IPR016046"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="MGI:MGI:107416"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63271"
FT                   /protein_id="EDL15830.1"
FT                   /translation="MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGN
FT                   REMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSR
FT                   GVAYKSRDTAIKT"
FT   CDS             join(9377672..9377740,9378239..9378345,9382780..9382867)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7669"
FT                   /product="mCG7669, isoform CRA_a"
FT                   /note="gene_id=mCG7669.2 transcript_id=mCT171454.0
FT                   protein_id=mCP94374.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3UVU8"
FT                   /db_xref="InterPro:IPR016046"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="MGI:MGI:107416"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVU8"
FT                   /protein_id="EDL15828.1"
FT                   /translation="MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGN
FT                   REMVYDCTSSSFDGCLARAVALGSCCGPLQQGRLGLTLCLPL"
FT   CDS             join(9377672..9377740,9378239..9378345,9380577..9380715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7669"
FT                   /product="mCG7669, isoform CRA_b"
FT                   /note="gene_id=mCG7669.2 transcript_id=mCT171455.0
FT                   protein_id=mCP94373.0 isoform=CRA_b"
FT                   /db_xref="GOA:D6RHM5"
FT                   /db_xref="InterPro:IPR016046"
FT                   /db_xref="InterPro:IPR022800"
FT                   /db_xref="InterPro:IPR029040"
FT                   /db_xref="MGI:MGI:107416"
FT                   /db_xref="UniProtKB/TrEMBL:D6RHM5"
FT                   /protein_id="EDL15829.1"
FT                   /translation="MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGN
FT                   REMVYDCTSSSFDGRSRLTMNDEAGCVDAAFSPSSQAEQGTQVSGSLLLHHETTPPSKN
FT                   "
FT   gene            9395767..>9397456
FT                   /locus_tag="mCG_147540"
FT                   /note="gene_id=mCG147540.0"
FT   mRNA            join(9395767..9395803,9397228..>9397456)
FT                   /locus_tag="mCG_147540"
FT                   /product="mCG147540"
FT                   /note="gene_id=mCG147540.0 transcript_id=mCT187803.0
FT                   created on 13-JAN-2004"
FT   CDS             9397315..>9397456
FT                   /codon_start=1
FT                   /locus_tag="mCG_147540"
FT                   /product="mCG147540"
FT                   /note="gene_id=mCG147540.0 transcript_id=mCT187803.0
FT                   protein_id=mCP109306.0"
FT                   /protein_id="EDL15831.1"
FT                   /translation="MHVREDMGWGRMCGALVLHRRPTGGSRREPDGWVRVTGPSTLIKN
FT                   GL"
FT   gene            9401753..9425252
FT                   /gene="Bzrap1"
FT                   /locus_tag="mCG_119366"
FT                   /note="gene_id=mCG119366.0"
FT   mRNA            join(9401753..9402109,9402820..9402927,9403164..9403292,
FT                   9403833..9404012,9404571..9404723,9406001..9406078,
FT                   9406166..9406249,9406486..9406575,9406739..9406861,
FT                   9407090..9407194,9410732..9410941,9412011..9412126,
FT                   9412409..9412518,9414870..9415700,9415848..9415999,
FT                   9416311..9416520,9416763..9417002,9417388..9417576,
FT                   9418106..9418945,9419568..9419667,9419765..9419916,
FT                   9420544..9420756,9421223..9421294,9422023..9422094,
FT                   9422286..9422390,9423001..9423051,9425081..9425252)
FT                   /gene="Bzrap1"
FT                   /locus_tag="mCG_119366"
FT                   /product="benzodiazapine receptor associated protein 1"
FT                   /note="gene_id=mCG119366.0 transcript_id=mCT120552.1
FT                   created on 19-JUN-2003"
FT   CDS             join(9401783..9402109,9402820..9402927,9403164..9403292,
FT                   9403833..9404012,9404571..9404723,9406001..9406078,
FT                   9406166..9406249,9406486..9406575,9406739..9406861,
FT                   9407090..9407194,9410732..9410941,9412011..9412126,
FT                   9412409..9412518,9414870..9415700,9415848..9415999,
FT                   9416311..9416520,9416763..9417002,9417388..9417576,
FT                   9418106..9418945,9419568..9419667,9419765..9419916,
FT                   9420544..9420756,9421223..9421294,9422023..9422094,
FT                   9422286..9422390,9423001..9423030)
FT                   /codon_start=1
FT                   /gene="Bzrap1"
FT                   /locus_tag="mCG_119366"
FT                   /product="benzodiazapine receptor associated protein 1"
FT                   /note="gene_id=mCG119366.0 transcript_id=mCT120552.1
FT                   protein_id=mCP85165.1"
FT                   /protein_id="EDL15832.1"
FT                   /translation="MEQLTTLPRLGDLGAMEPWALPAWQHWTQGQGCKPGDASPSIAGT
FT                   PTALQVKGLRFEESSKPEGAHSPGPVGNTDPEATETRLPKLGQQAESPGYSCSGLEEEE
FT                   AQAYKAKFNIGFGDRPNLELLRALGELQQRCTILKEENQMLRKSSFPETEEKVRRLKRK
FT                   NAELAVIAKRLEERAQKLQETNMRVVSAPVPRPGSSLELCRKALARQRARDLSETASAL
FT                   LAKDKQIAALQRECRELQARLSLVGKEGPQWLHMRDFDRLLRESQREVLRLQRQIALRN
FT                   QREPLRPARSPGPTAPSRAVLQDDVESPQVVLREPEKQQRVQQLESELCKKRKKCESLE
FT                   QEARKKQRRCEELELQLRAAQNENARLVEENSRLSGRATEKEQVEWENSELKGQLLGVT
FT                   QERDSALLKSQGLQSKLESLEQVLKHMREVAQRRQQLEVEHEQARLSLQEKQEEVRRLQ
FT                   QTTDPKPIGIFSLDLDLPPGSPGRCTPKSSEPALTTLTGIPRRTAKKAESLSNSSRSES
FT                   IHNSPKSCPTPEVDTASEVEELEVDSVSLLPAAPESHSGGARIQVFLARYSYNPFEGPN
FT                   ENPEAELPLTAGEYIYIYGNMDEDGFFEGELMDGRRGLVPSNFVERVSDDDLLSTLPRE
FT                   LADSSHSSGPELSFLSGGGGGCSSGGQSSGGRSQPRPEEEAAGDELSLSPPPEGLGEPL
FT                   AVPYPRHITVLKQLAHSVVLAWELPPERVDLRGFHIFVNGELRQALGPGVPPKAVLENM
FT                   DLRTGPLHVSVQALTSKGSSDPLRCCLAVGAGAGVVPSQLRIHRLTATSAEIAWVPGNS
FT                   NLAHAIYLNGEECPPARPSTYWATFCNLRPGTLYQARVEAQIPSQGPWEPGWERPEQRA
FT                   ATLQFTTLPAGLPDAPLDVQAEPGPSPGILMISWLPVTIDAAGTSNGVRVTGYAIYADG
FT                   QKIMEVASPTAGSVLVEVSQLQLLQACHEVTVRTMSPHGESSDSIPAPVAPALASACQP
FT                   ARMSCLSPRPSPEEEAGAAVRSISEEKRAIEPTLGQEGPEPVAPSLAKQEVECTSGDAG
FT                   PVPCSTQGELTQKKPSIEACHGGDLDSGLKLRSEKEDMSELGVHLVNSLVDHSRNSDLS
FT                   DIQEEEEEEEEEEEELGSRPCSSQKQVAGNSIRENGAKPQPDPFCETDSDEEILEQILE
FT                   LPLQRLCSKKLFSIPEEEEEEEEEEGLEKPGPSRTSQDPSQPELSLLGPGCDSSQPQGP
FT                   GLCPLSPELSGVREHLEDVLGVVGGNGRRRGGGSPEKLPNRKRPQDPREHCSRLLGNGG
FT                   PQASARPVPPRERGSLPVIEGTRVGQEPGGRGRPGLSRRCPRGPAPESSLVSCLSPKCL
FT                   EISIEYDSEDEQEAGSGGVSINSSCYPTDGEAWGTAAVGRPRGPPKVNPGPNAYLRLPA
FT                   WEKGEPERRGRSAIGRTKEPPSRATETGESRGQDNSGRRGPQRRGARVPRSGTTELAPP
FT                   RSPQEAPPHQDLPVRVFVALFDYDPVSMSPNPDAGEEELPFKEGQLLKVFGDKDADGFY
FT                   RGESGGRTGYIPCNMVAEVAVDSPAGRQQLLQRGFLPPNVLTEASGMTLQLFLTRYHSA
FT                   LEMVPLYTPQHTHPGLPPSLVGPRKAELPFRAGDVITVFGNMDDDGFYYGELNGQRGLV
FT                   PSNFLEGPGPESGSLESGTSQAESQRTRRRRVQC"
FT   gene            9433880..9444671
FT                   /gene="Mpo"
FT                   /locus_tag="mCG_119373"
FT                   /note="gene_id=mCG119373.0"
FT   mRNA            join(9433880..9434374,9434791..9434868,9435028..9435121,
FT                   9435450..9435625,9436059..9436182,9436278..9436407,
FT                   9436491..9436697,9437570..9437888,9440129..9440289,
FT                   9441308..9441563,9441859..9442029,9442790..9443027,
FT                   9443672..9443883,9444599..9444671)
FT                   /gene="Mpo"
FT                   /locus_tag="mCG_119373"
FT                   /product="myeloperoxidase"
FT                   /note="gene_id=mCG119373.0 transcript_id=mCT120543.0
FT                   created on 07-AUG-2002"
FT   CDS             join(9434793..9434868,9435028..9435121,9435450..9435625,
FT                   9436059..9436182,9436278..9436407,9436491..9436697,
FT                   9437570..9437888,9440129..9440289,9441308..9441563,
FT                   9441859..9442029,9442790..9443027,9443672..9443876)
FT                   /codon_start=1
FT                   /gene="Mpo"
FT                   /locus_tag="mCG_119373"
FT                   /product="myeloperoxidase"
FT                   /note="gene_id=mCG119373.0 transcript_id=mCT120543.0
FT                   protein_id=mCP85307.1"
FT                   /db_xref="GOA:Q6RFG4"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR029609"
FT                   /db_xref="MGI:MGI:97137"
FT                   /db_xref="UniProtKB/TrEMBL:Q6RFG4"
FT                   /protein_id="EDL15833.1"
FT                   /translation="MKLLLALAGLLAPLAMLQTSNGATPALLGEVENSVVLSCMEEAKQ
FT                   LVDRAYKERRESIKRSLQSGSASPTELLFYFKQPVAGTRTAVRAADYLHVALDLLKRKL
FT                   QPLWPRPFNVTDVLTPAQLNLLSVSSGCAYQDVGVTCPPNDKYRTITGHCNNRRSPTLG
FT                   ASNRAFVRWLPAEYEDGVSMPFGWTPGVNRNGFKVPLARQVSNAIVRFPNDQLTKDQER
FT                   ALMFMQWGQFLDHDITLTPEPATRFSFFTGLNCETSCLQQPPCFPLKIPPNDPRIKNQK
FT                   DCIPFFRSCPACTRNNITIRNQINALTSFVDASGVYGSEDPLARKLRNLTNQLGLLAVN
FT                   TRFQDNGRALMPFDSLHDDPCLLTNRSARIPCFLAGDMRSSEMPELTSMHTLFVREHNR
FT                   LATQLKRLNPRWNGEKLYQEARKIVGAMVQIITYRDYLPLVLGPAAMKKYLPQYRSYND
FT                   SVDPRIANVFTNAFRYGHTLIQPFMFRLNNQYRPTGPNPRVPLSKVFFASWRVVLEGGI
FT                   DPILRGLMATPAKLNRQNQIVVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYNAW
FT                   RRFCGLPQPSTVGELGTVLKNLELARKLMAQYGTPNNIDIWMGGVSEPLEPNGRVGQLL
FT                   ACLIGTQFRKLRDGDRFWWENPGVFSKQQRQALASISLPRIICDNTGITTVSKNNIFMS
FT                   NTYPRDFVSCNTLPKLNLTSWKET"
FT   gene            complement(9446710..9466116)
FT                   /gene="Lpo"
FT                   /locus_tag="mCG_7676"
FT                   /note="gene_id=mCG7676.1"
FT   mRNA            complement(join(9446710..9447342,9447531..9447768,
FT                   9449420..9449593,9450409..9450661,9454313..9454473,
FT                   9454962..9455286,9456471..9456677,9457359..9457488,
FT                   9457795..9457912,9458453..9458607,9461124..9461211,
FT                   9462257..9462334,9465746..9466116))
FT                   /gene="Lpo"
FT                   /locus_tag="mCG_7676"
FT                   /product="lactoperoxidase"
FT                   /note="gene_id=mCG7676.1 transcript_id=mCT6372.2 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(9447135..9447342,9447531..9447768,
FT                   9449420..9449593,9450409..9450661,9454313..9454473,
FT                   9454962..9455286,9456471..9456677,9457359..9457488,
FT                   9457795..9457912,9458453..9458607,9461124..9461211,
FT                   9462257..9462332))
FT                   /codon_start=1
FT                   /gene="Lpo"
FT                   /locus_tag="mCG_7676"
FT                   /product="lactoperoxidase"
FT                   /note="gene_id=mCG7676.1 transcript_id=mCT6372.2
FT                   protein_id=mCP9345.1"
FT                   /db_xref="GOA:Q91WA0"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019791"
FT                   /db_xref="InterPro:IPR029587"
FT                   /db_xref="MGI:MGI:1923363"
FT                   /db_xref="UniProtKB/TrEMBL:Q91WA0"
FT                   /protein_id="EDL15834.1"
FT                   /translation="MKVLLHLPALLASLTLLQTAASASDDPTAETDIIHDTVEEVKVWV
FT                   NKAFLDSRDRLKMAMTTKIHSTRHLSDYLKHAKGRTRTAIRSGQVWEESLKKLSQFLTN
FT                   VTGQGLDLTSLSWEAGCDPPAPTMTCNISSPYRTITGYCNNRKNPALGSANRALARWLP
FT                   AEYEDGLSLPYGWTPGKMRNGFPLPQPREVSNQIAAYLNEEDVLDQKRSMLFMQWGQIV
FT                   DHDMDFAPETEMGSDTYTKAQCDEHCIQGDNCFPIMFPPGDPKLKTQGKCMPFFRAGFV
FT                   CPTPPYKSLAREQINALTSFLDASLVYSPEPSLANRLRNLSSPLGLMAVNEEVSDNGRP
FT                   FPPFVKMKPSPCEVINATAGVPCFLAGDSRASEQILLATSHTLFIREHNRLATELSRLN
FT                   PHWDGETLYQEARKIMGAFIQITTFRDYLPILLGDEMQKWIPPYQGYNESVDPRISNVF
FT                   TFALRFGHLEIPSTVSRLDENYQPWGSESELPLHTVFFNTWRLVKDGGIDPLVRGLLAK
FT                   NAKLMHQNKMMTGELRNKLFQPNHTIHGFDLASINIQRSRDHGQPGYNSWRAFCGLSQP
FT                   KTLEELSAVMKNEVLAKKLMDLYGTPSNIDIWLGAVAEPLVHRGRVGPLLTCLLGQQFQ
FT                   RIRDGDRFWWENPGVFTEKQRESLQKMSFSRLVCDNTGIDKVPLNPFQANAYPHGFVDC
FT                   SSIDKLDLSPWASVKE"
FT   gene            9500165..>9509990
FT                   /locus_tag="mCG_7664"
FT                   /note="gene_id=mCG7664.2"
FT   mRNA            join(9500165..9500250,9500688..9500797,9501930..9502000,
FT                   9502424..9502579,9503517..9503614,9503762..9503890,
FT                   9504147..9504251,9504824..9504941,9505566..9505626,
FT                   9507041..9507106,9507679..9507749,9508075..9508144,
FT                   9508234..9508341,9508950..9509083,9509533..9509615,
FT                   9509706..9509803,9509902..>9509990)
FT                   /locus_tag="mCG_7664"
FT                   /product="mCG7664"
FT                   /note="gene_id=mCG7664.2 transcript_id=mCT6386.2 created on
FT                   19-JUN-2003"
FT   CDS             join(9500746..9500797,9501930..9502000,9502424..9502579,
FT                   9503517..9503614,9503762..9503890,9504147..9504251,
FT                   9504824..9504941,9505566..9505626,9507041..9507106,
FT                   9507679..9507749,9508075..9508144,9508234..9508341,
FT                   9508950..9509083,9509533..9509615,9509706..9509803,
FT                   9509902..9509990)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7664"
FT                   /product="mCG7664"
FT                   /note="gene_id=mCG7664.2 transcript_id=mCT6386.2
FT                   protein_id=mCP9342.2"
FT                   /protein_id="EDL15835.1"
FT                   /translation="MGKDLIDLATFRPPQAASGHRPDEEEEEEVVIGWQEKLFSQFEVD
FT                   LYQNESACQSPLDHQYRQEILKLENSGGRKNRRIFTYTDSDRYTDLEEYCQKITTSASE
FT                   VPSFLAERMANVRRRRQDRRGVEGSKLKSRIVTWEPSEDFIRNNHAINTPLQTMYIMAD
FT                   LGPYGKLGYKVHEHVLCILKVDSNGVITVKPDFTGIKGPYRIETEGEKQEHTSAWKYTI
FT                   DNVSSLAQPEEEEREQRVFKDLYGRHKEYLSSLVGTDFEMVVSAQGYEYDNLYVHFFVE
FT                   LPAANWSSPPFQQLSGVTQACATKSLGMDKVAYFSFPFTFEAFFLHEDESAESLPEWPV
FT                   LYCKVLSLDFWQRYRVEGYGAVVLPATPGSHTLTVSTWRPMELGLVAELRRFFIGGSLE
FT                   LEDPSYVRIPGTFKGERLSRFGFRTETTGTVTFRLHCLQQSRAFMESNSLRKQMRSVLD
FT                   RLEGFSQQSSTHNVLEAFRRARRRMQEARESLPQDLVSPTGTLT"
FT   gene            complement(9510967..9522505)
FT                   /gene="Epx"
FT                   /locus_tag="mCG_7667"
FT                   /note="gene_id=mCG7667.1"
FT   mRNA            complement(join(9510967..9511370,9511661..9511873,
FT                   9512371..9512608,9515554..9515724,9516250..9516505,
FT                   9516824..9516984,9518311..9518629,9519562..9519768,
FT                   9521246..9521375,9521460..9521577,9521754..9521929,
FT                   9522094..9522187,9522309..9522505))
FT                   /gene="Epx"
FT                   /locus_tag="mCG_7667"
FT                   /product="eosinophil peroxidase"
FT                   /note="gene_id=mCG7667.1 transcript_id=mCT6379.0 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(9511672..9511873,9512371..9512608,
FT                   9515554..9515724,9516250..9516505,9516824..9516984,
FT                   9518311..9518629,9519562..9519768,9521246..9521375,
FT                   9521460..9521577,9521754..9521929,9522094..9522187,
FT                   9522309..9522387))
FT                   /codon_start=1
FT                   /gene="Epx"
FT                   /locus_tag="mCG_7667"
FT                   /product="eosinophil peroxidase"
FT                   /note="gene_id=mCG7667.1 transcript_id=mCT6379.0
FT                   protein_id=mCP9343.1"
FT                   /protein_id="EDL15836.1"
FT                   /translation="MMQQLLALVGALATLILTQHAEGTAPASPSPVEISVLRDCIAEAK
FT                   LLVDTAYNRTQKSITQRLRSGSASPMDLLAYFKQPVAATRRVVQAADYMHVALGLLEER
FT                   LQPRGSRPFNATDVLTEPQLRLLSQASGCALQDQAERCSNKYRTITGRCNNKKHPWLGA
FT                   SNQALARWLPAEYEDHRSLPFGWTPGKRRNGFLLPLVRDVSNQIVRFPSKKLTSDRGRA
FT                   LMFMQWGQFIDHDLDFSPESPARVAFSMGVDCEKTCAQLPPCFPIKIPRNDPRIKNQRD
FT                   CIPFFRSAPACPQNRNKVRNQINALTSFVDASMVYGSEVTLALRLRNRTNFLGLLATNQ
FT                   RFQDNGRALLPFDNLHEDPCLLTNRSARIPCFLAGDTRSSETPKLTALHTLFVREHNRL
FT                   AAELRRLNPHWSGDKLYNEARKIVGAMVQIITYRDFLPLVLGRARIRRTLGPYRGYCSN
FT                   VDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSVFFASWRIIHEGGID
FT                   PILRGLMATPAKLNRQDSMLVDELRDKLFQQVRRIGLDLAALNMQRSRDHGLPGYNAWR
FT                   RFCGLSQPRNLAQLSRVLKNQDLARKFLRLYKTPDNIDIWVGAIAEPLLPGARVGPLLA
FT                   CLFENQFRRARDGDRFWWQKWGVFTKRQRKALRRISLSRIVCDNTGITTVSRDIFRANI
FT                   YPQGFVSCSRIPKLNLSAWRGK"
FT   gene            complement(<9554181..9555140)
FT                   /gene="Olfr464"
FT                   /locus_tag="mCG_56194"
FT                   /note="gene_id=mCG56194.2"
FT   mRNA            complement(<9554181..9555140)
FT                   /gene="Olfr464"
FT                   /locus_tag="mCG_56194"
FT                   /product="olfactory receptor 464"
FT                   /note="gene_id=mCG56194.2 transcript_id=mCT56377.2 created
FT                   on 11-NOV-2002"
FT   CDS             complement(9554181..9555122)
FT                   /codon_start=1
FT                   /gene="Olfr464"
FT                   /locus_tag="mCG_56194"
FT                   /product="olfactory receptor 464"
FT                   /note="gene_id=mCG56194.2 transcript_id=mCT56377.2
FT                   protein_id=mCP31484.2"
FT                   /db_xref="GOA:Q7TRV3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TRV3"
FT                   /protein_id="EDL15837.1"
FT                   /translation="MEPQNITWVSEFILLGFSQTQELQKLLFVVFLCVYITTVVGNILI
FT                   MITVTFDPRLDMPMYFLLRNLAVIDLSYSTVTSPKMLVDFFHKTKTISYQGCMAQIFFF
FT                   HLLGGGTVFFLSVMAYDRYIAISRPLHYVTIMNTKLCVGLVVASWVGGFAHSIVQLSLM
FT                   LPLPFCGPNVLDNFYCDVPQVLRLACTDTSLLEFLMISNSGMLVLIWFLLLLISYTVIL
FT                   VMLRSHSGQARRKAASTCTTHIIVVSMIFIPCIYIYSRPFTPFPLDKAVSISYTVLTPM
FT                   LNPMIYTLRNQEMQAAMKRLAEHLVLTKRNEL"
FT   gene            complement(9627998..9646765)
FT                   /gene="Dynll2"
FT                   /locus_tag="mCG_7675"
FT                   /note="gene_id=mCG7675.3"
FT   mRNA            complement(join(9627998..9630040,9632337..9632475,
FT                   9646680..9646765))
FT                   /gene="Dynll2"
FT                   /locus_tag="mCG_7675"
FT                   /product="dynein light chain LC8-type 2, transcript variant
FT                   mCT171458"
FT                   /note="gene_id=mCG7675.3 transcript_id=mCT171458.1 created
FT                   on 21-JUL-2003"
FT   mRNA            complement(join(9627998..9630040,9632337..9632475,
FT                   9635693..9635945))
FT                   /gene="Dynll2"
FT                   /locus_tag="mCG_7675"
FT                   /product="dynein light chain LC8-type 2, transcript variant
FT                   mCT6376"
FT                   /note="gene_id=mCG7675.3 transcript_id=mCT6376.3 created on
FT                   21-JUL-2003"
FT   mRNA            complement(join(9627998..9630040,9632337..9632475,
FT                   9634778..9635035))
FT                   /gene="Dynll2"
FT                   /locus_tag="mCG_7675"
FT                   /product="dynein light chain LC8-type 2, transcript variant
FT                   mCT171459"
FT                   /note="gene_id=mCG7675.3 transcript_id=mCT171459.2 created
FT                   on 21-JUL-2003"
FT   CDS             complement(join(9629903..9630040,9632337..9632468))
FT                   /codon_start=1
FT                   /gene="Dynll2"
FT                   /locus_tag="mCG_7675"
FT                   /product="dynein light chain LC8-type 2, isoform CRA_a"
FT                   /note="gene_id=mCG7675.3 transcript_id=mCT171458.1
FT                   protein_id=mCP94377.0 isoform=CRA_a"
FT                   /protein_id="EDL15838.1"
FT                   /translation="MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKE
FT                   FDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG"
FT   CDS             complement(join(9629903..9630040,9632337..9632468))
FT                   /codon_start=1
FT                   /gene="Dynll2"
FT                   /locus_tag="mCG_7675"
FT                   /product="dynein light chain LC8-type 2, isoform CRA_a"
FT                   /note="gene_id=mCG7675.3 transcript_id=mCT171459.2
FT                   protein_id=mCP94378.2 isoform=CRA_a"
FT                   /protein_id="EDL15839.1"
FT                   /translation="MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKE
FT                   FDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG"
FT   CDS             complement(join(9629903..9630040,9632337..9632468))
FT                   /codon_start=1
FT                   /gene="Dynll2"
FT                   /locus_tag="mCG_7675"
FT                   /product="dynein light chain LC8-type 2, isoform CRA_a"
FT                   /note="gene_id=mCG7675.3 transcript_id=mCT6376.3
FT                   protein_id=mCP9366.2 isoform=CRA_a"
FT                   /protein_id="EDL15840.1"
FT                   /translation="MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKE
FT                   FDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG"
FT   gene            <9719485..9728991
FT                   /gene="Vezf1"
FT                   /locus_tag="mCG_7665"
FT                   /note="gene_id=mCG7665.2"
FT   mRNA            join(<9719485..9720179,9721090..9721153,9722619..9722802,
FT                   9724840..9724992,9727833..9728991)
FT                   /gene="Vezf1"
FT                   /locus_tag="mCG_7665"
FT                   /product="vascular endothelial zinc finger 1"
FT                   /note="gene_id=mCG7665.2 transcript_id=mCT6387.2 created on
FT                   07-AUG-2002"
FT   CDS             join(<9719485..9720179,9721090..9721153,9722619..9722802,
FT                   9724840..9724992,9727833..9728260)
FT                   /codon_start=1
FT                   /gene="Vezf1"
FT                   /locus_tag="mCG_7665"
FT                   /product="vascular endothelial zinc finger 1"
FT                   /note="gene_id=mCG7665.2 transcript_id=mCT6387.2
FT                   protein_id=mCP9341.1"
FT                   /protein_id="EDL15841.1"
FT                   /translation="AHEASHHQQQAAQNSLLPLLSSAVEPPDQKPLLPIPITQKPQAAP
FT                   ETLKDAIGIKKEKPKTSFVCTYCSKAFRDSYHLRRHQSCHTGIKLVSRAKKTPTTVVPL
FT                   ISTIAGDSSRTSLVSTIAGILSTVTTSSSGTNPSSSASTTSMPVPQSVKKPSKPVKKNH
FT                   ACEMCGKAFRDVYHLNRHKLSHSDEKPFECPICNQRFKRKDRMTYHVRSHEGGITKPYT
FT                   CSVCGKGFSRPDHLSCHVKHVHSTERPFKCQTCTAAFATKDRLRTHMVRHEGKVSCNIC
FT                   GKLLSAAYITSHLKTHGQSQSINCNTCKQGISKTCMSEETSNQKQQQQQQQQQQQQQQQ
FT                   HVTSWPGKQVETLRLWEEAVKARKKEAANLCQTSTAATTPVTLTTPFNITSSVSSGTMS
FT                   NPVTVAAAMSMRSPVNVSSAVNITSPMNIGHPVTITSPLAMTSPLTLTTPVNLPTPVTA
FT                   PVNIAHPVTITSPMNLPTPMTLAAPLNIAMRPVESMPFLPQALPTSPPW"
FT   gene            9745806..9841148
FT                   /gene="Cuedc1"
FT                   /locus_tag="mCG_7677"
FT                   /note="gene_id=mCG7677.2"
FT   mRNA            join(9745806..9745845,9816818..9817427,9822413..9822540,
FT                   9826699..9826815,9831651..9831777,9832409..9832601,
FT                   9835412..9835483,9836361..9836482,9837126..9837219,
FT                   9840815..9841148)
FT                   /gene="Cuedc1"
FT                   /locus_tag="mCG_7677"
FT                   /product="CUE domain containing 1"
FT                   /note="gene_id=mCG7677.2 transcript_id=mCT6378.2 created on
FT                   18-OCT-2002"
FT   CDS             join(9817086..9817427,9822413..9822540,9826699..9826815,
FT                   9831651..9831777,9832409..9832601,9835412..9835483,
FT                   9836361..9836482,9837126..9837219,9840815..9840849)
FT                   /codon_start=1
FT                   /gene="Cuedc1"
FT                   /locus_tag="mCG_7677"
FT                   /product="CUE domain containing 1"
FT                   /note="gene_id=mCG7677.2 transcript_id=mCT6378.2
FT                   protein_id=mCP9367.2"
FT                   /protein_id="EDL15842.1"
FT                   /translation="MTSLFRRSSSGSGGGGATGARGAGTGAGDGSTAPQELNNSRPARQ
FT                   VRRLEFNQAMDDFKTMFPNMDYDIIECVLRANSGAVDATIDQLLQMNLEAGGGSAYEDS
FT                   SDSEDSIPPEILERTLEPDSSEEEPPPVYSPPAYHMHVFDRPYLMAPPTPPPRTLEPDS
FT                   SEEEPPPVYSPPAYHMHVFDRPYLMAPPTPPPRIDVPGSGQPASQRRYRNWNPPLLGSL
FT                   PDDFLRILPQQMDSIQGHPGGSKPMSGEGGPPPAPGPMACDQDSRWKQYLEDERIALFL
FT                   QNEEFMKELQRNRDFLLALERGTSETNPTVSEDALFRDKLKHMGKSTRRKLFELARAFS
FT                   EKTKMRKSKKKHLPKLQSYPSAWPWGGNSFPEQSGRLGAAASTANLLDDVEGHAYGEAG
FT                   ASSFTLPEML"
FT   gene            9852555..9859650
FT                   /gene="Mrps23"
FT                   /locus_tag="mCG_7673"
FT                   /note="gene_id=mCG7673.2"
FT   mRNA            join(9852555..9852624,9853328..9853498,9857998..9858075,
FT                   9858250..9858376,9858796..9859650)
FT                   /gene="Mrps23"
FT                   /locus_tag="mCG_7673"
FT                   /product="mitochondrial ribosomal protein S23, transcript
FT                   variant mCT6374"
FT                   /note="gene_id=mCG7673.2 transcript_id=mCT6374.2 created on
FT                   07-AUG-2002"
FT   mRNA            join(9852566..9852719,9853328..9853498,9857998..9858075,
FT                   9858250..9858376,9858796..9859650)
FT                   /gene="Mrps23"
FT                   /locus_tag="mCG_7673"
FT                   /product="mitochondrial ribosomal protein S23, transcript
FT                   variant mCT171457"
FT                   /note="gene_id=mCG7673.2 transcript_id=mCT171457.0 created
FT                   on 07-AUG-2002"
FT   CDS             join(9852581..9852624,9853328..9853498,9857998..9858075,
FT                   9858250..9858376,9858796..9858909)
FT                   /codon_start=1
FT                   /gene="Mrps23"
FT                   /locus_tag="mCG_7673"
FT                   /product="mitochondrial ribosomal protein S23, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG7673.2 transcript_id=mCT6374.2
FT                   protein_id=mCP9361.2 isoform=CRA_a"
FT                   /protein_id="EDL15843.1"
FT                   /translation="MAGSRLETVGSVFSRTRDLMRAGVLKEKPLWYDIYKAFPPLREPV
FT                   FRRPRLRYGKAKADIQDIFYQEDQIRAKFFATYGSGQKAFDLFNPNFKSTCQRFVEKYT
FT                   ELQNLGETDEEKLFVETGKALLAEGIILRRVREARTVSVRLQASSEGHEPQEDDDLAQR
FT                   GQVKQEPETAPSPP"
FT   CDS             join(9853341..9853498,9857998..9858075,9858250..9858376,
FT                   9858796..9858909)
FT                   /codon_start=1
FT                   /gene="Mrps23"
FT                   /locus_tag="mCG_7673"
FT                   /product="mitochondrial ribosomal protein S23, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG7673.2 transcript_id=mCT171457.0
FT                   protein_id=mCP94376.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TI14"
FT                   /db_xref="InterPro:IPR019520"
FT                   /db_xref="InterPro:IPR023611"
FT                   /db_xref="MGI:MGI:1928138"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TI14"
FT                   /protein_id="EDL15844.1"
FT                   /translation="MRAGVLKEKPLWYDIYKAFPPLREPVFRRPRLRYGKAKADIQDIF
FT                   YQEDQIRAKFFATYGSGQKAFDLFNPNFKSTCQRFVEKYTELQNLGETDEEKLFVETGK
FT                   ALLAEGIILRRVREARTVSVRLQASSEGHEPQEDDDLAQRGQVKQEPETAPSPP"
FT   gene            9943885..9944522
FT                   /locus_tag="mCG_48631"
FT                   /note="gene_id=mCG48631.2"
FT   mRNA            9943885..9944522
FT                   /locus_tag="mCG_48631"
FT                   /product="mCG48631"
FT                   /note="gene_id=mCG48631.2 transcript_id=mCT48814.2 created
FT                   on 16-SEP-2002"
FT   CDS             9943924..9944382
FT                   /codon_start=1
FT                   /locus_tag="mCG_48631"
FT                   /product="mCG48631"
FT                   /note="gene_id=mCG48631.2 transcript_id=mCT48814.2
FT                   protein_id=mCP31500.1"
FT                   /protein_id="EDL15845.1"
FT                   /translation="MEALFQAGSILMKVNTLQGKKMVESGLQSGDLSLSQSWPSYLPLP
FT                   ADLEILQQKVAGVQRELEDFKEEALKAIRYLEDAFCQMSGVLAQQEEQAARVKQRLREE
FT                   EDRGIVRNKVLTFLLPREKQLREHCQRLENMLVRSHNPLRAIRKSQAD"
FT   gene            complement(9998595..>10372030)
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /note="gene_id=mCG48633.2"
FT   mRNA            complement(join(9998595..10001571,10003973..10004045,
FT                   10005703..10005857,10023710..10023772,10042880..10042954,
FT                   10051390..10051504,10071036..10071118,10137665..10137713,
FT                   10247323..10247415,10367044..10367085,10371167..10371251,
FT                   10371941..>10372030))
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), transcript
FT                   variant mCT191046"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT191046.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(9998595..10001571,10003973..10004045,
FT                   10005703..10005911,10023710..10023772,10042880..10042954,
FT                   10051390..10051504,10071036..10071118,10137665..10137713,
FT                   10247323..10247415,10367044..10367085,10371167..10371251,
FT                   10371941..10372030))
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), transcript
FT                   variant mCT174521"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT174521.0 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(9998595..10001571,10003973..10004045,
FT                   10005703..10005857,10023710..10023772,10042880..10042954,
FT                   10051390..10051504,10071036..10071118,10137665..10137713,
FT                   10247323..10247415,10328998..10329258))
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), transcript
FT                   variant mCT185579"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT185579.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(10004004..10004045,10005703..10005857,
FT                   10023710..10023772,10042880..10042954,10051390..10051504,
FT                   10071036..10071118,10137665..10137713,10247323..10247415,
FT                   10367044..10367085,10371167..10371251,10371941..>10372029))
FT                   /codon_start=1
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT191046.0
FT                   protein_id=mCP112014.0 isoform=CRA_c"
FT                   /protein_id="EDL15848.1"
FT                   /translation="STDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDK
FT                   VLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKV
FT                   EDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPG
FT                   TRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAA
FT                   AAVAAARGSGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYISAASPQPGSGFGHG
FT                   IAGPLIATAFTNGYH"
FT   CDS             complement(join(10004004..10004045,10005703..10005911,
FT                   10023710..10023772,10042880..10042954,10051390..10051504,
FT                   10071036..10071118,10137665..10137713,10247323..10247415,
FT                   10367044..10367085,10371167..10371251,10371941..10371975))
FT                   /codon_start=1
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT174521.0
FT                   protein_id=mCP97440.0 isoform=CRA_a"
FT                   /protein_id="EDL15846.1"
FT                   /translation="MVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKV
FT                   AFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGFG
FT                   FVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMDAFMLG
FT                   MGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSVLNSYSAQP
FT                   NFGAPASPAGSNPARPGGFPGANSPGPVADLYGPASQDSGVGNYISAASPQPGSGFGHG
FT                   IAGPLIATAFTNGYH"
FT   CDS             complement(join(10004004..10004045,10005703..10005857,
FT                   10023710..10023772,10042880..10042954,10051390..10051504,
FT                   10071036..10071118,10137665..10137713,10247323..10247415))
FT                   /codon_start=1
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), isoform CRA_e"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT185579.0
FT                   protein_id=mCP106837.0 isoform=CRA_e"
FT                   /protein_id="EDL15850.1"
FT                   /translation="MVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNR
FT                   HRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPGTRGRARGLPYTMD
FT                   AFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAAAAVAAARGSGSNP
FT                   ARPGGFPGANSPGPVADLYGPASQDSGVGNYISAASPQPGSGFGHGIAGPLIATAFTNG
FT                   YH"
FT   gene            <10013185..10020872
FT                   /locus_tag="mCG_145249"
FT                   /note="gene_id=mCG145249.0"
FT   mRNA            join(<10013185..10013340,10014820..10015010,
FT                   10019655..10020872)
FT                   /locus_tag="mCG_145249"
FT                   /product="mCG145249"
FT                   /note="gene_id=mCG145249.0 transcript_id=mCT184673.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<10014885..10015010,10019655..10019855)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145249"
FT                   /product="mCG145249"
FT                   /note="gene_id=mCG145249.0 transcript_id=mCT184673.0
FT                   protein_id=mCP105665.0"
FT                   /protein_id="EDL15852.1"
FT                   /translation="SEPDKGNERWTSRKDEGRGCREGNRVRTDILRVGVDDNLSLKGPV
FT                   SLQGSRRSWAQRSLADGLQNKKRSVALVKNSVGKRRTRKNRVVPSNSGSPCFHYGEHGS
FT                   HWAG"
FT   mRNA            complement(join(10022440..10023772,10042880..10042954,
FT                   10051390..10051504,10071036..10071118,10137665..10137713,
FT                   10247323..10247415,10367044..10367085,10371167..10371251,
FT                   10371941..>10372030))
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), transcript
FT                   variant mCT191047"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT191047.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(10023651..10023772,10042880..10042954,
FT                   10051390..10051504,10071036..10071118,10137665..10137713,
FT                   10247323..10247415,10367044..10367085,10371167..10371251,
FT                   10371941..>10372029))
FT                   /codon_start=1
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT191047.0
FT                   protein_id=mCP112015.0 isoform=CRA_d"
FT                   /protein_id="EDL15849.1"
FT                   /translation="STDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDK
FT                   VLGQPHHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKV
FT                   EDAMLMFDKTTNRHRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKAQPKEVMFPPG
FT                   TRGRARGLPYTMDAFMLGMGMLGYPNFVATYGRGYPGFAPSYGYQFPGFPAAAYGPVAA
FT                   AAVAAARGSGRKVYGAGGSQACLVCRGR"
FT   gene            10053321..10055390
FT                   /locus_tag="mCG_1050992"
FT                   /note="gene_id=mCG1050992.0"
FT   mRNA            join(10053321..10053402,10053501..10054135,
FT                   10054330..10055390)
FT                   /locus_tag="mCG_1050992"
FT                   /product="mCG1050992"
FT                   /note="gene_id=mCG1050992.0 transcript_id=mCT194781.0
FT                   created on 27-JAN-2005"
FT   CDS             10055196..10055372
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050992"
FT                   /product="mCG1050992"
FT                   /note="gene_id=mCG1050992.0 transcript_id=mCT194781.0
FT                   protein_id=mCP115810.0"
FT                   /protein_id="EDL15853.1"
FT                   /translation="MAQQLRAFVLSKNLGSIPSTPTVTHNHQITPVPGDSTLYSDLHKY
FT                   WTYTQAKSFIYIQ"
FT   mRNA            complement(join(10135617..10137713,10247323..10247415,
FT                   10367044..10367085,10371167..10371251,10371941..10372030))
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), transcript
FT                   variant mCT185580"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT185580.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(10137540..10137713,10247323..10247415,
FT                   10367044..10367085,10371167..10371251,10371941..10371975))
FT                   /codon_start=1
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT185580.0
FT                   protein_id=mCP106838.0 isoform=CRA_b"
FT                   /protein_id="EDL15847.1"
FT                   /translation="MVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKV
FT                   AFPRRAQPKMVTRTKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNRHRGKM
FT                   ARRKRMTLPPLLGFSPPIPLTQCTRKMQKPASRLCIAQ"
FT   mRNA            complement(join(10340600..10340725,10342102..10342198,
FT                   10342527..10342598,10367044..10367085,10371167..10371251,
FT                   10371941..10372030))
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), transcript
FT                   variant mCT48816"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT48816.1 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(10342106..10342198,10342527..10342598,
FT                   10367044..10367085,10371167..10371251,10371941..10371975))
FT                   /codon_start=1
FT                   /gene="Msi2"
FT                   /locus_tag="mCG_48633"
FT                   /product="Musashi homolog 2 (Drosophila), isoform CRA_f"
FT                   /note="gene_id=mCG48633.2 transcript_id=mCT48816.1
FT                   protein_id=mCP31471.2 isoform=CRA_f"
FT                   /protein_id="EDL15851.1"
FT                   /translation="MVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELDSKTIDPKV
FT                   AFPRRAQPKSQEQGGSWKRTWTTVQARAASGDQKKVGLSDSAALFPALPVPPRPGRRGF
FT                   RGAF"
FT   gene            10373403..10383748
FT                   /locus_tag="mCG_117183"
FT                   /note="gene_id=mCG117183.1"
FT   mRNA            join(10373403..10373625,10375014..10375180,
FT                   10382719..10382818,10383337..10383748)
FT                   /locus_tag="mCG_117183"
FT                   /product="mCG117183"
FT                   /note="gene_id=mCG117183.1 transcript_id=mCT118319.1
FT                   created on 16-SEP-2002"
FT   gene            complement(10379421..10379972)
FT                   /locus_tag="mCG_3370"
FT                   /note="gene_id=mCG3370.0"
FT   mRNA            complement(10379421..10379972)
FT                   /locus_tag="mCG_3370"
FT                   /product="mCG3370"
FT                   /note="gene_id=mCG3370.0 transcript_id=mCT2308.0 created on
FT                   18-OCT-2002"
FT   CDS             complement(10379478..10379918)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3370"
FT                   /product="mCG3370"
FT                   /note="gene_id=mCG3370.0 transcript_id=mCT2308.0
FT                   protein_id=mCP9347.1"
FT                   /protein_id="EDL15855.1"
FT                   /translation="MLSKGPLQSVQVFGRKKTATAEAHCKRGNGLIKVNGRPLEMIEPR
FT                   TLQYKLLEPVLLLGKERFAGVDIRVRVKGGGHVAQIYAIRQSISKALVAYYQKYVDEAS
FT                   KKEIKDILIHYDRTLLVADPRRCESKKFGGPGARARYQKSYR"
FT   CDS             join(10382770..10382818,10383337..10383452)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117183"
FT                   /product="mCG117183"
FT                   /note="gene_id=mCG117183.1 transcript_id=mCT118319.1
FT                   protein_id=mCP85061.1"
FT                   /protein_id="EDL15854.1"
FT                   /translation="MTLLSHLQFKMTASSQATNSVLMKGAGLPEENSFAFQLHLETVDM
FT                   ALPSLKPLH"
FT   gene            complement(10488094..10508754)
FT                   /gene="Akap1"
FT                   /locus_tag="mCG_3369"
FT                   /note="gene_id=mCG3369.2"
FT   mRNA            complement(join(10488094..10489018,10489497..10489559,
FT                   10490331..10490404,10491851..10491918,10492272..10492422,
FT                   10494203..10494380,10496116..10496243,10496813..10496939,
FT                   10498360..10498493,10501472..10503078,10508589..10508754))
FT                   /gene="Akap1"
FT                   /locus_tag="mCG_3369"
FT                   /product="A kinase (PRKA) anchor protein 1, transcript
FT                   variant mCT2298"
FT                   /note="gene_id=mCG3369.2 transcript_id=mCT2298.2 created on
FT                   07-AUG-2002"
FT   mRNA            complement(join(10488094..10489018,10489497..10489559,
FT                   10490331..10490404,10491851..10491918,10492272..10492422,
FT                   10494203..10494380,10496116..10496243,10496813..10496939,
FT                   10498360..10498493,10500803..10500909,10501472..10503078,
FT                   10508589..10508754))
FT                   /gene="Akap1"
FT                   /locus_tag="mCG_3369"
FT                   /product="A kinase (PRKA) anchor protein 1, transcript
FT                   variant mCT171450"
FT                   /note="gene_id=mCG3369.2 transcript_id=mCT171450.0 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(10488944..10489018,10489497..10489559,
FT                   10490331..10490404,10491851..10491918,10492272..10492422,
FT                   10494203..10494380,10496116..10496243,10496813..10496939,
FT                   10498360..10498493,10501472..10503047))
FT                   /codon_start=1
FT                   /gene="Akap1"
FT                   /locus_tag="mCG_3369"
FT                   /product="A kinase (PRKA) anchor protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG3369.2 transcript_id=mCT2298.2
FT                   protein_id=mCP9340.2 isoform=CRA_b"
FT                   /protein_id="EDL15857.1"
FT                   /translation="MAIQLRSLFPLALPGMLALLGWWWFFSRKKDRLSSSDKQVETLKV
FT                   GPAIKDRRLSEEACPGVLSVAPTVTQPPGREEQRSVDKPSTEPLALPRTRQVRRRSESS
FT                   GNLPSVADTRSQPGPCRDEIAKVELSLMGDKAKSIPLGCPLLPKDASFPYEAVERCKQE
FT                   SALGKTPGRGWPSPYAASGEKARETGGTEGTGDAVLGENVSEEGLLSQECVSEVEKSEF
FT                   PILAPGGGEGEEVSHGPPQVAELLKKEEYIVGKLPSSFVEPVHSEPVKDEDALEPQVKG
FT                   SSNTSDRDLAGELDKDETVPENDQIKQAAFQLISQVILEATEELRATTVGKTVAQVHPI
FT                   SATQPKGKEESCVPASQETSLGQDTSDPASTRTGATASPSAEALPPKTYVSCLSSPLSG
FT                   PTKDQKPKNSAHHISLAPCPPPVTPQRQSLEGASNPRGDDNFVACMANNSQSVLSVSSL
FT                   GQCSDPVSTSGLEDSCTETISSSGDKAMTPPLPVSTQPFSNGVLKEELSDLGTEDGWTM
FT                   DTEADHSGGSDGNSMDSVDSCCGLTKPDSPQSVQAGSNPKKVDLIIWEIEVPKHLVGRL
FT                   IGKQGRYVSFLKQTSGAKIYISTLPYTQNIQICHIEGSQHHVDKALNLIGKKFKELNLT
FT                   NIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLD
FT                   QQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWWRAQVVASYEETNEVEIRYVDYGGY
FT                   KRVKVDVLRQIRSDFVTLPFQGAEVLLDSVVPLSDDDHFSPEADAAMSEMTGNTALLAQ
FT                   VTSYSATGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYASL"
FT   CDS             complement(join(10500842..10500909,10501472..10503047))
FT                   /codon_start=1
FT                   /gene="Akap1"
FT                   /locus_tag="mCG_3369"
FT                   /product="A kinase (PRKA) anchor protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG3369.2 transcript_id=mCT171450.0
FT                   protein_id=mCP94369.0 isoform=CRA_a"
FT                   /protein_id="EDL15856.1"
FT                   /translation="MAIQLRSLFPLALPGMLALLGWWWFFSRKKDRLSSSDKQVETLKV
FT                   GPAIKDRRLSEEACPGVLSVAPTVTQPPGREEQRSVDKPSTEPLALPRTRQVRRRSESS
FT                   GNLPSVADTRSQPGPCRDEIAKVELSLMGDKAKSIPLGCPLLPKDASFPYEAVERCKQE
FT                   SALGKTPGRGWPSPYAASGEKARETGGTEGTGDAVLGENVSEEGLLSQECVSEVEKSEF
FT                   PILAPGGGEGEEVSHGPPQVAELLKKEEYIVGKLPSSFVEPVHSEPVKDEDALEPQVKG
FT                   SSNTSDRDLAGELDKDETVPENDQIKQAAFQLISQVILEATEELRATTVGKTVAQVHPI
FT                   SATQPKGKEESCVPASQETSLGQDTSDPASTRTGATASPSAEALPPKTYVSCLSSPLSG
FT                   PTKDQKPKNSAHHISLAPCPPPVTPQRQSLEGASNPRGDDNFVACMANNSQSVLSVSSL
FT                   GQCSDPVSTSGLEDSCTETISSSGDKAMTPPLPVSTQPFSNGVLKEELSDLGTEDGWTM
FT                   DTEADHSGVAAPPQERGHFGNGGCTGFFEC"
FT   gene            10508852..10538729
FT                   /locus_tag="mCG_65172"
FT                   /note="gene_id=mCG65172.1"
FT   mRNA            join(10508852..10509086,10509451..10509530,
FT                   10516334..10516706,10537061..10537170,10538489..10538729)
FT                   /locus_tag="mCG_65172"
FT                   /product="mCG65172"
FT                   /note="gene_id=mCG65172.1 transcript_id=mCT65355.1 created
FT                   on 16-SEP-2002"
FT   CDS             10538573..10538719
FT                   /codon_start=1
FT                   /locus_tag="mCG_65172"
FT                   /product="mCG65172"
FT                   /note="gene_id=mCG65172.1 transcript_id=mCT65355.1
FT                   protein_id=mCP35269.2"
FT                   /protein_id="EDL15858.1"
FT                   /translation="MSTTMLIQRYLEQRPHHSAVPRMLIADLSCPLSTHHPRCVSCLLL
FT                   TKQ"
FT   gene            10566773..10591333
FT                   /locus_tag="mCG_1050994"
FT                   /note="gene_id=mCG1050994.0"
FT   mRNA            join(10566773..10566890,10567320..10567514,
FT                   10583353..10583545,10587706..10587809,10591137..10591333)
FT                   /locus_tag="mCG_1050994"
FT                   /product="mCG1050994"
FT                   /note="gene_id=mCG1050994.0 transcript_id=mCT194783.0
FT                   created on 27-JAN-2005"
FT   CDS             join(10567397..10567514,10583353..10583366)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050994"
FT                   /product="mCG1050994"
FT                   /note="gene_id=mCG1050994.0 transcript_id=mCT194783.0
FT                   protein_id=mCP115812.0"
FT                   /protein_id="EDL15859.1"
FT                   /translation="MGGCEPPCGFRDLNSGPSEEQSVLLPAEPSRQSKTTFSKGQIH"
FT   gene            complement(10579634..10612740)
FT                   /gene="Scpep1"
FT                   /locus_tag="mCG_1482"
FT                   /note="gene_id=mCG1482.1"
FT   mRNA            complement(join(10579634..10580338,10584695..10584858,
FT                   10585649..10585786,10588700..10588813,10589854..10589947,
FT                   10591099..10591227,10592179..10592216,10596403..10596475,
FT                   10598884..10598958,10599459..10599614,10602105..10602194,
FT                   10609729..10609877,10612592..10612740))
FT                   /gene="Scpep1"
FT                   /locus_tag="mCG_1482"
FT                   /product="serine carboxypeptidase 1, transcript variant
FT                   mCT8135"
FT                   /note="gene_id=mCG1482.1 transcript_id=mCT8135.1 created on
FT                   16-SEP-2002"
FT   mRNA            complement(join(10579637..10580140,10591209..10591227,
FT                   10592179..10592216,10596403..10596475,10598884..10598958,
FT                   10599459..10599614,10602105..10602194,10609729..10609877,
FT                   10612592..10612714))
FT                   /gene="Scpep1"
FT                   /locus_tag="mCG_1482"
FT                   /product="serine carboxypeptidase 1, transcript variant
FT                   mCT173332"
FT                   /note="gene_id=mCG1482.1 transcript_id=mCT173332.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(10580085..10580140,10591209..10591227,
FT                   10592179..10592216,10596403..10596475,10598884..10598958,
FT                   10599459..10599614,10602105..10602194,10609729..10609877,
FT                   10612592..10612667))
FT                   /codon_start=1
FT                   /gene="Scpep1"
FT                   /locus_tag="mCG_1482"
FT                   /product="serine carboxypeptidase 1, isoform CRA_a"
FT                   /note="gene_id=mCG1482.1 transcript_id=mCT173332.0
FT                   protein_id=mCP96251.0 isoform=CRA_a"
FT                   /protein_id="EDL15860.1"
FT                   /translation="MELSRRICLVQLWLLLLSFLLGFSAGSAIHWREPEGKEVWDYVTV
FT                   RKDAHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQLKPRNTT
FT                   WLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYI
FT                   FSESYGGKMAAGISVELYKAVQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSMSLL
FT                   DNQDCGLLCLLRNQFCFPKSI"
FT   CDS             complement(join(10580276..10580338,10584695..10584858,
FT                   10585649..10585786,10588700..10588813,10589854..10589947,
FT                   10591099..10591227,10592179..10592216,10596403..10596475,
FT                   10598884..10598958,10599459..10599614,10602105..10602194,
FT                   10609729..10609877,10612592..10612667))
FT                   /codon_start=1
FT                   /gene="Scpep1"
FT                   /locus_tag="mCG_1482"
FT                   /product="serine carboxypeptidase 1, isoform CRA_b"
FT                   /note="gene_id=mCG1482.1 transcript_id=mCT8135.1
FT                   protein_id=mCP14107.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q99J29"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:1921867"
FT                   /db_xref="UniProtKB/TrEMBL:Q99J29"
FT                   /protein_id="EDL15861.1"
FT                   /translation="MELSRRICLVQLWLLLLSFLLGFSAGSAIHWREPEGKEVWDYVTV
FT                   RKDAHMFWWLYYATNPCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDTQLKPRNTT
FT                   WLQWASLLFVDNPVGTGFSYVNTTDAYAKDLDTVASDMMVLLKSFFDCHKEFQTVPFYI
FT                   FSESYGGKMAAGISVELYKAVQQGTIKCNFSGVALGDSWISPVDSVLSWGPYLYSMSLL
FT                   DNQGLAEVSDIAEQVLDAVNKGFYKEATQLWGKAEMIIEKNTDGVNFYNILTKSSPEKA
FT                   MESSLEFLRSPLVRLCQRHVRHLQGDALSQLMNGPIKKKLKIIPEDISWGAQASYVFLS
FT                   MEGDFMKPAIDVVDKLLAAGVNVTVYNGQLDLIVDTIGQESWVQKLKWPQLSKFNQLKW
FT                   KALYTDPKSSETAAFVKSYENLAFYWILKAGHMVPSDQGEMALKMMKLVTKQE"
FT   gene            complement(<10621714..10623896)
FT                   /locus_tag="mCG_55628"
FT                   /note="gene_id=mCG55628.2"
FT   mRNA            complement(join(<10621714..10622229,10623698..10623896))
FT                   /locus_tag="mCG_55628"
FT                   /product="mCG55628"
FT                   /note="gene_id=mCG55628.2 transcript_id=mCT55811.2 created
FT                   on 31-MAR-2003"
FT   CDS             complement(<10621714..10622191)
FT                   /codon_start=1
FT                   /locus_tag="mCG_55628"
FT                   /product="mCG55628"
FT                   /note="gene_id=mCG55628.2 transcript_id=mCT55811.2
FT                   protein_id=mCP35298.2"
FT                   /protein_id="EDL15862.1"
FT                   /translation="MDVFLMIRYKKTTILTDAKESSTVLALKRIIEGIMKRPPEEQLLF
FT                   KDNQLLDEMKTLRECGFTSQVARPEAPATVGLAFRTGDVFEGLEIHPYSPPLDLLDLLK
FT                   ASQNEANEPLFDEDPANEPLSNEDPAKEQFFDDEPPNQQFFHNLPNQFFDDDPMC"
FT   gene            10624526..10633964
FT                   /locus_tag="mCG_117175"
FT                   /note="gene_id=mCG117175.1"
FT   mRNA            join(10624526..10624629,10627458..10627525,
FT                   10631252..10631313,10631732..10631827,10633471..10633964)
FT                   /locus_tag="mCG_117175"
FT                   /product="mCG117175, transcript variant mCT171443"
FT                   /note="gene_id=mCG117175.1 transcript_id=mCT171443.0
FT                   created on 12-SEP-2002"
FT   mRNA            join(10630575..10630653,10631252..10631313,
FT                   10631732..10631827,10633471..10633964)
FT                   /locus_tag="mCG_117175"
FT                   /product="mCG117175, transcript variant mCT118311"
FT                   /note="gene_id=mCG117175.1 transcript_id=mCT118311.1
FT                   created on 12-SEP-2002"
FT   mRNA            join(10630583..10630653,10631252..10631313,
FT                   10633471..10633964)
FT                   /locus_tag="mCG_117175"
FT                   /product="mCG117175, transcript variant mCT171442"
FT                   /note="gene_id=mCG117175.1 transcript_id=mCT171442.0
FT                   created on 12-SEP-2002"
FT   mRNA            join(10631218..10631314,10631731..10631828,
FT                   10633470..10633964)
FT                   /locus_tag="mCG_117175"
FT                   /product="mCG117175, transcript variant mCT173142"
FT                   /note="gene_id=mCG117175.1 transcript_id=mCT173142.0
FT                   created on 12-SEP-2002"
FT   CDS             10633485..10633787
FT                   /codon_start=1
FT                   /locus_tag="mCG_117175"
FT                   /product="mCG117175, isoform CRA_a"
FT                   /note="gene_id=mCG117175.1 transcript_id=mCT118311.1
FT                   protein_id=mCP85298.1 isoform=CRA_a"
FT                   /protein_id="EDL15863.1"
FT                   /translation="MESQADTGLFVFLVIRHKKTTIFTDAMESSTVWELKRIIEGIMKR
FT                   PPEEQLLFKDNQLLDEMKTLRECGFTFQVARPETPATVGLAFRTGDVFEGLEIHP"
FT   CDS             10633485..10633787
FT                   /codon_start=1
FT                   /locus_tag="mCG_117175"
FT                   /product="mCG117175, isoform CRA_a"
FT                   /note="gene_id=mCG117175.1 transcript_id=mCT171442.0
FT                   protein_id=mCP94361.0 isoform=CRA_a"
FT                   /protein_id="EDL15864.1"
FT                   /translation="MESQADTGLFVFLVIRHKKTTIFTDAMESSTVWELKRIIEGIMKR
FT                   PPEEQLLFKDNQLLDEMKTLRECGFTFQVARPETPATVGLAFRTGDVFEGLEIHP"
FT   CDS             10633485..10633787
FT                   /codon_start=1
FT                   /locus_tag="mCG_117175"
FT                   /product="mCG117175, isoform CRA_a"
FT                   /note="gene_id=mCG117175.1 transcript_id=mCT171443.0
FT                   protein_id=mCP94362.0 isoform=CRA_a"
FT                   /protein_id="EDL15865.1"
FT                   /translation="MESQADTGLFVFLVIRHKKTTIFTDAMESSTVWELKRIIEGIMKR
FT                   PPEEQLLFKDNQLLDEMKTLRECGFTFQVARPETPATVGLAFRTGDVFEGLEIHP"
FT   CDS             10633485..10633787
FT                   /codon_start=1
FT                   /locus_tag="mCG_117175"
FT                   /product="mCG117175, isoform CRA_a"
FT                   /note="gene_id=mCG117175.1 transcript_id=mCT173142.0
FT                   protein_id=mCP96061.0 isoform=CRA_a"
FT                   /protein_id="EDL15866.1"
FT                   /translation="MESQADTGLFVFLVIRHKKTTIFTDAMESSTVWELKRIIEGIMKR
FT                   PPEEQLLFKDNQLLDEMKTLRECGFTFQVARPETPATVGLAFRTGDVFEGLEIHP"
FT   gene            10634800..10652601
FT                   /gene="Coil"
FT                   /locus_tag="mCG_1481"
FT                   /note="gene_id=mCG1481.1"
FT   mRNA            join(10634800..10635052,10641695..10642790,
FT                   10642912..10642998,10643226..10643273,10645638..10645707,
FT                   10648560..10648648,10651655..10652601)
FT                   /gene="Coil"
FT                   /locus_tag="mCG_1481"
FT                   /product="coilin"
FT                   /note="gene_id=mCG1481.1 transcript_id=mCT8134.1 created on
FT                   07-AUG-2002"
FT   CDS             join(10634808..10635052,10641695..10642790,
FT                   10642912..10642998,10643226..10643273,10645638..10645707,
FT                   10648560..10648648,10651655..10651729)
FT                   /codon_start=1
FT                   /gene="Coil"
FT                   /locus_tag="mCG_1481"
FT                   /product="coilin"
FT                   /note="gene_id=mCG1481.1 transcript_id=mCT8134.1
FT                   protein_id=mCP14106.1"
FT                   /db_xref="GOA:Q5SU73"
FT                   /db_xref="InterPro:IPR024822"
FT                   /db_xref="MGI:MGI:104842"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5SU73"
FT                   /protein_id="EDL15867.1"
FT                   /translation="MAASETVRLRLQFDYPPPATPHCTVFWLLVDLNRCRVVTDLISLI
FT                   RQRFGFSSGALLGLYLEGGLLPPAESARLVRDNDSLRVKLEDQGLPENLIVSNGGDSSF
FT                   PCRKAKKRAFKLMEDEETDQGYKSSKKHCKRQEDSGQNEKASDLETKLLPDETGRTKSK
FT                   KKSKVTGSPAEEDEEETKKKSSKRKEKCEPKKQTRASKSSKQQTPKEGASQNCSFPRAS
FT                   PRSLGKARRRSSTGLKGSSGHLSESESCPESVSDGHCSVMMQEVTFSEKLSAELLKDAP
FT                   ATKTAAANRQASKPGFTFSSGKGKASRTSSSSSDSSSESEDQFLVSKNMLEGASGFLKP
FT                   TGLFAGQGGSGPGLSLETPGIMGWKSSDSNRGRQAPGPPSTPVPTSLGRGWGRGEDLLF
FT                   GKGLRGRGVRGRGRGRGQAVSCVFNRSSESQKQRQLNDILTNSSVVIQNPVEPPKKDYS
FT                   LLPLLAAAPQVGEKIAFKLLELTSDYSPDVSDYKEGKILSHDPETQQVDIEVLSSLPAL
FT                   KEPGKFDLVYHNENGTEVVEYAVTQEKRITVLWRELIDPRLIIDSSGSISST"
FT   gene            10660258..10681017
FT                   /gene="Trim25"
FT                   /locus_tag="mCG_1483"
FT                   /note="gene_id=mCG1483.1"
FT   mRNA            join(10660258..10660889,10665553..10665648,
FT                   10669878..10670111,10671553..10671721,10674224..10674286,
FT                   10676275..10676373,10676461..10676559,10676903..10677883,
FT                   10677904..10681017)
FT                   /gene="Trim25"
FT                   /locus_tag="mCG_1483"
FT                   /product="tripartite motif protein 25, transcript variant
FT                   mCT8136"
FT                   /note="gene_id=mCG1483.1 transcript_id=mCT8136.2 created on
FT                   18-OCT-2002"
FT   mRNA            join(10660287..10660889,10665553..10665648,
FT                   10669878..10670111,10671553..10671721,10674224..10674286,
FT                   10675909..10675932,10676275..10676373,10676461..10676559,
FT                   10676903..10677883,10677904..10681017)
FT                   /gene="Trim25"
FT                   /locus_tag="mCG_1483"
FT                   /product="tripartite motif protein 25, transcript variant
FT                   mCT174520"
FT                   /note="gene_id=mCG1483.1 transcript_id=mCT174520.0 created
FT                   on 18-OCT-2002"
FT   CDS             join(10660296..10660889,10665553..10665648,
FT                   10669878..10670111,10671553..10671721,10674224..10674286,
FT                   10675909..10675932,10676275..10676373,10676461..10676559,
FT                   10676903..10677429)
FT                   /codon_start=1
FT                   /gene="Trim25"
FT                   /locus_tag="mCG_1483"
FT                   /product="tripartite motif protein 25, isoform CRA_a"
FT                   /note="gene_id=mCG1483.1 transcript_id=mCT174520.0
FT                   protein_id=mCP97439.0 isoform=CRA_a"
FT                   /protein_id="EDL15868.1"
FT                   /translation="MAELNPLAEELSCSVCLELFKEPVTTPCGHNFCMSCLDETWVVQG
FT                   PPYRCPQCRKVYQVRPQLQKNTVMCAVVEQFLQAEQARTPVDDWTPPARFSASSAATQV
FT                   ACDHCLTEIAVKTCLVCMASFCQEHLRPHFDSPAFQDHPLQSPIRDLLRRKCTQHNRLR
FT                   EFFCPEHGECICHICLVEHKTCSPTTLSQASADLEYKLRNKLTIMHSHINGATKALEDV
FT                   RSKQQCVQDSMKRKMEQLRQEYMEMKAVIDAAETSSLRKLKEEEKRVYGKFDTIYQVLV
FT                   KKKSEMQKLKAEVELIMDKGDEFEFLEKAAKLQGESTKPVYIPKIDLDHDLIMGIYQGA
FT                   ADLKSELKHSIKKLQKKSEEHNGSGNKGDQTQSTFKPVQPSKKTIQEKKTKKTPVAPGP
FT                   PSHFSPNKLPTFGAPGQSLDSKATSPDAAPKASAAQPDSIGVKAKVLENFLTKSRTELL
FT                   EYFVKVIFDYNTAHNKVSLSNKYTTASVSDGLQHYRSHPQRFTYCSQVLGLHCYKNGIH
FT                   YWEVELQKNNFCGVGICYGSMERQGPESRLGRNPNSWCVEWFNNKISAWHNNVEKTLPS
FT                   TKATRVGVLLNCDHGFVIFFAVTEKVHLMYKFKVDFTEALYPAFWVFSAGTTLSICSK"
FT   CDS             join(10660296..10660889,10665553..10665648,
FT                   10669878..10670111,10671553..10671721,10674224..10674286,
FT                   10676275..10676373,10676461..10676559,10676903..10677429)
FT                   /codon_start=1
FT                   /gene="Trim25"
FT                   /locus_tag="mCG_1483"
FT                   /product="tripartite motif protein 25, isoform CRA_b"
FT                   /note="gene_id=mCG1483.1 transcript_id=mCT8136.2
FT                   protein_id=mCP14114.2 isoform=CRA_b"
FT                   /protein_id="EDL15869.1"
FT                   /translation="MAELNPLAEELSCSVCLELFKEPVTTPCGHNFCMSCLDETWVVQG
FT                   PPYRCPQCRKVYQVRPQLQKNTVMCAVVEQFLQAEQARTPVDDWTPPARFSASSAATQV
FT                   ACDHCLTEIAVKTCLVCMASFCQEHLRPHFDSPAFQDHPLQSPIRDLLRRKCTQHNRLR
FT                   EFFCPEHGECICHICLVEHKTCSPTTLSQASADLEYKLRNKLTIMHSHINGATKALEDV
FT                   RSKQQCVQDSMKRKMEQLRQEYMEMKAVIDAAETSSLRKLKEEEKRVYGKFDTIYQVLV
FT                   KKKSEMQKLKAEVELIMDKGDEFEFLEKAAKLQGESTKPVYIPKIDLDHDLIMGIYQGA
FT                   ADLKSELKHSIKKLQKKSEEHNGSGNKGDQTQSTFKPVQPSKKTIPVAPGPPSHFSPNK
FT                   LPTFGAPGQSLDSKATSPDAAPKASAAQPDSIGVKAKVLENFLTKSRTELLEYFVKVIF
FT                   DYNTAHNKVSLSNKYTTASVSDGLQHYRSHPQRFTYCSQVLGLHCYKNGIHYWEVELQK
FT                   NNFCGVGICYGSMERQGPESRLGRNPNSWCVEWFNNKISAWHNNVEKTLPSTKATRVGV
FT                   LLNCDHGFVIFFAVTEKVHLMYKFKVDFTEALYPAFWVFSAGTTLSICSK"
FT   gene            complement(10699485..>10726447)
FT                   /gene="Dgke"
FT                   /locus_tag="mCG_145958"
FT                   /note="gene_id=mCG145958.0"
FT   mRNA            complement(join(10699485..10702281,10702846..10702957,
FT                   10703514..10703641,10705658..10705729,10710037..10710150,
FT                   10711949..10712000,10712419..10712576,10712757..10712900,
FT                   10714516..10714635,10717454..10717613,10725830..>10726447))
FT                   /gene="Dgke"
FT                   /locus_tag="mCG_145958"
FT                   /product="diacylglycerol kinase, epsilon"
FT                   /note="gene_id=mCG145958.0 transcript_id=mCT186066.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(10702102..10702281,10702846..10702957,
FT                   10703514..10703641,10705658..10705729,10710037..10710150,
FT                   10711949..10712000,10712419..10712576,10712757..10712900,
FT                   10714516..10714635,10717454..10717613,10725830..>10726305))
FT                   /codon_start=1
FT                   /gene="Dgke"
FT                   /locus_tag="mCG_145958"
FT                   /product="diacylglycerol kinase, epsilon"
FT                   /note="gene_id=mCG145958.0 transcript_id=mCT186066.0
FT                   protein_id=mCP107513.0"
FT                   /protein_id="EDL15870.1"
FT                   /translation="ATPGPEKMEGDQRSGPPAQSLLPDGHLVLWTLCSVLLPVFITLWC
FT                   SLQRSRRQLHRRDIFRKSKHCWRDTDLFSHPTYCCVCAQHILQGAFCDCCGLRVDEGCL
FT                   KKVDKRFPCKEIMLKNDKAADAMPHHWIRGNVPLCSYCVFCRQQCGSQPKLCDYRCIWC
FT                   QKTVHDECMRSSLRSEKCDFGEFRNLIIPPSYLTSINQMRKDKNTNYEGLASKFGKQWT
FT                   PLIILANSRSGTNMGEGLLGEFKILLNPVQVFDVTKTPPIKALQLCTLLPYYSVRVLVC
FT                   GGDGTVGWVLDAIDEMKIKGQEKYIPEVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVL
FT                   RNVMEADGIKLDRWKVQVTNKGYYNLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPS
FT                   LFSSRILNKAVYLFYGTKDCLVQECKDLNKKIELELDGERVELPNLEGIIVLNIGYWGG
FT                   GCRLWEGMGDETYPLARHDDGLLEIVGVYGSFHCAQIQVKLANPFRIGQAHTVRLTLKC
FT                   SMMPMQVDGEPWAQGPCTVTITHKTHALMLYFSGEQSDDDISSPSDHEDVKEAE"
FT   gene            10731958..10734962
FT                   /gene="A930013B10Rik"
FT                   /locus_tag="mCG_147530"
FT                   /note="gene_id=mCG147530.0"
FT   mRNA            join(10731958..10732090,10732328..10732379,
FT                   10733201..10734962)
FT                   /gene="A930013B10Rik"
FT                   /locus_tag="mCG_147530"
FT                   /product="RIKEN cDNA A930013B10"
FT                   /note="gene_id=mCG147530.0 transcript_id=mCT187793.0
FT                   created on 13-JAN-2004"
FT   CDS             join(10732000..10732090,10732328..10732379,
FT                   10733201..10733501)
FT                   /codon_start=1
FT                   /gene="A930013B10Rik"
FT                   /locus_tag="mCG_147530"
FT                   /product="RIKEN cDNA A930013B10"
FT                   /note="gene_id=mCG147530.0 transcript_id=mCT187793.0
FT                   protein_id=mCP109296.0"
FT                   /db_xref="MGI:MGI:3041185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C8U9"
FT                   /protein_id="EDL15871.1"
FT                   /translation="MDSASQRRFQPGKAREDLVREDRSSWWKFPDHLPTCLWEDVLMAA
FT                   RLCLSDAEEALLGAPGLRSFVSLTSREIPPEELCLPWCFSQNECCVPQFQAVHFPLNIR
FT                   LHPTSLPLCPHAAPSCLAWIAGWLWPSEPLLTLAVFTCWADTK"
FT   gene            10739855..10755904
FT                   /locus_tag="mCG_1484"
FT                   /note="gene_id=mCG1484.1"
FT   mRNA            join(10739855..10740215,10741210..10741310,
FT                   10755521..10755904)
FT                   /locus_tag="mCG_1484"
FT                   /product="mCG1484"
FT                   /note="gene_id=mCG1484.1 transcript_id=mCT8137.1 created on
FT                   25-OCT-2002"
FT   CDS             10739924..10740109
FT                   /codon_start=1
FT                   /locus_tag="mCG_1484"
FT                   /product="mCG1484"
FT                   /note="gene_id=mCG1484.1 transcript_id=mCT8137.1
FT                   protein_id=mCP14119.2"
FT                   /protein_id="EDL15872.1"
FT                   /translation="MLSKPHSGGHISCLRMKIRRNSEGNILAVIIANSESDVLSLTRQT
FT                   VLAEVYTALDLTGPRF"
FT   gene            complement(<10964743..10965689)
FT                   /gene="Nog"
FT                   /locus_tag="mCG_117177"
FT                   /note="gene_id=mCG117177.1"
FT   mRNA            complement(<10964743..10965689)
FT                   /gene="Nog"
FT                   /locus_tag="mCG_117177"
FT                   /product="noggin"
FT                   /note="gene_id=mCG117177.1 transcript_id=mCT118313.1
FT                   created on 02-APR-2003"
FT   CDS             complement(10964743..10965441)
FT                   /codon_start=1
FT                   /gene="Nog"
FT                   /locus_tag="mCG_117177"
FT                   /product="noggin"
FT                   /note="gene_id=mCG117177.1 transcript_id=mCT118313.1
FT                   protein_id=mCP85311.0"
FT                   /db_xref="GOA:A2RTJ4"
FT                   /db_xref="InterPro:IPR008717"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:104327"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTJ4"
FT                   /protein_id="EDL15873.1"
FT                   /translation="MERCPSLGVTLYALVVVLGLRAAPAGGQHYLHIRPAPSDNLPLVD
FT                   LIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAEL
FT                   DQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWND
FT                   LGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQY
FT                   PIISECKCSC"
FT   gene            complement(<11059781..11086413)
FT                   /gene="4932411E22Rik"
FT                   /locus_tag="mCG_55963"
FT                   /note="gene_id=mCG55963.1"
FT   mRNA            complement(join(<11059781..11059959,11073003..11073216,
FT                   11079482..11079648,11086311..11086413))
FT                   /gene="4932411E22Rik"
FT                   /locus_tag="mCG_55963"
FT                   /product="RIKEN cDNA 4932411E22"
FT                   /note="gene_id=mCG55963.1 transcript_id=mCT56146.1 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(<11059781..11059959,11073003..11073216,
FT                   11079482..11079648,11086311..11086344))
FT                   /codon_start=1
FT                   /gene="4932411E22Rik"
FT                   /locus_tag="mCG_55963"
FT                   /product="RIKEN cDNA 4932411E22"
FT                   /note="gene_id=mCG55963.1 transcript_id=mCT56146.1
FT                   protein_id=mCP35292.2"
FT                   /protein_id="EDL15874.1"
FT                   /translation="MPLSVPLHTAAVHFCSYREKFISLYCRLSAVVELDSLNTQQSLRE
FT                   AISDSEVAAAKQRHQQVLDFIQQIDEVWREMRWIMDALQYARYKQPVSGLPITKLIDSS
FT                   SEQNLKKISSTSSHIDCLPSTSPSPEMHRRKAVSESQPCSDEEGCSEVFLPTDSDYDSS
FT                   DALSPRDLDLVYLSSHDIAQQALSGLSGSAPDVLQ"
FT   gene            complement(11068678..11071131)
FT                   /locus_tag="mCG_147541"
FT                   /note="gene_id=mCG147541.0"
FT   mRNA            complement(join(11068678..11069851,11069868..11071131))
FT                   /locus_tag="mCG_147541"
FT                   /product="mCG147541"
FT                   /note="gene_id=mCG147541.0 transcript_id=mCT187804.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11068762..11069025)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147541"
FT                   /product="mCG147541"
FT                   /note="gene_id=mCG147541.0 transcript_id=mCT187804.0
FT                   protein_id=mCP109307.0"
FT                   /protein_id="EDL15875.1"
FT                   /translation="MKHLPRGPRRNVGSKKKKKAFHGKGRAICSIPWAFSPTHFLWGQY
FT                   HRKQYFSPTLMASPHDAWVKQWREGRCCFLQMSLKIIPFLQM"
FT   gene            complement(11299999..11442914)
FT                   /locus_tag="mCG_147543"
FT                   /note="gene_id=mCG147543.0"
FT   mRNA            complement(join(11299999..11300991,11442875..11442914))
FT                   /locus_tag="mCG_147543"
FT                   /product="mCG147543"
FT                   /note="gene_id=mCG147543.0 transcript_id=mCT187806.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11300324..11300545)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147543"
FT                   /product="mCG147543"
FT                   /note="gene_id=mCG147543.0 transcript_id=mCT187806.0
FT                   protein_id=mCP109309.0"
FT                   /protein_id="EDL15876.1"
FT                   /translation="MATVQTFFLEQISCILYSLWNSQCLYQTTHLFSSVRPDIIVLGLS
FT                   WEDRHFTVFSLKSACEYISQCVFTSGII"
FT   gene            complement(11636398..11678666)
FT                   /gene="Pctp"
FT                   /locus_tag="mCG_1473"
FT                   /note="gene_id=mCG1473.2"
FT   mRNA            complement(join(11636398..11636572,11637912..11637979,
FT                   11639017..11639188,11640516..11640595,11643259..11643376,
FT                   11659880..11659901))
FT                   /gene="Pctp"
FT                   /locus_tag="mCG_1473"
FT                   /product="phosphatidylcholine transfer protein, transcript
FT                   variant mCT171445"
FT                   /note="gene_id=mCG1473.2 transcript_id=mCT171445.0 created
FT                   on 07-AUG-2002"
FT   mRNA            complement(join(11636398..11636572,11637912..11637979,
FT                   11639017..11639188,11640516..11640595,11643259..11643376,
FT                   11657833..11657996))
FT                   /gene="Pctp"
FT                   /locus_tag="mCG_1473"
FT                   /product="phosphatidylcholine transfer protein, transcript
FT                   variant mCT8261"
FT                   /note="gene_id=mCG1473.2 transcript_id=mCT8261.0 created on
FT                   07-AUG-2002"
FT   mRNA            complement(join(11636436..11636572,11637912..11637979,
FT                   11639017..11639188,11640516..11640595,11643259..11643376,
FT                   11678626..11678666))
FT                   /gene="Pctp"
FT                   /locus_tag="mCG_1473"
FT                   /product="phosphatidylcholine transfer protein, transcript
FT                   variant mCT171446"
FT                   /note="gene_id=mCG1473.2 transcript_id=mCT171446.0 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(11636507..11636572,11637912..11637979,
FT                   11639017..11639188,11640516..11640595,11643259..11643376,
FT                   11657833..11657973))
FT                   /codon_start=1
FT                   /gene="Pctp"
FT                   /locus_tag="mCG_1473"
FT                   /product="phosphatidylcholine transfer protein, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1473.2 transcript_id=mCT8261.0
FT                   protein_id=mCP14110.1 isoform=CRA_b"
FT                   /protein_id="EDL15879.1"
FT                   /translation="MAGAACCFSDEQFREACAELQKPALTGADWQLLVEASGITIYRLL
FT                   DQPSGLYEYKVFGVLEGCSPALLTDVYMDLDYRKQWDQYVKELYEKESDEQMVAYWEVK
FT                   YPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQSISAPQFPEKSGVIRVKQYKQSLAIES
FT                   DGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNYHKKT"
FT   CDS             complement(join(11636507..11636572,11637912..11637979,
FT                   11639017..11639188,11640516..11640595,11643259..11643301))
FT                   /codon_start=1
FT                   /gene="Pctp"
FT                   /locus_tag="mCG_1473"
FT                   /product="phosphatidylcholine transfer protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1473.2 transcript_id=mCT171446.0
FT                   protein_id=mCP94364.0 isoform=CRA_a"
FT                   /protein_id="EDL15877.1"
FT                   /translation="MDLDYRKQWDQYVKELYEKESDEQMVAYWEVKYPFPLSNRDYVYT
FT                   RQRRDLDVDGRKIYVVLAQSISAPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYF
FT                   DNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNYHKKT"
FT   CDS             complement(join(11636507..11636572,11637912..11637979,
FT                   11639017..11639188,11640516..11640595,11643259..11643301))
FT                   /codon_start=1
FT                   /gene="Pctp"
FT                   /locus_tag="mCG_1473"
FT                   /product="phosphatidylcholine transfer protein, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1473.2 transcript_id=mCT171445.0
FT                   protein_id=mCP94365.0 isoform=CRA_a"
FT                   /protein_id="EDL15878.1"
FT                   /translation="MDLDYRKQWDQYVKELYEKESDEQMVAYWEVKYPFPLSNRDYVYT
FT                   RQRRDLDVDGRKIYVVLAQSISAPQFPEKSGVIRVKQYKQSLAIESDGKKGSRVFMYYF
FT                   DNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNYHKKT"
FT   gene            11688301..11694483
FT                   /gene="Tmem100"
FT                   /locus_tag="mCG_1472"
FT                   /note="gene_id=mCG1472.1"
FT   mRNA            join(11688301..11688697,11691542..11691679,
FT                   11693251..11694483)
FT                   /gene="Tmem100"
FT                   /locus_tag="mCG_1472"
FT                   /product="transmembrane protein 100"
FT                   /note="gene_id=mCG1472.1 transcript_id=mCT8260.1 created on
FT                   07-AUG-2002"
FT   CDS             11693323..11693727
FT                   /codon_start=1
FT                   /gene="Tmem100"
FT                   /locus_tag="mCG_1472"
FT                   /product="transmembrane protein 100"
FT                   /note="gene_id=mCG1472.1 transcript_id=mCT8260.1
FT                   protein_id=mCP14109.1"
FT                   /protein_id="EDL15880.1"
FT                   /translation="MTEEPTKENLGAPKSPTPVTMEKNPKREVVVTTGPLVSEVQLMAA
FT                   TGGAELSCYRCIIPFAVVVFITGIVVTAVAYSFNSHGSIISIFGLVLLSSGLFLLASSA
FT                   LCWKVRQRNKKVKRRESQTALVVNQRCLFA"
FT   gene            complement(11721505..11722171)
FT                   /locus_tag="mCG_49987"
FT                   /note="gene_id=mCG49987.2"
FT   mRNA            complement(11721505..11722171)
FT                   /locus_tag="mCG_49987"
FT                   /product="mCG49987"
FT                   /note="gene_id=mCG49987.2 transcript_id=mCT50170.2 created
FT                   on 11-NOV-2002"
FT   CDS             complement(11721746..11721943)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49987"
FT                   /product="mCG49987"
FT                   /note="gene_id=mCG49987.2 transcript_id=mCT50170.2
FT                   protein_id=mCP35286.2"
FT                   /protein_id="EDL15881.1"
FT                   /translation="MFQIGKMRYVSVRDFKGKILIDIREYWMDSEGEMKPGRKGISLNM
FT                   EQWSQLKEQISDIDDAVRKL"
FT   gene            complement(11793614..11802316)
FT                   /locus_tag="mCG_147548"
FT                   /note="gene_id=mCG147548.0"
FT   mRNA            complement(join(11793614..11794975,11795140..11795247,
FT                   11798009..11798119,11802190..11802316))
FT                   /locus_tag="mCG_147548"
FT                   /product="mCG147548"
FT                   /note="gene_id=mCG147548.0 transcript_id=mCT187811.1
FT                   created on 19-MAR-2004"
FT   CDS             complement(join(11794930..11794975,11795140..11795247,
FT                   11798009..11798043))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147548"
FT                   /product="mCG147548"
FT                   /note="gene_id=mCG147548.0 transcript_id=mCT187811.1
FT                   protein_id=mCP109314.1"
FT                   /protein_id="EDL15882.1"
FT                   /translation="MSEPRRIPKKNRLTYHLCLAFITIVVAQLTSMIYMELHLQLFGYL
FT                   CFRQCLSFQNRCPHLRV"
FT   gene            11904808..11932863
FT                   /gene="Mmd"
FT                   /locus_tag="mCG_1475"
FT                   /note="gene_id=mCG1475.1"
FT   mRNA            join(11904808..11905022,11918786..11918860,
FT                   11920327..11920428,11921800..11921869,11930949..11932863)
FT                   /gene="Mmd"
FT                   /locus_tag="mCG_1475"
FT                   /product="monocyte to macrophage
FT                   differentiation-associated"
FT                   /note="gene_id=mCG1475.1 transcript_id=mCT8262.2 created on
FT                   07-AUG-2002"
FT   CDS             join(11904997..11905022,11918786..11918860,
FT                   11920327..11920428,11921800..11921869,11930949..11931149)
FT                   /codon_start=1
FT                   /gene="Mmd"
FT                   /locus_tag="mCG_1475"
FT                   /product="monocyte to macrophage
FT                   differentiation-associated"
FT                   /note="gene_id=mCG1475.1 transcript_id=mCT8262.2
FT                   protein_id=mCP14120.2"
FT                   /protein_id="EDL15883.1"
FT                   /translation="MRFRNRFQRTVEHCFHMCDRMVIYFFIAASYAPWLNLRELGPLAS
FT                   HMRWFIWLMAAGGTIYVFLYHEKYKVVELFFYLTMGFSPALVVTSMNNTDGLQELACGG
FT                   LIYCLGVVFFKSDGIIPFAHAIWHLFVATAAAVHYYAIWKYLYRSPTDFIRHL"
FT   gene            complement(11988256..12042384)
FT                   /gene="Hlf"
FT                   /locus_tag="mCG_141353"
FT                   /note="gene_id=mCG141353.0"
FT   mRNA            complement(join(11988256..11992693,11997480..11997700,
FT                   12039318..12039653,12041795..12042384))
FT                   /gene="Hlf"
FT                   /locus_tag="mCG_141353"
FT                   /product="hepatic leukemia factor, transcript variant
FT                   mCT174830"
FT                   /note="gene_id=mCG141353.0 transcript_id=mCT174830.0
FT                   created on 25-OCT-2002"
FT   mRNA            complement(join(11990708..11992693,11997480..11997700,
FT                   12022018..12022092,12039318..12039653,12041138..>12041192))
FT                   /gene="Hlf"
FT                   /locus_tag="mCG_141353"
FT                   /product="hepatic leukemia factor, transcript variant
FT                   mCT191011"
FT                   /note="gene_id=mCG141353.0 transcript_id=mCT191011.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(11991100..11992693,11997480..11997700,
FT                   12039318..12039653,12041138..>12041180))
FT                   /gene="Hlf"
FT                   /locus_tag="mCG_141353"
FT                   /product="hepatic leukemia factor, transcript variant
FT                   mCT191012"
FT                   /note="gene_id=mCG141353.0 transcript_id=mCT191012.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(11992478..11992693,11997480..11997700,
FT                   12039318..12039653,12041795..12041909))
FT                   /codon_start=1
FT                   /gene="Hlf"
FT                   /locus_tag="mCG_141353"
FT                   /product="hepatic leukemia factor, isoform CRA_a"
FT                   /note="gene_id=mCG141353.0 transcript_id=mCT174830.0
FT                   protein_id=mCP97749.0 isoform=CRA_a"
FT                   /protein_id="EDL15884.1"
FT                   /translation="MEKMSRQLPLNPTFIPPPYGVLRSLLENPLKLPLHPEDAFSKEKD
FT                   KGKKLDDESSSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQH
FT                   DHSPHPPGLQPASSTAPSVMDLSSRATAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSP
FT                   IDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDD
FT                   LKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKC
FT                   KNILAKYEARHGPL"
FT   CDS             complement(join(11992478..11992693,11997480..11997700,
FT                   12022018..12022092,12039318..12039653,12041138..>12041192))
FT                   /codon_start=1
FT                   /gene="Hlf"
FT                   /locus_tag="mCG_141353"
FT                   /product="hepatic leukemia factor, isoform CRA_b"
FT                   /note="gene_id=mCG141353.0 transcript_id=mCT191011.0
FT                   protein_id=mCP111967.0 isoform=CRA_b"
FT                   /protein_id="EDL15885.1"
FT                   /translation="AGSRVTACRSLLWLEPFLAFSKEKDKGKKLDDESSSPTVPQSAFL
FT                   GPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSTAPSVM
FT                   DLSSRATAPLHPGIPSPNCMQSPIRPEADHLCLSLPWVKEQRDIYWPYHTQGQLLPANR
FT                   NTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKV
FT                   FIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRK
FT                   ELGKCKNILAKYEARHGPL"
FT   CDS             complement(join(11992478..11992693,11997480..11997700,
FT                   12039318..12039653,12041138..>12041180))
FT                   /codon_start=1
FT                   /gene="Hlf"
FT                   /locus_tag="mCG_141353"
FT                   /product="hepatic leukemia factor, isoform CRA_c"
FT                   /note="gene_id=mCG141353.0 transcript_id=mCT191012.0
FT                   protein_id=mCP111968.0 isoform=CRA_c"
FT                   /protein_id="EDL15886.1"
FT                   /translation="VTACRSLLWLEPFLAFSKEKDKGKKLDDESSSPTVPQSAFLGPTL
FT                   WDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSTAPSVMDLSS
FT                   RATAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSI
FT                   PGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDAR
FT                   RLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL"
FT   gene            complement(12132148..12292339)
FT                   /gene="Stxbp4"
FT                   /locus_tag="mCG_1471"
FT                   /note="gene_id=mCG1471.1"
FT   mRNA            complement(join(12132148..12132926,12146585..12146642,
FT                   12187347..12187480,12189772..12189821,12192019..12192135,
FT                   12200662..12200838,12223588..12223653,12227096..12227185,
FT                   12243957..12244048,12246370..12246466,12251812..12251906,
FT                   12257677..12257755,12258702..12258918,12259079..12259185,
FT                   12270917..12271049,12273389..12273516,12273927..12273996,
FT                   12292288..12292339))
FT                   /gene="Stxbp4"
FT                   /locus_tag="mCG_1471"
FT                   /product="syntaxin binding protein 4"
FT                   /note="gene_id=mCG1471.1 transcript_id=mCT8259.1 created on
FT                   07-AUG-2002"
FT   CDS             complement(join(12132812..12132926,12146585..12146642,
FT                   12187347..12187480,12189772..12189821,12192019..12192135,
FT                   12200662..12200838,12223588..12223653,12227096..12227185,
FT                   12243957..12244048,12246370..12246466,12251812..12251906,
FT                   12257677..12257755,12258702..12258918,12259079..12259185,
FT                   12270917..12271049,12273389..12273435))
FT                   /codon_start=1
FT                   /gene="Stxbp4"
FT                   /locus_tag="mCG_1471"
FT                   /product="syntaxin binding protein 4"
FT                   /note="gene_id=mCG1471.1 transcript_id=mCT8259.1
FT                   protein_id=mCP14103.2"
FT                   /protein_id="EDL15887.1"
FT                   /translation="MSDGTASARSSSPLDRDPAFRVITVTKETGLGLKILGGINRNEGP
FT                   LVYIHEVIPGGDCYKDGRLKPGDQLVSINKESMIGVSFEEAKSIITRAKLRSESPWEIA
FT                   FIRQKSYCGHPGNICCPSPQVSEDCGPQTSTFTLLSSPSETLLPKTSSTPQTQDSTFPS
FT                   CKAIQTKPEHDKTEHSPITSLDNSPADTSNADIAPAWTDDDSGPQGKISLNPSVRLKAE
FT                   KLEMALNYLGIQPTKEQREALREQVQADSKGTVSFGDFVQVARSLFCLQLDEVNVGVHE
FT                   IPSILDSQLLPCDSLEADEVGKLRQERNAALEERNVLKEKLLESEKHRKQLIEELQNVK
FT                   QEAKAVAEETRALRSRIHLAEAAQRQAHGMEMDYEEVIRLLEAEVSELKAQLADYSDQN
FT                   KESVQDLRKRVTVLDCQLRKSEMARKAFKASTERLLGFIEAIQEVLLDSSAPLSTLSER
FT                   RAVLASQTSLPLLARNGRSFPATLLLESKELVRSVHAILDMDCLPYGWEEAYTADGIKY
FT                   FINHVTQTTSWIHPVMSALNLSCAEESEEDCPRELTDPKS"
FT   gene            12292425..12300415
FT                   /gene="Cox11"
FT                   /locus_tag="mCG_1470"
FT                   /note="gene_id=mCG1470.1"
FT   mRNA            join(12292425..12292807,12294624..12294779,
FT                   12297863..12297988,12298579..12300415)
FT                   /gene="Cox11"
FT                   /locus_tag="mCG_1470"
FT                   /product="COX11 homolog, cytochrome c oxidase assembly
FT                   protein (yeast)"
FT                   /note="gene_id=mCG1470.1 transcript_id=mCT8258.1 created on
FT                   16-SEP-2002"
FT   CDS             join(12292445..12292807,12294624..12294779,
FT                   12297863..12297988,12298579..12298761)
FT                   /codon_start=1
FT                   /gene="Cox11"
FT                   /locus_tag="mCG_1470"
FT                   /product="COX11 homolog, cytochrome c oxidase assembly
FT                   protein (yeast)"
FT                   /note="gene_id=mCG1470.1 transcript_id=mCT8258.1
FT                   protein_id=mCP14108.1"
FT                   /protein_id="EDL15888.1"
FT                   /translation="MGGLWCPGWRLVASCGRGWRQPGWSGRTVVYAELVLRPGWDGLGG
FT                   AERGLRRLGTWKRPSGSRGPAAQPPRRPRSSNPFQRAQEDEWRRRNKTVLTYVAAAAVG
FT                   MLGASYAAVPLYRLYCQTTGLGGSAVAGHSSDQIENMVPVKDRVIKVTFNADVHASLQW
FT                   NFRPQQTEIYVVPGETALAFYKAKNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQ
FT                   RLNPQEEVDMPVFFYIDPEFAEDPRMVNVDLITLSYTFFEAKEGHKLPVPGYN"
FT   gene            complement(12297673..>12341591)
FT                   /locus_tag="mCG_1474"
FT                   /note="gene_id=mCG1474.3"
FT   mRNA            complement(join(12297673..12300518,12301044..12301108,
FT                   12303527..12303602,12303967..12304069,12306092..12306143,
FT                   12310536..12310635,12311897..12312014,12312331..12312391,
FT                   12315946..12316079,12325245..12325361,12326983..12327087,
FT                   12327814..12327936,12328815..12328964,12337213..12337291,
FT                   12339049..12339133,12341500..12341581))
FT                   /locus_tag="mCG_1474"
FT                   /product="mCG1474, transcript variant mCT8264"
FT                   /note="gene_id=mCG1474.3 transcript_id=mCT8264.3 created on
FT                   05-MAR-2003"
FT   mRNA            complement(join(12299900..12300518,12301044..12301108,
FT                   12303527..12303602,12303967..12304069,12306092..12306143,
FT                   12310536..12310635,12311897..12312014,12312331..12312391,
FT                   12315946..12316079,12325245..12325361,12326983..12327087,
FT                   12327814..12327936,12328815..12328964,12337213..12337308,
FT                   12339049..12339133,12341500..>12341591))
FT                   /locus_tag="mCG_1474"
FT                   /product="mCG1474, transcript variant mCT191033"
FT                   /note="gene_id=mCG1474.3 transcript_id=mCT191033.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(12299900..12300518,12301044..12301108,
FT                   12303527..12303602,12303967..12304069,12306092..12306143,
FT                   12310536..12310635,12311897..12312014,12312331..12312391,
FT                   12315946..12316079,12325245..12325361,12328815..12328964,
FT                   12337213..12337291,12339049..12339133,12341500..12341568))
FT                   /locus_tag="mCG_1474"
FT                   /product="mCG1474, transcript variant mCT180861"
FT                   /note="gene_id=mCG1474.3 transcript_id=mCT180861.0 created
FT                   on 05-MAR-2003"
FT   CDS             complement(join(12301045..12301108,12303527..12303602,
FT                   12303967..12304069,12306092..12306143,12310536..12310635,
FT                   12311897..12312014,12312331..12312391,12315946..12316079,
FT                   12325245..12325361,12328815..12328964,12337213..12337291,
FT                   12339049..12339133,12341500..12341557))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1474"
FT                   /product="mCG1474, isoform CRA_a"
FT                   /note="gene_id=mCG1474.3 transcript_id=mCT180861.0
FT                   protein_id=mCP103783.0 isoform=CRA_a"
FT                   /protein_id="EDL15889.1"
FT                   /translation="MAFGKSHRDPYATSVGHLIEKATFAGVLTEDWGQFLHICDIINTT
FT                   QDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLIVKKEFIKDTLVKL
FT                   LNPRYTLPLETQNRILNFIKIGKLHSELDMVKMNVKVMTAILMENIPGSENHEDIELLR
FT                   KLYKTGREMQERIMDLLVVVENEDVTMELIQVNEDLNNAVLGYERFTRNQQRLLEQKRN
FT                   RTEATRTSSEPSAPSCDLLDLSPIVPVPTPNEGALNSVNAQLSGLSVSSLSPVITNNLY
FT                   PSLQPQRDLLASEDIEIPTLFPQRTSQNLASSHTYDNFHSNSVLLQPVSLHTATAAAAA
FT                   NQRLPPLPSSHPVLKDGDLQPPNYYEVMEFDPLAPTTEAVYEEIDGYHQKEAQSHSDC"
FT   CDS             complement(join(12301045..12301108,12303527..12303602,
FT                   12303967..12304069,12306092..12306143,12310536..12310635,
FT                   12311897..12312014,12312331..12312391,12315946..12316079,
FT                   12325245..12325361,12326983..12327087,12327814..12327936,
FT                   12328815..12328964,12337213..12337291,12339049..12339133,
FT                   12341500..12341557))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1474"
FT                   /product="mCG1474, isoform CRA_c"
FT                   /note="gene_id=mCG1474.3 transcript_id=mCT8264.3
FT                   protein_id=mCP14115.3 isoform=CRA_c"
FT                   /db_xref="GOA:Q7TNI6"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR014645"
FT                   /db_xref="InterPro:IPR018205"
FT                   /db_xref="InterPro:IPR027428"
FT                   /db_xref="MGI:MGI:1919193"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TNI6"
FT                   /protein_id="EDL15891.1"
FT                   /translation="MAFGKSHRDPYATSVGHLIEKATFAGVLTEDWGQFLHICDIINTT
FT                   QDGPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQNCGPSFQSLIVKKEFIKDTLVKL
FT                   LNPRYTLPLETQNRILNFIKTWSQGFPGGVDVSEVKEVYLDLLKKGVQFPPSDGEPETR
FT                   QEGGQISPNRPTSVPTAPALSSIIAPKNPTISLVPEQIGKLHSELDMVKMNVKVMTAIL
FT                   MENIPGSENHEDIELLRKLYKTGREMQERIMDLLVVVENEDVTMELIQVNEDLNNAVLG
FT                   YERFTRNQQRLLEQKRNRTEATRTSSEPSAPSCDLLDLSPIVPVPTPNEGALNSVNAQL
FT                   SGLSVSSLSPVITNNLYPSLQPQRDLLASEDIEIPTLFPQRTSQNLASSHTYDNFHSNS
FT                   VLLQPVSLHTATAAAAANQRLPPLPSSHPVLKDGDLQPPNYYEVMEFDPLAPTTEAVYE
FT                   EIDGYHQKEAQSHSDC"
FT   CDS             complement(join(12301045..12301108,12303527..12303602,
FT                   12303967..12304069,12306092..12306143,12310536..12310635,
FT                   12311897..12312014,12312331..12312391,12315946..12316079,
FT                   12325245..12325361,12326983..12327087,12327814..12327936,
FT                   12328815..12328964,12337213..12337308,12339049..>12339063))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1474"
FT                   /product="mCG1474, isoform CRA_b"
FT                   /note="gene_id=mCG1474.3 transcript_id=mCT191033.0
FT                   protein_id=mCP111971.0 isoform=CRA_b"
FT                   /protein_id="EDL15890.1"
FT                   /translation="HHTGRCLYCHRPKDAVKALKKRISKNYNHKEIQLSLSLIDMCVQN
FT                   CGPSFQSLIVKKEFIKDTLVKLLNPRYTLPLETQNRILNFIKTWSQGFPGGVDVSEVKE
FT                   VYLDLLKKGVQFPPSDGEPETRQEGGQISPNRPTSVPTAPALSSIIAPKNPTISLVPEQ
FT                   IGKLHSELDMVKMNVKVMTAILMENIPGSENHEDIELLRKLYKTGREMQERIMDLLVVV
FT                   ENEDVTMELIQVNEDLNNAVLGYERFTRNQQRLLEQKRNRTEATRTSSEPSAPSCDLLD
FT                   LSPIVPVPTPNEGALNSVNAQLSGLSVSSLSPVITNNLYPSLQPQRDLLASEDIEIPTL
FT                   FPQRTSQNLASSHTYDNFHSNSVLLQPVSLHTATAAAAANQRLPPLPSSHPVLKDGDLQ
FT                   PPNYYEVMEFDPLAPTTEAVYEEIDGYHQKEAQSHSDC"
FT   gene            complement(<12505246..>12520863)
FT                   /locus_tag="mCG_1031981"
FT                   /note="gene_id=mCG1031981.0"
FT   mRNA            complement(join(<12505246..12505332,12506113..12506227,
FT                   12510317..12510631,12520619..>12520863))
FT                   /locus_tag="mCG_1031981"
FT                   /product="mCG1031981"
FT                   /note="gene_id=mCG1031981.0 transcript_id=mCT149685.0
FT                   created on 28-MAR-2003"
FT   CDS             complement(join(12505246..12505332,12506113..12506227,
FT                   12510317..12510631,12520619..12520863))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031981"
FT                   /product="mCG1031981"
FT                   /note="gene_id=mCG1031981.0 transcript_id=mCT149685.0
FT                   protein_id=mCP85169.0"
FT                   /protein_id="EDL15892.1"
FT                   /translation="MKIVQQMQKAAITSRAEEEQRRDLVIQRGFAQAEIKTPKEKCIWY
FT                   RMQSPAFWRKPQLLITRAAAFSAVKGKLAGRRRLQVRGASKEILSEVEHNLQDATQVCR
FT                   NVQLDPQLVPGCGASEIAVAHDLTEKSKAMTGVEQWPYRAVAQALEAMPRTWIQNCGAS
FT                   TICLLTSLRAKHTQESCETWGVNRACEWPLGHPEREMKSECLIGLDFTTQYLMVFVLNC
FT                   QNKPSEVLTQQKIHSTFKQQKGRLKAAEGHS"
FT   gene            12533675..12545441
FT                   /locus_tag="mCG_147544"
FT                   /note="gene_id=mCG147544.0"
FT   mRNA            join(12533675..12533845,12545044..12545441)
FT                   /locus_tag="mCG_147544"
FT                   /product="mCG147544"
FT                   /note="gene_id=mCG147544.0 transcript_id=mCT187807.0
FT                   created on 13-JAN-2004"
FT   CDS             12545312..12545416
FT                   /codon_start=1
FT                   /locus_tag="mCG_147544"
FT                   /product="mCG147544"
FT                   /note="gene_id=mCG147544.0 transcript_id=mCT187807.0
FT                   protein_id=mCP109310.0"
FT                   /protein_id="EDL15893.1"
FT                   /translation="MPIIDISNDHRKCDLSLKSLPSALYIVFFQNEAK"
FT   gene            complement(13223219..13225486)
FT                   /locus_tag="mCG_54287"
FT                   /note="gene_id=mCG54287.2"
FT   mRNA            complement(13223219..13225486)
FT                   /locus_tag="mCG_54287"
FT                   /product="mCG54287"
FT                   /note="gene_id=mCG54287.2 transcript_id=mCT54470.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(13223382..13225388)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54287"
FT                   /product="mCG54287"
FT                   /note="gene_id=mCG54287.2 transcript_id=mCT54470.2
FT                   protein_id=mCP35276.1"
FT                   /db_xref="GOA:A2RSC8"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="MGI:MGI:1920720"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSC8"
FT                   /protein_id="EDL15894.1"
FT                   /translation="MASQFCLPLAPRLSPLKPLKSHFTDFQVGICVAIQRSDKRIHLAV
FT                   VTEINRENSWVTVEWVEKGVKKGKKIELETVLLLNPALASLEHQRSRRPLRPVSVVPST
FT                   AIGDQRTATKWIAMIPHRNETPSGDSQTLMIPSNPCLMKRKKSPCLREIEKLQKQREKR
FT                   RRLQLEIRARRALDINTGNPNFETMRMIEEYRRRLDSSKMSSLEPPEDHRICVCVRKRP
FT                   LNQRETTMKDLDIITIPSHNVVMVHESKQKVDLTRYLENQTFCFDHAFDDKASNELVYQ
FT                   FTARPLVESIFRKGMATCFAYGQTGSGKTHTMGGAFLGKAQDCSKGIYALVAQDVFLLL
FT                   KTPAYEKLELKVYGTFFEIYGGKVYDLLNWKKKLQVLEDGNQQVQVVGLQEQEVSCVEE
FT                   VLNLVELGNSCRTSGQTSVNAHSSRSHAVFQLILKAGGKLHGKFSLVDLAGNERGADTA
FT                   KATRKRQLEGAEINKSLLALKECIRALGKNKSHTPFRASKLTQVLRDSFIGQNSYTCMI
FT                   ATISPGMTSCENTLNTLRYANRVKELALEARPYHHCVSPPGHEVPLMIENDNTNSGKSL
FT                   QRDEVIQIPTVEKEEEKESDELTSKKEPAASWSRSNQWWEAIQETAEGVNGDVDFCIAQ
FT                   SLSVLEQKIGVLTDIQKKLQSLREDLQKKSQVE"
FT   gene            13797229..13801734
FT                   /locus_tag="mCG_147539"
FT                   /note="gene_id=mCG147539.0"
FT   mRNA            join(13797229..13797286,13798047..13801734)
FT                   /locus_tag="mCG_147539"
FT                   /product="mCG147539"
FT                   /note="gene_id=mCG147539.0 transcript_id=mCT187802.0
FT                   created on 13-JAN-2004"
FT   CDS             13798618..13798878
FT                   /codon_start=1
FT                   /locus_tag="mCG_147539"
FT                   /product="mCG147539"
FT                   /note="gene_id=mCG147539.0 transcript_id=mCT187802.0
FT                   protein_id=mCP109305.0"
FT                   /protein_id="EDL15895.1"
FT                   /translation="MRMKHFSVIEGIQDKGKIGSSLLFLNFSLFIHGKKSHGYIGLLIL
FT                   ILHCVPIFNTCYNLIDLPPKTSVQQNTPFLPLRYLKRWGPE"
FT   gene            14740757..15265832
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /note="gene_id=mCG1462.3"
FT   mRNA            join(14740757..14740838,14742375..14743015,
FT                   14830395..14830469,14958896..14959038,15155300..15156186)
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /product="carbonic anhydrase 10, transcript variant
FT                   mCT185729"
FT                   /note="gene_id=mCG1462.3 transcript_id=mCT185729.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(14741133..14741451,14742375..14743015,
FT                   14830395..14830469,14958896..14959038,15030800..15031362)
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /product="carbonic anhydrase 10, transcript variant
FT                   mCT8187"
FT                   /note="gene_id=mCG1462.3 transcript_id=mCT8187.2 created on
FT                   10-JUN-2003"
FT   mRNA            join(14741139..14741451,14742375..14743015,
FT                   14830395..14830469,14958896..14959038,15155300..15155489,
FT                   15243253..15243323,15247504..15247576,15261672..15261826,
FT                   15263782..15263956,15264874..15265832)
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /product="carbonic anhydrase 10, transcript variant
FT                   mCT180860"
FT                   /note="gene_id=mCG1462.3 transcript_id=mCT180860.0 created
FT                   on 10-JUN-2003"
FT   mRNA            join(14741218..14741451,14742372..14743015,
FT                   14830395..14830469,14958896..14959038,15155300..15156186)
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /product="carbonic anhydrase 10, transcript variant
FT                   mCT185728"
FT                   /note="gene_id=mCG1462.3 transcript_id=mCT185728.0 created
FT                   on 10-JUN-2003"
FT   CDS             join(14742955..14743015,14830395..14830469,
FT                   14958896..14959038,15155300..15155489,15243253..15243254)
FT                   /codon_start=1
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /product="carbonic anhydrase 10, isoform CRA_a"
FT                   /note="gene_id=mCG1462.3 transcript_id=mCT180860.0
FT                   protein_id=mCP103782.0 isoform=CRA_a"
FT                   /protein_id="EDL15896.1"
FT                   /translation="MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVP
FT                   VPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRH
FT                   VSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEV"
FT   CDS             join(14742955..14743015,14830395..14830469,
FT                   14958896..14959038,15155300..15155530)
FT                   /codon_start=1
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /product="carbonic anhydrase 10, isoform CRA_b"
FT                   /note="gene_id=mCG1462.3 transcript_id=mCT185728.0
FT                   protein_id=mCP106987.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TRQ4"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018423"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="MGI:MGI:1919855"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TRQ4"
FT                   /protein_id="EDL15897.1"
FT                   /translation="MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVP
FT                   VPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRH
FT                   VSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVCAPAKVL
FT                   RHRANL"
FT   CDS             join(14742955..14743015,14830395..14830469,
FT                   14958896..14959038,15155300..15155530)
FT                   /codon_start=1
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /product="carbonic anhydrase 10, isoform CRA_b"
FT                   /note="gene_id=mCG1462.3 transcript_id=mCT185729.0
FT                   protein_id=mCP106986.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TRQ4"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018423"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="MGI:MGI:1919855"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TRQ4"
FT                   /protein_id="EDL15898.1"
FT                   /translation="MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVP
FT                   VPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRH
FT                   VSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVCAPAKVL
FT                   RHRANL"
FT   CDS             join(14742955..14743015,14830395..14830469,
FT                   14958896..14959038,15030800..15030832)
FT                   /codon_start=1
FT                   /gene="Car10"
FT                   /locus_tag="mCG_1462"
FT                   /product="carbonic anhydrase 10, isoform CRA_c"
FT                   /note="gene_id=mCG1462.3 transcript_id=mCT8187.2
FT                   protein_id=mCP14112.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q9CZQ3"
FT                   /db_xref="InterPro:IPR001148"
FT                   /db_xref="InterPro:IPR018423"
FT                   /db_xref="InterPro:IPR023561"
FT                   /db_xref="MGI:MGI:1919855"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CZQ3"
FT                   /protein_id="EDL15899.1"
FT                   /translation="MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVP
FT                   VPSFWGLVNSAWNLCSVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKDCSVMEVLEE"
FT   gene            complement(14814700..14815431)
FT                   /locus_tag="mCG_48744"
FT                   /note="gene_id=mCG48744.2"
FT   mRNA            complement(14814700..14815431)
FT                   /locus_tag="mCG_48744"
FT                   /product="mCG48744"
FT                   /note="gene_id=mCG48744.2 transcript_id=mCT48927.2 created
FT                   on 25-OCT-2002"
FT   CDS             complement(14814976..14815305)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48744"
FT                   /product="mCG48744"
FT                   /note="gene_id=mCG48744.2 transcript_id=mCT48927.2
FT                   protein_id=mCP35297.2"
FT                   /protein_id="EDL15900.1"
FT                   /translation="MAYQLYRNTTLGNSLQESLDELIQSQQITPQLVLQVLLQFDKAIN
FT                   SALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTG
FT                   SNTTE"
FT   gene            complement(15516157..>15542682)
FT                   /gene="Utp18"
FT                   /locus_tag="mCG_1467"
FT                   /note="gene_id=mCG1467.2"
FT   mRNA            complement(join(15516157..15516956,15517682..15517725,
FT                   15518846..15518988,15523247..15523421,15525230..15525353,
FT                   15526694..15527468,15532664..15532838,15532935..15533060,
FT                   15534865..15534953,15536945..15537015,15538960..15539058,
FT                   15540640..15540755,15542306..>15542682))
FT                   /gene="Utp18"
FT                   /locus_tag="mCG_1467"
FT                   /product="UTP18, small subunit (SSU) processome component,
FT                   homolog (yeast), transcript variant mCT190997"
FT                   /note="gene_id=mCG1467.2 transcript_id=mCT190997.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(15516158..15516956,15517682..15517725,
FT                   15518846..15518988,15523247..15523421,15525230..15525353,
FT                   15526694..15526784,15527368..15527468,15532664..15532838,
FT                   15532935..15533060,15534865..15534953,15536945..15537015,
FT                   15538960..15539058,15540640..15540755,15542306..15542671))
FT                   /gene="Utp18"
FT                   /locus_tag="mCG_1467"
FT                   /product="UTP18, small subunit (SSU) processome component,
FT                   homolog (yeast), transcript variant mCT8192"
FT                   /note="gene_id=mCG1467.2 transcript_id=mCT8192.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(15517701..15517725,15518846..15518988,
FT                   15523247..15523421,15525230..15525353,15526694..15526784,
FT                   15527368..15527468,15532664..15532838,15532935..15533060,
FT                   15534865..15534953,15536945..15537015,15538960..15539058,
FT                   15540640..15540755,15542306..15542629))
FT                   /codon_start=1
FT                   /gene="Utp18"
FT                   /locus_tag="mCG_1467"
FT                   /product="UTP18, small subunit (SSU) processome component,
FT                   homolog (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG1467.2 transcript_id=mCT8192.2
FT                   protein_id=mCP14117.2 isoform=CRA_b"
FT                   /protein_id="EDL15902.1"
FT                   /translation="MPPERKSRTRRDRRAGATPGRKARPGSGSTPAKAARSSQRTQPAE
FT                   PRAAPSAGSAAAAAEEEESRLRQRNRLTLEDDKPAAERCLEQLVFGDVEDDEDALLQRL
FT                   RSSRGQLHGSSDESEVENEAKDIFSQKKKQPVWVDEDDEDEEIVDMSNNRFRKDIMKNA
FT                   SESKLSKDKLQKRLKEEFQHAMGGVPDWAEAGSKQRTSSDDESEEDEDDLLQRTGNFIS
FT                   TSTSLPRGILKMKNCRPANAERPTTARISSVQFHPGAQVVMVSGVDNAISLFQVDGKTN
FT                   PKIQSIYLEKFPIFKACFSANGEEVLATSMHSKVLYVYDMLAGKLIPVHQVRGLKEKTV
FT                   KQFEVSPDGSFLLIGGIAGFSHLLSMKTKELIGSMKINGRIAASTFSSDSKRIYTYSEN
FT                   GEVYVWDVNSRKCMNRFLDEGSLCGLSIAASKNGQYVACGSKSGVVNIYNQDSCLQQTN
FT                   PKPIKAIMNLVTGVTSLAFNPTTEILAVASRKMKEAVRLVHLPSCTVFSNFPVFKKSTL
FT                   SRVQTMDFSPRGGYFALGNEKGRALMYRLHHYSDF"
FT   CDS             complement(join(15527296..15527468,15532664..15532838,
FT                   15532935..15533060,15534865..15534953,15536945..15537015,
FT                   15538960..15539058,15540640..15540755,15542306..>15542680))
FT                   /codon_start=1
FT                   /gene="Utp18"
FT                   /locus_tag="mCG_1467"
FT                   /product="UTP18, small subunit (SSU) processome component,
FT                   homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG1467.2 transcript_id=mCT190997.0
FT                   protein_id=mCP111970.0 isoform=CRA_a"
FT                   /protein_id="EDL15901.1"
FT                   /translation="CAVVLHVNVGVFPSALRMPPERKSRTRRDRRAGATPGRKARPGSG
FT                   STPAKAARSSQRTQPAEPRAAPSAGSAAAAAEEEESRLRQRNRLTLEDDKPAAERCLEQ
FT                   LVFGDVEDDEDALLQRLRSSRGQLHGSSDESEVENEAKDIFSQKKKQPVWVDEDDEDEE
FT                   IVDMSNNRFRKDIMKNASESKLSKDKLQKRLKEEFQHAMGGVPDWAEAGSKQRTSSDDE
FT                   SEEDEDDLLQRTGNFISTSTSLPRGILKMKNCRPANAERPTTARISSVQFHPGAQVVMV
FT                   SGVDNAISLFQVDGKTNPKIQSIYLEKFPIFKACFSANGEEVLATSMHSKVLYVYDMLA
FT                   GKLIPVHQVRGLKEKTVKQFEVSPDGSFLLIGGIAGFSHLLSMKVNHVLSSCFPSGSKA
FT                   RVKDSLEL"
FT   gene            <15542822..15606536
FT                   /locus_tag="mCG_1463"
FT                   /note="gene_id=mCG1463.3"
FT   mRNA            join(<15542822..15543034,15561871..15562070,
FT                   15565555..15565688,15567034..15567157,15569127..15569209,
FT                   15578120..15578237,15579899..15580033,15580544..15580632,
FT                   15581178..15581412,15582420..15582475,15582975..15583079,
FT                   15589128..15589275,15591321..15591403,15591706..15591940,
FT                   15593367..15593444,15603336..15604859)
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, transcript variant mCT191060"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT191060.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(15542838..15543093,15561871..15562070,
FT                   15565555..15565688,15567034..15567157,15569127..15569209,
FT                   15578120..15578237,15579899..15580033,15580544..15580632,
FT                   15581178..15581412,15582420..15582475,15582975..15583079,
FT                   15589128..15589275,15591321..15591403,15591706..15591865,
FT                   15593367..15593444,15603336..15606536)
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, transcript variant mCT8188"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT8188.2 created on
FT                   04-MAR-2003"
FT   mRNA            join(15543180..15543388,15543994..15544050,
FT                   15548096..15548145,15561871..15562070,15565555..15565688,
FT                   15567034..15567157,15569127..15569209,15578120..15578237,
FT                   15579899..15580033,15580544..15580632,15581178..15581412,
FT                   15582420..15582475,15582975..15583079,15589128..15589275,
FT                   15591321..15591403,15591706..15591865,15593367..15593444,
FT                   15603336..15606536)
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, transcript variant mCT174824"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT174824.0 created
FT                   on 04-MAR-2003"
FT   mRNA            join(<15543189..15543388,15543994..15544050,
FT                   15548096..15548145,15561871..15562070,15565555..15565688,
FT                   15567034..15567157,15569127..15569209,15578120..15578237,
FT                   15579899..15580033,15580544..15580632,15581178..15581412,
FT                   15582420..15582475,15582975..15583079,15589128..15589275,
FT                   15591321..15591403,15591706..15591940,15593367..15593444,
FT                   15603223..15604861)
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, transcript variant mCT191062"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT191062.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<15543191..15543388,15561871..15562070,
FT                   15565555..15565688,15567034..15567157,15569127..15569209,
FT                   15578120..15578237,15579899..15580033,15580544..15580632,
FT                   15581178..15581412,15582420..15582475,15582975..15583079,
FT                   15589128..15589275,15591321..15591403,15591706..15591940,
FT                   15593367..15593444,15603336..15604861)
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, transcript variant mCT191061"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT191061.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<15544045..15544050,15548096..15548145,
FT                   15561871..15562070,15565555..15565688,15567034..15567157,
FT                   15569127..15569209,15578120..15578237,15579899..15580033,
FT                   15580544..15580632,15581178..15581412,15582420..15582475,
FT                   15582975..15583079,15589128..15589275,15591321..15591403,
FT                   15591706..15591940,15593367..15593444,15603223..15603248)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, isoform CRA_c"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT191062.0
FT                   protein_id=mCP112005.0 isoform=CRA_c"
FT                   /protein_id="EDL15906.1"
FT                   /translation="RVGFCKPPLRDVMITAIKKQNILHNPKEKADWFGMFDGYDSCSED
FT                   TSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYPDGKSGMATCEMCGMVGVRDAFYSKT
FT                   KRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQ
FT                   AKTKAGNSAISVEGFSWGNYINSNSFIAAPVACFKHAPMGTCWGDISENVRIEVPNTDC
FT                   SLPTKVFWIAGIIKLAGYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVP
FT                   PRTVQHKYTNWKAFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTR
FT                   VAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQDG
FT                   HFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDG
FT                   SEAADGSDWFCYHATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPV
FT                   KLFNKDVPNHGFRVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDC
FT                   ESPDLYPVGWCQLTGYQLQPPASQSSRESQSASSKQKKKAKSQQYKGHKKSTEEMTES"
FT   CDS             join(15548126..15548145,15561871..15562070,
FT                   15565555..15565688,15567034..15567157,15569127..15569209,
FT                   15578120..15578237,15579899..15580033,15580544..15580632,
FT                   15581178..15581412,15582420..15582475,15582975..15583079,
FT                   15589128..15589275,15591321..15591403,15591706..15591865,
FT                   15593367..15593444,15603336..15603454)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, isoform CRA_a"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT174824.0
FT                   protein_id=mCP97743.0 isoform=CRA_a"
FT                   /protein_id="EDL15903.1"
FT                   /translation="MITAIKKQNILHNPKEKADWFGMFDGYDSCSEDTSSSSSSEESEE
FT                   EVAPLPSNLPIIKNNGQVYTYPDGKSGMATCEMCGMVGVRDAFYSKTKRFCSVSCSRSY
FT                   SSNSKKASILARLQGKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSAISV
FT                   EGFSWGNYINSNSFIAAPVACFKHAPMGTCWGDISENVRIEVPNTDCSLPTKVFWIAGI
FT                   IKLAGYNALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRTVQHKYTNWK
FT                   AFLVKRLTGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRL
FT                   RLVYEESEDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQDGHFDTPPHLFAKV
FT                   KEVDQSGEWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAADGSDWFCY
FT                   HATSPSIFPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGF
FT                   RVGMKLEAVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDSSRESQSASSKQK
FT                   KKAKSQQYKGHKKMTTSQLKEELLDGEDYSFLHGASDQESNGSATVYIKQEP"
FT   CDS             join(<15561872..15562070,15565555..15565688,
FT                   15567034..15567157,15569127..15569209,15578120..15578237,
FT                   15579899..15580033,15580544..15580632,15581178..15581412,
FT                   15582420..15582475,15582975..15583079,15589128..15589275,
FT                   15591321..15591403,15591706..15591940,15593367..15593444,
FT                   15603336..15603454)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, isoform CRA_b"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT191060.0
FT                   protein_id=mCP112003.0 isoform=CRA_b"
FT                   /protein_id="EDL15904.1"
FT                   /translation="QNILHNPKEKADWFGMFDGYDSCSEDTSSSSSSEESEEEVAPLPS
FT                   NLPIIKNNGQVYTYPDGKSGMATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKA
FT                   SILARLQGKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSAISVEGFSWGN
FT                   YINSNSFIAAPVACFKHAPMGTCWGDISENVRIEVPNTDCSLPTKVFWIAGIIKLAGYN
FT                   ALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRTVQHKYTNWKAFLVKRL
FT                   TGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEES
FT                   EDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQDGHFDTPPHLFAKVKEVDQSG
FT                   EWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAADGSDWFCYHATSPSI
FT                   FPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGFRVGMKLE
FT                   AVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQ
FT                   PPASQSSRESQSASSKQKKKAKSQQYKGHKKMTTSQLKEELLDGEDYSFLHGASDQESN
FT                   GSATVYIKQEP"
FT   CDS             join(<15561872..15562070,15565555..15565688,
FT                   15567034..15567157,15569127..15569209,15578120..15578237,
FT                   15579899..15580033,15580544..15580632,15581178..15581412,
FT                   15582420..15582475,15582975..15583079,15589128..15589275,
FT                   15591321..15591403,15591706..15591940,15593367..15593444,
FT                   15603336..15603454)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, isoform CRA_b"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT191061.0
FT                   protein_id=mCP112004.0 isoform=CRA_b"
FT                   /protein_id="EDL15905.1"
FT                   /translation="QNILHNPKEKADWFGMFDGYDSCSEDTSSSSSSEESEEEVAPLPS
FT                   NLPIIKNNGQVYTYPDGKSGMATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKA
FT                   SILARLQGKPPTKKAKVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSAISVEGFSWGN
FT                   YINSNSFIAAPVACFKHAPMGTCWGDISENVRIEVPNTDCSLPTKVFWIAGIIKLAGYN
FT                   ALLRYEGFENDSSLDFWCNICGSDIHPVGWCAASGKPLVPPRTVQHKYTNWKAFLVKRL
FT                   TGAKTLPPDFSQKVSESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEES
FT                   EDRTDDFWCHMHSPLIHHIGWSRSIGHRFKRSDITKKQDGHFDTPPHLFAKVKEVDQSG
FT                   EWFKEGMKLEAIDPLNLSTICVATIRKVLADGFLMIGIDGSEAADGSDWFCYHATSPSI
FT                   FPVGFCEINMIELTPPRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGFRVGMKLE
FT                   AVDLMEPRLICVATVTRIIHRLLRIHFDGWEEEYDQWVDCESPDLYPVGWCQLTGYQLQ
FT                   PPASQSSRESQSASSKQKKKAKSQQYKGHKKMTTSQLKEELLDGEDYSFLHGASDQESN
FT                   GSATVYIKQEP"
FT   CDS             join(15561917..15562070,15565555..15565688,
FT                   15567034..15567157,15569127..15569209,15578120..15578237,
FT                   15579899..15580033,15580544..15580632,15581178..15581412,
FT                   15582420..15582475,15582975..15583079,15589128..15589275,
FT                   15591321..15591403,15591706..15591865,15593367..15593444,
FT                   15603336..15603454)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1463"
FT                   /product="mCG1463, isoform CRA_d"
FT                   /note="gene_id=mCG1463.3 transcript_id=mCT8188.2
FT                   protein_id=mCP14113.2 isoform=CRA_d"
FT                   /protein_id="EDL15907.1"
FT                   /translation="MFDGYDSCSEDTSSSSSSEESEEEVAPLPSNLPIIKNNGQVYTYP
FT                   DGKSGMATCEMCGMVGVRDAFYSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKA
FT                   KVLQKQPLVAKLAAYAQYQATLQNQAKTKAGNSAISVEGFSWGNYINSNSFIAAPVACF
FT                   KHAPMGTCWGDISENVRIEVPNTDCSLPTKVFWIAGIIKLAGYNALLRYEGFENDSSLD
FT                   FWCNICGSDIHPVGWCAASGKPLVPPRTVQHKYTNWKAFLVKRLTGAKTLPPDFSQKVS
FT                   ESMQYPFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHMHSPL
FT                   IHHIGWSRSIGHRFKRSDITKKQDGHFDTPPHLFAKVKEVDQSGEWFKEGMKLEAIDPL
FT                   NLSTICVATIRKVLADGFLMIGIDGSEAADGSDWFCYHATSPSIFPVGFCEINMIELTP
FT                   PRGYTKLPFKWFDYLRETGSIAAPVKLFNKDVPNHGFRVGMKLEAVDLMEPRLICVATV
FT                   TRIIHRLLRIHFDGWEEEYDQWVDSSRESQSASSKQKKKAKSQQYKGHKKMTTSQLKEE
FT                   LLDGEDYSFLHGASDQESNGSATVYIKQEP"
FT   gene            complement(15609398..15615825)
FT                   /locus_tag="mCG_1461"
FT                   /note="gene_id=mCG1461.2"
FT   mRNA            complement(join(15609398..15609628,15611478..15611590,
FT                   15612379..15612480,15615064..15615193,15615395..15615825))
FT                   /locus_tag="mCG_1461"
FT                   /product="mCG1461, transcript variant mCT174823"
FT                   /note="gene_id=mCG1461.2 transcript_id=mCT174823.0 created
FT                   on 18-NOV-2002"
FT   mRNA            complement(join(15609398..15609628,15611478..15611590,
FT                   15612379..15612480,15615064..15615252))
FT                   /locus_tag="mCG_1461"
FT                   /product="mCG1461, transcript variant mCT8186"
FT                   /note="gene_id=mCG1461.2 transcript_id=mCT8186.2 created on
FT                   18-NOV-2002"
FT   CDS             complement(join(15609511..15609628,15611478..15611590,
FT                   15612379..15612480,15615064..15615189))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1461"
FT                   /product="mCG1461, isoform CRA_a"
FT                   /note="gene_id=mCG1461.2 transcript_id=mCT174823.0
FT                   protein_id=mCP97742.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5NC82"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="MGI:MGI:97356"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NC82"
FT                   /protein_id="EDL15908.1"
FT                   /translation="MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASE
FT                   EHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTI
FT                   RGDFCIQVGRNIIHGSDSVESAEKEIHLWFKPEELIDYKSCAHDWVYE"
FT   CDS             complement(join(15609511..15609628,15611478..15611590,
FT                   15612379..15612480,15615064..15615189))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1461"
FT                   /product="mCG1461, isoform CRA_a"
FT                   /note="gene_id=mCG1461.2 transcript_id=mCT8186.2
FT                   protein_id=mCP14111.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q5NC82"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="MGI:MGI:97356"
FT                   /db_xref="UniProtKB/TrEMBL:Q5NC82"
FT                   /protein_id="EDL15909.1"
FT                   /translation="MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASE
FT                   EHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTI
FT                   RGDFCIQVGRNIIHGSDSVESAEKEIHLWFKPEELIDYKSCAHDWVYE"
FT   gene            complement(15616546..>15625906)
FT                   /locus_tag="mCG_145251"
FT                   /note="gene_id=mCG145251.0"
FT   mRNA            complement(join(15616546..15619086,15620637..15620749,
FT                   15623199..15623300,15625776..>15625906))
FT                   /locus_tag="mCG_145251"
FT                   /product="mCG145251"
FT                   /note="gene_id=mCG145251.0 transcript_id=mCT184675.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(15618969..15619086,15620637..15620749,
FT                   15623199..15623300,15625776..>15625904))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145251"
FT                   /product="mCG145251"
FT                   /note="gene_id=mCG145251.0 transcript_id=mCT184675.0
FT                   protein_id=mCP105667.0"
FT                   /protein_id="EDL15910.1"
FT                   /translation="TMANSERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVGLKFLQAS
FT                   EDLLKEHYTDLKDRPFFTGLVKYMHSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGT
FT                   IRGDFCIQVGRNIIHGSDSVKSAEKEISLWFQPEELVEYKSCAQNWIYE"
FT   gene            15640623..15786929
FT                   /gene="Spag9"
FT                   /locus_tag="mCG_115147"
FT                   /note="gene_id=mCG115147.1"
FT   mRNA            join(15640623..15640929,15657471..15657591,
FT                   15695717..15695766,15699481..15699631,15725827..15726034,
FT                   15726869..15726968,15729492..15729613,15738820..15738877,
FT                   15740238..15740390,15741426..15741477,15743711..15743841,
FT                   15747066..15747122,15748031..15748204,15749274..15749403,
FT                   15749843..15749932,15750817..15750988,15754546..15754764,
FT                   15755009..15755204,15756355..15756480,15757435..15757515,
FT                   15759388..15759488,15763751..15763902,15768038..15768190,
FT                   15769859..15770030,15773129..15773242,15774359..15774397,
FT                   15775269..15775445,15777840..15777989,15783572..15783687,
FT                   15786234..15786929)
FT                   /gene="Spag9"
FT                   /locus_tag="mCG_115147"
FT                   /product="sperm associated antigen 9"
FT                   /note="gene_id=mCG115147.1 transcript_id=mCT116247.1
FT                   created on 16-SEP-2002"
FT   CDS             join(15657580..15657591,15695717..15695766,
FT                   15699481..15699631,15725827..15726034,15726869..15726968,
FT                   15729492..15729613,15738820..15738877,15740238..15740390,
FT                   15741426..15741477,15743711..15743841,15747066..15747122,
FT                   15748031..15748204,15749274..15749403,15749843..15749932,
FT                   15750817..15750988,15754546..15754764,15755009..15755204,
FT                   15756355..15756480,15757435..15757515,15759388..15759488,
FT                   15763751..15763902,15768038..15768073)
FT                   /codon_start=1
FT                   /gene="Spag9"
FT                   /locus_tag="mCG_115147"
FT                   /product="sperm associated antigen 9"
FT                   /note="gene_id=mCG115147.1 transcript_id=mCT116247.1
FT                   protein_id=mCP85407.1"
FT                   /protein_id="EDL15911.1"
FT                   /translation="MLTRIQTMENGLELGCLLICRKERPISLGIFPLPAGDGLLTPDTQ
FT                   KGGETPGSEQWKFQELSQPRSHTSLKDELSDISQGGSKATTPASTANSDVSAIPPDTPS
FT                   KEDNEGFVKGTDTSNKSEISKHIEVQVAQETRNVSTESGENEEKSEVQAIIESTPELDM
FT                   DKDLSGYKGSSTPTKGIENKAFDRNTESLFEELSSAGSGLIGDVDEGADLLGMGREVEN
FT                   LILENTQLLETKNALNVVKNDLIAKVDELTCEKDVLQGELEAVKQAKLKLEDKNRELEE
FT                   ELRKARAEAEDARQKAKDDDDSDIPTAQRKRFTRVEMARVLMERNQYKERLMELQEAVR
FT                   WTEMIRASRENPAMQEKKRSSIWQFFSRLFSSSSNATKKPEPPVNLKYNAPTSHVTPSV
FT                   KKRSSTLSQLPGDKSKAFDFLSEETEASLASRREQKREQYRQVKAHVQKEDGRVQAFGW
FT                   SLPQKYKQVANGQGETKMKNLPVPVYLRPLDEKDASMKEQQKEFKNQEELSSQVWICTS
FT                   THSTTKVIIIDAVQPGNILDSFTVCNSHVLCIASVPGARETDYPAGEELSESGQVDKAS
FT                   LCGSMTSNSSAEMDSLLGGITVVGCSTEGLTGAATSPSTNGASPVIEKPPEMETENSEV
FT                   DENIPTAEEATEATEGNAGSTEDTVDISQPGVYTEHVFTDPLGVQIPEDLSPVFQSSND
FT                   SDVYKDQISVLPNEQDLAREEAQKMSSLLPTMWLGAQNGCLYVHSSVAQWRKCLHSIKL
FT                   KDSILSIVGGSEILFPICRHVKGIVLVALADGTLAIFHRGVGVNLSGGKTRDGGSVVGA
FT                   SVFYKDIAGLDTEGSKQRSASQSSLDKLDQELKMDNGICQTITF"
FT   gene            15759937..15761515
FT                   /locus_tag="mCG_1050997"
FT                   /note="gene_id=mCG1050997.0"
FT   mRNA            join(15759937..15760856,15760888..15761011,
FT                   15761071..15761515)
FT                   /locus_tag="mCG_1050997"
FT                   /product="mCG1050997"
FT                   /note="gene_id=mCG1050997.0 transcript_id=mCT194786.0
FT                   created on 27-JAN-2005"
FT   CDS             15760518..15760640
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050997"
FT                   /product="mCG1050997"
FT                   /note="gene_id=mCG1050997.0 transcript_id=mCT194786.0
FT                   protein_id=mCP115815.0"
FT                   /protein_id="EDL15912.1"
FT                   /translation="MHVCVRVLDSPRTGVTESCVSCYMGARNIAQVLWKSSQCS"
FT   gene            <15875329..>15876414
FT                   /locus_tag="mCG_10620"
FT                   /note="gene_id=mCG10620.0"
FT   mRNA            <15875329..>15876414
FT                   /locus_tag="mCG_10620"
FT                   /product="mCG10620"
FT                   /note="gene_id=mCG10620.0 transcript_id=mCT10837.1 created
FT                   on 09-AUG-2002"
FT   CDS             15875329..15876414
FT                   /codon_start=1
FT                   /locus_tag="mCG_10620"
FT                   /product="mCG10620"
FT                   /note="gene_id=mCG10620.0 transcript_id=mCT10837.1
FT                   protein_id=mCP7906.0"
FT                   /protein_id="EDL15913.1"
FT                   /translation="MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWY
FT                   PEKPYKGSGFRCIHVGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIG
FT                   EKGPVKVLYVDDSSETGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAV
FT                   SPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSSKVARTSPINLGLTVNVNDLLKQK
FT                   AISSSVHSLYGLGLGSQQQPQPQPQQQQQQPPSSQPPPPLPQQQQQQPQQQQQQQQQTS
FT                   ALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDG
FT                   LNFSLNNMQYSNQQFQPVMAN"
FT   gene            complement(15897635..15898254)
FT                   /locus_tag="mCG_147537"
FT                   /note="gene_id=mCG147537.0"
FT   mRNA            complement(15897635..15898254)
FT                   /locus_tag="mCG_147537"
FT                   /product="mCG147537"
FT                   /note="gene_id=mCG147537.0 transcript_id=mCT187800.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(15897639..15898070)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147537"
FT                   /product="mCG147537"
FT                   /note="gene_id=mCG147537.0 transcript_id=mCT187800.0
FT                   protein_id=mCP109303.0"
FT                   /protein_id="EDL15914.1"
FT                   /translation="MCCGLPRKSPKICFGSKRNKEDKGRRIRGQPRHQRGCGPRENEHC
FT                   LMLPSSGAYGHLQGSGGKIYLGGAWEGPLGDGSSEITCFFWSQIQRHCVEDLEPLCHLC
FT                   ICPVPSSDLHSVDIPPKEALWDALMASSNIRRTIINKIS"
FT   gene            complement(<15899275..15907745)
FT                   /gene="Wfikkn2"
FT                   /locus_tag="mCG_52859"
FT                   /note="gene_id=mCG52859.2"
FT   mRNA            complement(join(<15899275..15900795,15904084..15904308,
FT                   15907433..15907745))
FT                   /gene="Wfikkn2"
FT                   /locus_tag="mCG_52859"
FT                   /product="WAP, follistatin/kazal, immunoglobulin, kunitz
FT                   and netrin domain containing 2"
FT                   /note="gene_id=mCG52859.2 transcript_id=mCT53042.2 created
FT                   on 11-NOV-2002"
FT   CDS             complement(join(15899275..15900795,15904084..15904278))
FT                   /codon_start=1
FT                   /gene="Wfikkn2"
FT                   /locus_tag="mCG_52859"
FT                   /product="WAP, follistatin/kazal, immunoglobulin, kunitz
FT                   and netrin domain containing 2"
FT                   /note="gene_id=mCG52859.2 transcript_id=mCT53042.2
FT                   protein_id=mCP30300.0"
FT                   /protein_id="EDL15915.1"
FT                   /translation="MCAPGYHRFWFHWGLLLLLLLEAPLRGLALPPIRYSHAGICPNDM
FT                   NPNLWVDAQSTCKRECETDQECETYEKCCPNVCGTKSCVAARYMDVKGKKGPVGMPKEA
FT                   TCDHFMCLQQGSECDIWDGQPVCKCKDRCEKEPSFTCASDGLTYYNRCFMDAEACSKGI
FT                   TLSVVTCRYHFTWPNTSPPPPETTVHPTTASPETLGLDMAAPALLNHPVHQSVTVGETV
FT                   SFLCDVVGRPRPELTWEKQLEDRENVVMRPNHVRGNVVVTNIAQLVIYNVQPQDAGIYT
FT                   CTARNVAGVLRADFPLSVVRGGQARATSESSLNGTAFPATECLKPPDSEDCGEEQTRWH
FT                   FDAQANNCLTFTFGHCHHNLNHFETYEACMLACMSGPLATCSLPALQGPCKAYVPRWAY
FT                   NSQTGLCQSFVYGGCEGNGNNFESREACEESCPFPRGNQHCRACKPRQKLVTSFCRSDF
FT                   VILGRVSELTEEQDSGRALVTVDEVLKDEKMGLKFLGREPLEVTLLHVDWTCPCPNVTV
FT                   GETPLIIMGEVDGGMAMLRPDSFVGASSTRRVRKLREVMYKKTCDVLKDFLGLQ"
FT   gene            15947774..>15949103
FT                   /locus_tag="mCG_52858"
FT                   /note="gene_id=mCG52858.2"
FT   mRNA            join(15947774..15947949,15948957..>15949103)
FT                   /locus_tag="mCG_52858"
FT                   /product="mCG52858"
FT                   /note="gene_id=mCG52858.2 transcript_id=mCT53041.1 created
FT                   on 31-MAR-2003"
FT   CDS             join(15947917..15947949,15948957..15949103)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52858"
FT                   /product="mCG52858"
FT                   /note="gene_id=mCG52858.2 transcript_id=mCT53041.1
FT                   protein_id=mCP30299.1"
FT                   /protein_id="EDL15916.1"
FT                   /translation="MRKLPNTLLRKDKDIQRLQDFQEIELLLVKSGNPDWTQHTALPRT
FT                   ETPCYNSNAAKMTY"
FT   gene            complement(15954289..15985210)
FT                   /gene="3300001P08Rik"
FT                   /locus_tag="mCG_10631"
FT                   /note="gene_id=mCG10631.2"
FT   mRNA            complement(join(15954289..15956181,15956287..15956427,
FT                   15959070..15959230,15960034..15960317,15960915..15961076,
FT                   15963114..15963218,15964658..15964732,15966978..15967122,
FT                   15969315..15969354,15972775..15972841,15984938..15985210))
FT                   /gene="3300001P08Rik"
FT                   /locus_tag="mCG_10631"
FT                   /product="RIKEN cDNA 3300001P08"
FT                   /note="gene_id=mCG10631.2 transcript_id=mCT10848.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(15955985..15956181,15956287..15956427,
FT                   15959070..15959230,15960034..15960317,15960915..15961076,
FT                   15963114..15963218,15964658..15964732,15966978..15967122,
FT                   15969315..15969354,15972775..15972841,15984938..15985036))
FT                   /codon_start=1
FT                   /gene="3300001P08Rik"
FT                   /locus_tag="mCG_10631"
FT                   /product="RIKEN cDNA 3300001P08"
FT                   /note="gene_id=mCG10631.2 transcript_id=mCT10848.2
FT                   protein_id=mCP7900.2"
FT                   /protein_id="EDL15917.1"
FT                   /translation="MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPA
FT                   ELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGH
FT                   ARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVE
FT                   QLKEERELLRSTTSTIESFAAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAK
FT                   IKATVEELKEKLRKRTEEPDRDERLKKEKQEREEREKEREREREERERKRRREEEEREK
FT                   ERARDRERRKRSRSRSRHSSRTSDRRCSRSRDHKRSRSRDRRRSRSRDRRRSRSHDRSE
FT                   RKHRSRSRDRRRSKSRDRKSYKHRSKSRDREQDRKSKEKEKKGSDDKKSSVKSSSREKQ
FT                   SEDTNPESKESDTKNEVNGTSEDIKSEVQRKYAQMKMELSRVRRHTKASSEGKDSVVLQ
FT                   NILRYIVLSQLFCSRLRAPISVPLWKLLSTYVI"
FT   gene            <15991399..16003229
FT                   /gene="Ankrd40"
FT                   /locus_tag="mCG_115150"
FT                   /note="gene_id=mCG115150.1"
FT   mRNA            join(<15991399..15991638,15997153..15997301,
FT                   15997690..15998169,16001648..16001829,16002941..16003229)
FT                   /gene="Ankrd40"
FT                   /locus_tag="mCG_115150"
FT                   /product="ankyrin repeat domain 40, transcript variant
FT                   mCT180852"
FT                   /note="gene_id=mCG115150.1 transcript_id=mCT180852.0
FT                   created on 04-MAR-2003"
FT   mRNA            join(<15991399..15991638,15997153..15997301,
FT                   15997690..15998169,16001648..16001829,16002548..16002817)
FT                   /gene="Ankrd40"
FT                   /locus_tag="mCG_115150"
FT                   /product="ankyrin repeat domain 40, transcript variant
FT                   mCT116250"
FT                   /note="gene_id=mCG115150.1 transcript_id=mCT116250.1
FT                   created on 04-MAR-2003"
FT   CDS             join(<15991541..15991638,15997153..15997301,
FT                   15997690..15998169,16001648..16001829,16002941..16002964)
FT                   /codon_start=1
FT                   /gene="Ankrd40"
FT                   /locus_tag="mCG_115150"
FT                   /product="ankyrin repeat domain 40, isoform CRA_a"
FT                   /note="gene_id=mCG115150.1 transcript_id=mCT180852.0
FT                   protein_id=mCP103774.0 isoform=CRA_a"
FT                   /protein_id="EDL15918.1"
FT                   /translation="RLREAAALGDIREVQKLVESGVDVNSQNEVNGWTCLHWACKRNHG
FT                   QVVSYLLQSGADREILTTKGEMPVQLTSRREIRKIMGVEEADEEEEIPQLKKESELPFV
FT                   PNYLANPAFPFIYTPAAEDSTQLQNGGPSPPPVSPPADSSPPLLPPTETPLLGAFPRDH
FT                   SSLALVQNGDISAPSAILRTPESTKPGPVCQPPVSQNRSLFSVPSKPPVSLEPQNGTYA
FT                   GPAPAFQPFFFTGAFPFNMQELVLKVRIQNPSLRENDFIEIELDRQELTYQELLRVSCC
FT                   ELGVNPDQVEKIRKLPNTLLRKKRCIHTD"
FT   CDS             join(<15991541..15991638,15997153..15997301,
FT                   15997690..15998169,16001648..16001829,16002548..16002577)
FT                   /codon_start=1
FT                   /gene="Ankrd40"
FT                   /locus_tag="mCG_115150"
FT                   /product="ankyrin repeat domain 40, isoform CRA_b"
FT                   /note="gene_id=mCG115150.1 transcript_id=mCT116250.1
FT                   protein_id=mCP85116.1 isoform=CRA_b"
FT                   /protein_id="EDL15919.1"
FT                   /translation="RLREAAALGDIREVQKLVESGVDVNSQNEVNGWTCLHWACKRNHG
FT                   QVVSYLLQSGADREILTTKGEMPVQLTSRREIRKIMGVEEADEEEEIPQLKKESELPFV
FT                   PNYLANPAFPFIYTPAAEDSTQLQNGGPSPPPVSPPADSSPPLLPPTETPLLGAFPRDH
FT                   SSLALVQNGDISAPSAILRTPESTKPGPVCQPPVSQNRSLFSVPSKPPVSLEPQNGTYA
FT                   GPAPAFQPFFFTGAFPFNMQELVLKVRIQNPSLRENDFIEIELDRQELTYQELLRVSCC
FT                   ELGVNPDQVEKIRKLPNTLLRKIKDEPRPWN"
FT   gene            complement(16006599..>16056064)
FT                   /gene="Abcc3"
FT                   /locus_tag="mCG_10629"
FT                   /note="gene_id=mCG10629.1"
FT   mRNA            complement(join(16006599..16007083,16009255..16009449,
FT                   16014143..16014309,16015010..16015168,16015291..16015437,
FT                   16017583..16017684,16019485..16019611,16019719..16019918,
FT                   16021264..16021574,16021857..16022034,16022113..16022260,
FT                   16022415..16022526,16023759..16023936,16024237..16024404,
FT                   16026020..16026196,16026284..16026410,16026629..16026695,
FT                   16026942..16027029,16027363..16027509,16027616..16027819,
FT                   16030208..16030300,16030799..16030960,16031059..16031236,
FT                   16034298..16034486,16035552..16035683,16036306..16036367,
FT                   16036588..16036713,16037401..16037538,16037746..16037871,
FT                   16038219..16038395,16056020..>16056064))
FT                   /gene="Abcc3"
FT                   /locus_tag="mCG_10629"
FT                   /product="ATP-binding cassette, sub-family C (CFTR/MRP),
FT                   member 3"
FT                   /note="gene_id=mCG10629.1 transcript_id=mCT10846.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(16006975..16007083,16009255..16009449,
FT                   16014143..16014309,16015010..16015168,16015291..16015437,
FT                   16017583..16017684,16019485..16019611,16019719..16019918,
FT                   16021264..16021574,16021857..16022034,16022113..16022260,
FT                   16022415..16022526,16023759..16023936,16024237..16024404,
FT                   16026020..16026196,16026284..16026410,16026629..16026695,
FT                   16026942..16027029,16027363..16027509,16027616..16027819,
FT                   16030208..16030300,16030799..16030960,16031059..16031236,
FT                   16034298..16034486,16035552..16035683,16036306..16036367,
FT                   16036588..16036713,16037401..16037538,16037746..16037871,
FT                   16038219..16038395,16056020..16056064))
FT                   /codon_start=1
FT                   /gene="Abcc3"
FT                   /locus_tag="mCG_10629"
FT                   /product="ATP-binding cassette, sub-family C (CFTR/MRP),
FT                   member 3"
FT                   /note="gene_id=mCG10629.1 transcript_id=mCT10846.2
FT                   protein_id=mCP7903.2"
FT                   /protein_id="EDL15920.1"
FT                   /translation="MDRLCGSGELGSKFWDSNLSIYTNTPDLTPCFQNSLLAWVPCIYL
FT                   WAALPCYLFYLRHHQLGYIVLSWLSRLKTALGVLLWCVSWVDLFYSFHGLIHGSSPAPV
FT                   FFVTPLVVGITMLLATLLIQYERLRGVQSSGVLIIFWLLCVICAIIPFRSKILSALAEG
FT                   KILDPFRFTTFYIYFALVFCALILSCFKEKPPLFSPENLDTNPCPEASAGFFSRLSFWW
FT                   FTRLAILGYRRPLEDRDLWSLSEEDCSHKVVQRLLEAWQKQQNQASGSQTATAEPKIPG
FT                   EDAVLLKPRPKSKQPSFLRALVRTFTSSLLMSACFNLIQNLLGFVNPQLLSILIRFISD
FT                   PTAPTWWGFLLAGLMFLSSTMQTLILHQYYHCIFVMALRLRTAIIGVIYRKALVITNSV
FT                   KRESTVGEMVNLMSVDAQRFMDVSPFINLLWSAPLQVILAIYFLWQILGPSALAGVAVI
FT                   VLLIPLNGAVSMKMKTYQVKQMKFKDSRIKLMSEILNGIKVLKLYAWEPSFLEQVKGIR
FT                   QSELQLLRKGAYLQAISTFIWICTPFLVTLITLGVYVYVDESNVLDAEKAFVSLSLFNI
FT                   LKIPLNMLPQLISGLTQASVSLKRIQDFLNQNELDPQCVERKTISPGYAITIHNGTFTW
FT                   AQDLPPTLHSLNIQIPKGALVAVVGPVGCGKSSLVSALLGEMEKLEGVVSVKGSVAYVP
FT                   QQAWIQNCTLQENVLFGQPMNPKRYQQALETCALLADLDVLPGGDQTEIGEKGINLSGG
FT                   QRQRVSLARAVYSDANIFLLDDPLSAVDSHVAKHIFDQVIGPEGVLAGKTRVLVTHGIS
FT                   FLPQTDFIIVLAGGQVSEMGHYSALLQHDGSFANFLRNYAPDEDQEDHEALQNANEEVL
FT                   LLEDTLSTHTDLTDNEPAIYEVRKQFMREMSSLSSEGEVQNRTMPKKHTNSLEKEALVT
FT                   KTKETGALIKEEIAETGNVKLSVYWDYAKSMGLCTTLSICLLYGGQSAAAIGANVWLSA
FT                   WSNDAEEHGQQNKTSVRLGLLVMLSAFTMVVGAIQAARLLHEALLHNKIRSPQSFFDTT
FT                   PSGRILNRFSKDIYVIDEVLAPTILMLLNSFFTSISTIMVIVASTPLFMVVVLPLAVLY
FT                   GFVQRFYVATSRQLKRLESISRSPIFSHFSETVTGTSVIRAYGRIQDFKVLSDTKVDNN
FT                   QKSSYPYIASNRWLGVHVEFVGNCVVLFAALFAVIGRNSLNPGLVGLSVSYALQVTMAL
FT                   NWMIRMISDLESNIIAVERVKEYSKTKTEAPWVVESNRAPEGWPTRGMVEFRNYSVRYR
FT                   PGLELVLKNVTVHVQGGEKVGIVGRTGAGKSSMTLCLFRILEAAEGEIVIDGLNVAHIG
FT                   LHDLRSQLTIIPQDPILFSGTLRMNLDPFGRYSEEDIWRALELSHLNTFVSSQPAGLDF
FT                   QCAEGGDNLSVGQRQLVCLARALLRKSRVLVLDEATAAIDLETDDLIQGTIRTQFEDCT
FT                   VLTIAHRLNTIMDYNRVLVLDKGVVAEFDSPVNLIAAGGIFYGMAKDAGLA"
FT   gene            complement(16071763..16138957)
FT                   /locus_tag="mCG_125171"
FT                   /note="gene_id=mCG125171.1"
FT   mRNA            complement(join(16071763..16073013,16073135..16073177,
FT                   16074344..16074513,16074752..16074929,16079055..16079411,
FT                   16079718..16079839,16079938..16080016,16080153..16080223,
FT                   16080467..16080600,16081316..16081425,16082104..16082255,
FT                   16086957..16087010,16089037..16089250,16089690..16089779,
FT                   16090667..16090792,16092339..16092465,16093384..16093568,
FT                   16095981..16096104,16096216..16096316,16097244..16097675,
FT                   16101873..16102069,16102149..16102229,16103746..16103814,
FT                   16106767..16106923,16107003..16107117,16107213..16107398,
FT                   16108065..16108216,16121682..16122058,16123816..16124599,
FT                   16126614..16126706,16126872..16127172,16128104..16128263,
FT                   16130165..16130262,16130587..16130720,16130877..16130989,
FT                   16138296..16138957))
FT                   /locus_tag="mCG_125171"
FT                   /product="mCG125171"
FT                   /note="gene_id=mCG125171.1 transcript_id=mCT126428.1
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(16072877..16073013,16073135..16073177,
FT                   16074344..16074513,16074752..16074929,16079055..16079411,
FT                   16079718..16079839,16079938..16080016,16080153..16080223,
FT                   16080467..16080600,16081316..16081425,16082104..16082255,
FT                   16086957..16087010,16089037..16089250,16089690..16089779,
FT                   16090667..16090792,16092339..16092465,16093384..16093568,
FT                   16095981..16096104,16096216..16096316,16097244..16097675,
FT                   16101873..16102069,16102149..16102229,16103746..16103814,
FT                   16106767..16106923,16107003..16107117,16107213..16107398,
FT                   16108065..16108216,16121682..16122058,16123816..16124599,
FT                   16126614..16126706,16126872..16127172,16128104..16128263,
FT                   16130165..16130262,16130587..16130720,16130877..16130939))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125171"
FT                   /product="mCG125171"
FT                   /note="gene_id=mCG125171.1 transcript_id=mCT126428.1
FT                   protein_id=mCP85014.1"
FT                   /protein_id="EDL15921.1"
FT                   /translation="MGMFRPCEDIACDSQRCRILQAFDDFIFAFFAVEMVVKMVALGIF
FT                   GKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVRTVRVLRPLRAINRVPSMRILV
FT                   TLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNRCFLPENFSLPLSVDLEPYYQ
FT                   TENEDESPFICSQPRENGMRSCRSVPTLRGEGGGGPPCGLDYEAYNSSSNTTCVNWNQY
FT                   YTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIMYFVMDAHSFYNFIYFILL
FT                   IIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNASTLASFSEPGSCYEELL
FT                   KYLVYILRKAARRLAQVSRAVGVRAGLLSSPVARGGQEPQPSGSCSRSHRRLSVHHLVH
FT                   HHHHHHHHYHLGNGTLRVPRASPEIQDRDANGSRWLMLPPPSTPTPSGGPPRGAESVHS
FT                   FYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPEMLKDKALVEVAPSP
FT                   GPPTLTSFNIPPGPFSSMHKLLETQSTGACHSSCKISSPCSKADSGACGPDSCPYCART
FT                   GAGEPESADHEMPDSDSEAVYEFTQDAQHSDLRDPHRRRRPSLGPDAEPSSVLAFWRLI
FT                   CDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNIVFTSLFALEML
FT                   LKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMRVLKLVRFLPA
FT                   LQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTLPDRKNFDSL
FT                   LWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLVAILVGGFP
FT                   GRGNRQTGRYEWTVKLYSAACQLPGDATKSESEPDFFSPSVDGDGDRKKRLALVALGEH
FT                   SELRKSLLPPLIIHTAATPMSLPKSSSTGVGEALGSGSRRTSSSGSAEPGTAHHEMKSP
FT                   PSARSSPHSPWSAASSWTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQDEEES
FT                   SEEDRASPAGSDHRHRGSLEREAKSSFDLPDTLQVPGLHRTASGRSSASEHQDCNGKSA
FT                   SGRLARTLRADDPPLDGDDGDDEGNLSKGERLRAWVRARLPACCRERDSWSAYIFPPQS
FT                   RFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAVVALGWCFGEQAYLRSS
FT                   WNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLRPLRVISRAQGLKLVVET
FT                   LMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRWV
FT                   RHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL
FT                   IVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLKRLEKKRRSKEKQMADLMLDD
FT                   VIASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHY
FT                   QQPQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMGITL
FT                   EEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLFM
FT                   LLFFIFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMKD
FT                   TLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEA
FT                   ELELEMKTLSPQPHSPLGSPFLWPGVEGVNSPDSPKPGAPHTTAHIGAASSGFSLEHPT
FT                   MVPHTEEGPVPLGPDLLTVRKSGVSRTHSLPNDSYMCRNGSTAERSLGHRGWGLPKAQS
FT                   GSILSVHSQPADTSCILQLPKDAHYLLQPHGAPTWGAIPKLPPPGRSPLAQRPLRRQAA
FT                   IRTDSLDVQGLGRRVEHPGAAALRQPEQSLQAHPACQPLAQAWNPAGPRTLKRPEAA"
FT   gene            complement(16143805..16151044)
FT                   /gene="Spata20"
FT                   /locus_tag="mCG_10636"
FT                   /note="gene_id=mCG10636.1"
FT   mRNA            complement(join(16143805..16144168,16144341..16144421,
FT                   16145300..16145499,16146507..16146718,16146974..16147142,
FT                   16147388..16147580,16147663..16147872,16147970..16148044,
FT                   16148266..16148370,16148468..16148598,16148834..16149035,
FT                   16149153..16149296,16149372..16149526,16149639..16149703,
FT                   16149802..16149984,16150940..16151044))
FT                   /gene="Spata20"
FT                   /locus_tag="mCG_10636"
FT                   /product="spermatogenesis associated 20, transcript variant
FT                   mCT10853"
FT                   /note="gene_id=mCG10636.1 transcript_id=mCT10853.2 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(16143807..16144168,16144341..16144421,
FT                   16145300..16145499,16146507..16146718,16146974..16147142,
FT                   16147388..16147580,16147663..16147872,16147970..16148044,
FT                   16148266..16148370,16148468..16148598,16148834..16149035,
FT                   16149153..16149296,16149372..16149526,16149639..16149703,
FT                   16149802..16149984,16150095..>16150195))
FT                   /gene="Spata20"
FT                   /locus_tag="mCG_10636"
FT                   /product="spermatogenesis associated 20, transcript variant
FT                   mCT191001"
FT                   /note="gene_id=mCG10636.1 transcript_id=mCT191001.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16143998..16144168,16144341..16144421,
FT                   16145300..16145499,16146507..16146718,16146974..16147142,
FT                   16147388..16147580,16147663..16147872,16147970..16148044,
FT                   16148266..16148370,16148468..16148598,16148834..16149035,
FT                   16149153..16149296,16149372..16149526,16149639..16149703,
FT                   16149802..16149984,16150095..>16150189))
FT                   /codon_start=1
FT                   /gene="Spata20"
FT                   /locus_tag="mCG_10636"
FT                   /product="spermatogenesis associated 20, isoform CRA_b"
FT                   /note="gene_id=mCG10636.1 transcript_id=mCT191001.0
FT                   protein_id=mCP111956.0 isoform=CRA_b"
FT                   /protein_id="EDL15923.1"
FT                   /translation="PGREPPMSHHSSPPPKHKGEHKGHGLPRGSERGSSSRDKDRSATT
FT                   VSSSAPMPAGGKSSRTNCPPPAPPKTANRLINEKSPYLLQHAYNPVDWYPWGQEAFDKA
FT                   KKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLNENFICVMVDREERPDVDKVYMT
FT                   FVQATSSGGGWPMNVWLTPGLQPFVGGTYFPPEDGLTRVGFRTVLMRICDQWKLNKNTL
FT                   LENSQRVTTALLARSEISVGDRQIPASAATMNSRCFQQLDEGYDEEYGGFAEAPKFPTP
FT                   VILNFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIQDHVGQGFHRYSTDRQWHIPH
FT                   FEKMLYDQAQLSVVYTQAFQISGDEFYADVAKGILQYVTRTLSHRSGGFYSAEDADSPP
FT                   ERGMKPQEGAYYVWTVKEVQQLLPEPVVGASEPLTSGQLLMKHYGLSEVGNINSSQDPN
FT                   GELHGQNVLMVRYSLELTAARYGLEVEAVRALLNTGLEKLFQARKHRPKAHLDNKMLAA
FT                   WNGLMVSGFAVTGAALGMEKLVAQATSGAKFLKRHMFDVSSGRLKRTCYAGTGGTVEQS
FT                   NPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQDTQDKLFWDPRGGGYFCSEAE
FT                   LGADLPLRLKDDQDGAEPSANSVSAHNLLRLHSFTGHKDWMDKCVCLLTAFSERMRRVP
FT                   VALPEMVRTLSAQQQTLKQIVICGDPQAKDTKALLQCVHSIYVPNKVLILADGDPSSFL
FT                   SRQLPFLSSLRRVEDRATVYIFENQACSMPITDPCELRKLLHQ"
FT   CDS             complement(join(16143998..16144168,16144341..16144421,
FT                   16145300..16145499,16146507..16146718,16146974..16147142,
FT                   16147388..16147580,16147663..16147872,16147970..16148044,
FT                   16148266..16148370,16148468..16148598,16148834..16149035,
FT                   16149153..16149296,16149372..16149526,16149639..16149703,
FT                   16149802..16149926))
FT                   /codon_start=1
FT                   /gene="Spata20"
FT                   /locus_tag="mCG_10636"
FT                   /product="spermatogenesis associated 20, isoform CRA_a"
FT                   /note="gene_id=mCG10636.1 transcript_id=mCT10853.2
FT                   protein_id=mCP7911.2 isoform=CRA_a"
FT                   /protein_id="EDL15922.1"
FT                   /translation="MPAGGKSSRTNCPPPAPPKTANRLINEKSPYLLQHAYNPVDWYPW
FT                   GQEAFDKAKKENKPIFLSVGYSTCHWCHMMEEESFQNEEIGRLLNENFICVMVDREERP
FT                   DVDKVYMTFVQATSSGGGWPMNVWLTPGLQPFVGGTYFPPEDGLTRVGFRTVLMRICDQ
FT                   WKLNKNTLLENSQRVTTALLARSEISVGDRQIPASAATMNSRCFQQLDEGYDEEYGGFA
FT                   EAPKFPTPVILNFLFSYWLSHRLTQDGSRAQQMALHTLKMMANGGIQDHVGQGFHRYST
FT                   DRQWHIPHFEKMLYDQAQLSVVYTQAFQISGDEFYADVAKGILQYVTRTLSHRSGGFYS
FT                   AEDADSPPERGMKPQEGAYYVWTVKEVQQLLPEPVVGASEPLTSGQLLMKHYGLSEVGN
FT                   INSSQDPNGELHGQNVLMVRYSLELTAARYGLEVEAVRALLNTGLEKLFQARKHRPKAH
FT                   LDNKMLAAWNGLMVSGFAVTGAALGMEKLVAQATSGAKFLKRHMFDVSSGRLKRTCYAG
FT                   TGGTVEQSNPPCWGFLEDYAFVVRGLLDLYEASQESSWLEWALRLQDTQDKLFWDPRGG
FT                   GYFCSEAELGADLPLRLKDDQDGAEPSANSVSAHNLLRLHSFTGHKDWMDKCVCLLTAF
FT                   SERMRRVPVALPEMVRTLSAQQQTLKQIVICGDPQAKDTKALLQCVHSIYVPNKVLILA
FT                   DGDPSSFLSRQLPFLSSLRRVEDRATVYIFENQACSMPITDPCELRKLLHQ"
FT   gene            complement(16155562..16164829)
FT                   /gene="Epn3"
FT                   /locus_tag="mCG_10623"
FT                   /note="gene_id=mCG10623.1"
FT   mRNA            complement(join(16155562..16156358,16156450..16156683,
FT                   16156788..16156904,16157045..16157314,16157741..16157828,
FT                   16158652..16158783,16158972..16159052,16159813..16159931,
FT                   16160881..16161560,16164709..16164829))
FT                   /gene="Epn3"
FT                   /locus_tag="mCG_10623"
FT                   /product="epsin 3, transcript variant mCT10840"
FT                   /note="gene_id=mCG10623.1 transcript_id=mCT10840.2 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(16155871..16156358,16156450..16156683,
FT                   16156788..16156904,16157045..16157314,16157741..16157828,
FT                   16158652..16158783,16158972..16159052,16159813..16159931,
FT                   16160881..16161560,16164579..>16164809))
FT                   /gene="Epn3"
FT                   /locus_tag="mCG_10623"
FT                   /product="epsin 3, transcript variant mCT191034"
FT                   /note="gene_id=mCG10623.1 transcript_id=mCT191034.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16156030..16156358,16156450..16156683,
FT                   16156788..16156904,16157045..16157314,16157741..16157828,
FT                   16158652..16158783,16158972..16159052,16159813..16159931,
FT                   16160881..>16161523))
FT                   /codon_start=1
FT                   /gene="Epn3"
FT                   /locus_tag="mCG_10623"
FT                   /product="epsin 3, isoform CRA_b"
FT                   /note="gene_id=mCG10623.1 transcript_id=mCT191034.0
FT                   protein_id=mCP111954.0 isoform=CRA_b"
FT                   /protein_id="EDL15925.1"
FT                   /translation="KQGGPSFKTVTSRRWRSALYLRRGRGPPTSKSPTMTTSALRRQVK
FT                   NIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFAEVMGMVWRRLNDSGKN
FT                   WRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQGVNVREKVKQ
FT                   VMALLKDEERLRQERTHALKTKERMALEGMGIGSGQLGYSRRSRGSPSSYTSASSSPRY
FT                   ASDLEQARPQTSGEEELQLQLALAMSREEAERPVPPASHRDEDLQLQLALSLSRQEHEK
FT                   GVRSWKGDDSPVANGAEPAGQRRQRDREPEREERKEEEKLKTSQSSILDLADIFAPAPA
FT                   LPSTHCSADPWDIPGLRPNTEPSGSSWGPSADPWSPVPSGNALSRSQPWDLLPTLSSSE
FT                   PWGRTPVLPSGPPIADPWAPSSPTRKLPSTGADPWGASMETSDTSALGGASPFDPFAKP
FT                   LESTEPKESRDSAQALPTGKSPSTVELDPFGDSSPSCKQNGMKEPEALDLGVLGEALPQ
FT                   QPGKEARPCRTPESFLGPSASSLVNLDSLVKAPLAARTRNPFLTGLGVPSPTNPFGAGD
FT                   QGRPTLNQMRTGSPALGLPPGGPVGAPVGSMTYSASLPLPLSSVPVGATLPASVSVFPQ
FT                   AGAFAPPPASLPQPLLPTSGPMGPLPPQAGTNPFL"
FT   CDS             complement(join(16156030..16156358,16156450..16156683,
FT                   16156788..16156904,16157045..16157314,16157741..16157828,
FT                   16158652..16158783,16158972..16159052,16159813..16159931,
FT                   16160881..16161421))
FT                   /codon_start=1
FT                   /gene="Epn3"
FT                   /locus_tag="mCG_10623"
FT                   /product="epsin 3, isoform CRA_a"
FT                   /note="gene_id=mCG10623.1 transcript_id=mCT10840.2
FT                   protein_id=mCP7913.2 isoform=CRA_a"
FT                   /protein_id="EDL15924.1"
FT                   /translation="MTTSALRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIAD
FT                   LTFNTVAFAEVMGMVWRRLNDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQ
FT                   TLKDFQYIDRDGKDQGVNVREKVKQVMALLKDEERLRQERTHALKTKERMALEGMGIGS
FT                   GQLGYSRRSRGSPSSYTSASSSPRYASDLEQARPQTSGEEELQLQLALAMSREEAERPV
FT                   PPASHRDEDLQLQLALSLSRQEHEKGVRSWKGDDSPVANGAEPAGQRRQRDREPEREER
FT                   KEEEKLKTSQSSILDLADIFAPAPALPSTHCSADPWDIPGLRPNTEPSGSSWGPSADPW
FT                   SPVPSGNALSRSQPWDLLPTLSSSEPWGRTPVLPSGPPIADPWAPSSPTRKLPSTGADP
FT                   WGASMETSDTSALGGASPFDPFAKPLESTEPKESRDSAQALPTGKSPSTVELDPFGDSS
FT                   PSCKQNGMKEPEALDLGVLGEALPQQPGKEARPCRTPESFLGPSASSLVNLDSLVKAPL
FT                   AARTRNPFLTGLGVPSPTNPFGAGDQGRPTLNQMRTGSPALGLPPGGPVGAPVGSMTYS
FT                   ASLPLPLSSVPVGATLPASVSVFPQAGAFAPPPASLPQPLLPTSGPMGPLPPQAGTNPF
FT                   L"
FT   gene            complement(16166233..>16186416)
FT                   /gene="Mycbpap"
FT                   /locus_tag="mCG_10626"
FT                   /note="gene_id=mCG10626.1"
FT   mRNA            complement(join(16166233..16166406,16168012..16168182,
FT                   16168489..16168634,16169068..16169183,16169891..16170012,
FT                   16170442..16170831,16171383..16171529,16172554..16172741,
FT                   16173111..16173300,16174251..16174362,16174765..16174880,
FT                   16174937..16175082,16176633..16176774,16177236..16177351,
FT                   16177599..16177785,16178526..16178629,16178782..16178941,
FT                   16179534..16179661,16186371..>16186416))
FT                   /gene="Mycbpap"
FT                   /locus_tag="mCG_10626"
FT                   /product="Mycbp associated protein, transcript variant
FT                   mCT10843"
FT                   /note="gene_id=mCG10626.1 transcript_id=mCT10843.2 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(16166234..16166406,16168012..16168182,
FT                   16168489..16168634,16169068..16169183,16169891..16170012,
FT                   16170442..16170831,16171383..16171529,16172554..16172741,
FT                   16173111..16173300,16174251..16174362,16174765..16174880,
FT                   16174967..16175082,16176633..16176774,16177236..16177785,
FT                   16178526..16178629,16178782..16178941,16179534..16179661,
FT                   16186371..>16186402))
FT                   /gene="Mycbpap"
FT                   /locus_tag="mCG_10626"
FT                   /product="Mycbp associated protein, transcript variant
FT                   mCT191036"
FT                   /note="gene_id=mCG10626.1 transcript_id=mCT191036.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16166305..16166406,16168012..16168182,
FT                   16168489..16168634,16169068..16169183,16169891..16170012,
FT                   16170442..16170831,16171383..16171529,16172554..16172741,
FT                   16173111..16173300,16174251..16174362,16174765..16174880,
FT                   16174937..16175082,16176633..16176774,16177236..16177351,
FT                   16177599..16177785,16178526..16178629,16178782..16178941,
FT                   16179534..16179661,16186371..16186416))
FT                   /codon_start=1
FT                   /gene="Mycbpap"
FT                   /locus_tag="mCG_10626"
FT                   /product="Mycbp associated protein, isoform CRA_a"
FT                   /note="gene_id=mCG10626.1 transcript_id=mCT10843.2
FT                   protein_id=mCP7919.2 isoform=CRA_a"
FT                   /protein_id="EDL15926.1"
FT                   /translation="MMKKITERQSPLKLLEKKRAKAPEQPTPPIQEEPEPVSNVLQGDD
FT                   ILALAIKKEDLRKQHVPQFEETGEKPVVTQKFIIRKLKPKDSSKRVYHLVAHPATPDAA
FT                   TKPLDYSGPHDSFLSSGQILPHQILGSLQDFKRIAVARGNTQLAKLIHIQPCLMTLISA
FT                   KEEPKPKPPKEEERPSPWAPPPQHNFLKNWRRHIALRKKQQEALSKHLKKPASELLMHT
FT                   GESYRKIQEEREVIDRALPTQHDGKATSWFWSPLEYLGDEMTGLLMTKKKTQRGLVEPI
FT                   THIRKPLSIQVETGLPAQKDAWYRYTWDRSLFLIYRRKELQSIMAELDFSQQVANAFIP
FT                   DPEDIDGLEVVGHGKPFSSVTVEEHLPPEKIQKSSSEDTVFLDSLTNLSDMVPMPILGP
FT                   SLLFCGKPACWVRGSNPEDKKNIGIGVRLTFETLEGERTSSELTVVNNGTVAIWYNWRR
FT                   RPHQDFFQDLKQNKTQRFYFNNREGVILPGETKHFTFFFKSLNAGIFRESWEFGTHPTL
FT                   LGGAVLQVTLHAISLTQDIFMDERKLLETKLAAHEAITIAQSVLQDLLRGISTPERTPS
FT                   PVDAYLTEEDLFNYRNPRLHYQHQVVQNLHQLWQQYRKAKATQKETPSLRTPVPLLLVE
FT                   KASGSISPRNLVSEYSQLSPHQEMDTARKTRDFFLSLKSSIGKKSVARKSIMEELLVEE
FT                   GPDRETTQRPWALKSISPPKWNLCLEDFRQAVMTFPEELQREDALIQLNKAAMELCQEQ
FT                   KPLQSDLLYQMCLQLWRDVIDSLVSQSLWLRNLLGLPEKETVYLDLPDEQGQKSPPVTE
FT                   SKVTSGKAGKEDRRGGAQEKKQLGTKDKDDKRGSKTPGKEDRPNSKKLKPKDDKKVVKS
FT                   ASRDRLLSEDPPPDSTAPSQEPIDPLVMEKYTQRLHAEVYALLDNLVTDVMVLADELSS
FT                   TKNVEESLRFCS"
FT   CDS             complement(join(16166305..16166406,16168012..16168182,
FT                   16168489..16168634,16169068..16169183,16169891..16170012,
FT                   16170442..16170831,16171383..16171529,16172554..16172741,
FT                   16173111..16173300,16174251..16174362,16174765..16174880,
FT                   16174967..16175082,16176633..16176774,16177236..>16177580))
FT                   /codon_start=1
FT                   /gene="Mycbpap"
FT                   /locus_tag="mCG_10626"
FT                   /product="Mycbp associated protein, isoform CRA_b"
FT                   /note="gene_id=mCG10626.1 transcript_id=mCT191036.0
FT                   protein_id=mCP111955.0 isoform=CRA_b"
FT                   /protein_id="EDL15927.1"
FT                   /translation="GPARVPPSGTEALLCLLSHPPRLPLTSICPMTASGFQASVGSEMR
FT                   QGVGHPIQSARACVFCFWYHDHSLPSFSPALEHLKKPASELLMHTGESYRKIQEEREVI
FT                   DRALPTQHDGKATSWFWSPLEYLGDEMTGLLMTKKKTQRGLVEPITHIRKPLSIQVETG
FT                   LPAQKDAWYRYTWDRSLFLIYRRKELQSIMAELDFSQQDIDGLEVVGHGKPFSSVTVEE
FT                   HLPPEKIQKSSSEDTVFLDSLTNLSDMVPMPILGPSLLFCGKPACWVRGSNPEDKKNIG
FT                   IGVRLTFETLEGERTSSELTVVNNGTVAIWYNWRRRPHQDFFQDLKQNKTQRFYFNNRE
FT                   GVILPGETKHFTFFFKSLNAGIFRESWEFGTHPTLLGGAVLQVTLHAISLTQDIFMDER
FT                   KLLETKLAAHEAITIAQSVLQDLLRGISTPERTPSPVDAYLTEEDLFNYRNPRLHYQHQ
FT                   VVQNLHQLWQQYRKAKATQKETPSLRTPVPLLLVEKASGSISPRNLVSEYSQLSPHQEM
FT                   DTARKTRDFFLSLKSSIGKKSVARKSIMEELLVEEGPDRETTQRPWALKSISPPKWNLC
FT                   LEDFRQAVMTFPEELQREDALIQLNKAAMELCQEQKPLQSDLLYQMCLQLWRDVIDSLV
FT                   SQSLWLRNLLGLPEKETVYLDLPDEQGQKSPPVTESKVTSGKAGKEDRRGGAQEKKQLG
FT                   TKDKDDKRGSKTPGKEDRPNSKKLKPKDDKKVVKSASRDRLLSEDPPPDSTAPSQEPID
FT                   PLVMEKYTQRLHAEVYALLDNLVTDVMVLADELSSTKNVEESLRFCS"
FT   gene            complement(16204713..>16214102)
FT                   /gene="Rsad1"
FT                   /locus_tag="mCG_10637"
FT                   /note="gene_id=mCG10637.3"
FT   mRNA            complement(join(16204713..16204936,16207359..16207548,
FT                   16207782..16207885,16208188..16208242,16208449..16208596,
FT                   16208999..16209062,16209314..16209679,16213056..16213260,
FT                   16213368..16213501,16213877..16214101))
FT                   /gene="Rsad1"
FT                   /locus_tag="mCG_10637"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   1, transcript variant mCT10854"
FT                   /note="gene_id=mCG10637.3 transcript_id=mCT10854.2 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(16204713..16204936,16207359..16207548,
FT                   16207782..16207885,16208188..16208242,16208449..16208596,
FT                   16208999..16209062,16209314..16209679,16213075..16213260,
FT                   16213368..16213499))
FT                   /gene="Rsad1"
FT                   /locus_tag="mCG_10637"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   1, transcript variant mCT175070"
FT                   /note="gene_id=mCG10637.3 transcript_id=mCT175070.0 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(16205224..16207548,16207782..16207885,
FT                   16208188..16208242,16208449..16208596,16208999..16209062,
FT                   16209314..16209679,16213056..16213260,16213368..16213501,
FT                   16213873..>16214102))
FT                   /gene="Rsad1"
FT                   /locus_tag="mCG_10637"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   1, transcript variant mCT191003"
FT                   /note="gene_id=mCG10637.3 transcript_id=mCT191003.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16207431..16207548,16207782..16207885,
FT                   16208188..16208242,16208449..16208596,16208999..16209062,
FT                   16209314..16209679,16213056..16213260,16213368..16213501,
FT                   16213877..16214011))
FT                   /codon_start=1
FT                   /gene="Rsad1"
FT                   /locus_tag="mCG_10637"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG10637.3 transcript_id=mCT10854.2
FT                   protein_id=mCP7915.2 isoform=CRA_a"
FT                   /protein_id="EDL15928.1"
FT                   /translation="MVPSGVRTGRWMAAARAAQRRPRVDSLGQPPSPESASTRAALYVH
FT                   WPYCEKRCSYCNFNKYIPRGVEEGTVRNCLVTEARTLLRLSGVQRVESVFFGGGTPSLA
FT                   SPHTVAAVLEAVAQEVYLPADSEVTLEANPTSAPGPRLAAFGAAGVNRLSIGLQSLDDA
FT                   ELQLLGRTHSASDALRTLAEARLLFPGRVSVDLMLGLPAQKVEPWLQQLQKLLYHCDDH
FT                   LSLYQLTLERGTSLFAQVQQGTLPAPDPDLAAEMYQEGRTVLRDAGFRQYEVSNFARNG
FT                   ALSTHNWTYWQCGQYLGIGPGAHGRFVPQGTGGHTREARIQTLEPDNWMKEVTLFGHGT
FT                   RKCVRLGKLELLEEVLAMGLRTDVGVTHQHWQQFEPQLTLWDVFGASKEVEELLAQGLL
FT                   LLDYRGLRCSWEGLAVLDSLLLTLLPQLQEAWQHRPSSPVSGG"
FT   CDS             complement(join(16207431..16207548,16207782..16207885,
FT                   16208188..16208242,16208449..16208596,16208999..16209062,
FT                   16209314..16209679,16213056..16213260,16213368..>16213501))
FT                   /codon_start=1
FT                   /gene="Rsad1"
FT                   /locus_tag="mCG_10637"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG10637.3 transcript_id=mCT191003.0
FT                   protein_id=mCP111957.0 isoform=CRA_c"
FT                   /protein_id="EDL15930.1"
FT                   /translation="WPYCEKRCSYCNFNKYIPRGVEEGTVRNCLVTEARTLLRLSGVQR
FT                   VESVFFGGGTPSLASPHTVAAVLEAVAQEVYLPADSEVTLEANPTSAPGPRLAAFGAAG
FT                   VNRLSIGLQSLDDAELQLLGRTHSASDALRTLAEARLLFPGRVSVDLMLGLPAQKVEPW
FT                   LQQLQKLLYHCDDHLSLYQLTLERGTSLFAQVQQGTLPAPDPDLAAEMYQEGRTVLRDA
FT                   GFRQYEVSNFARNGALSTHNWTYWQCGQYLGIGPGAHGRFVPQGTGGHTREARIQTLEP
FT                   DNWMKEVTLFGHGTRKCVRLGKLELLEEVLAMGLRTDVGVTHQHWQQFEPQLTLWDVFG
FT                   ASKEVEELLAQGLLLLDYRGLRCSWEGLAVLDSLLLTLLPQLQEAWQHRPSSPVSGG"
FT   CDS             complement(join(16207431..16207548,16207782..16207885,
FT                   16208188..16208242,16208449..16208596,16208999..16209062,
FT                   16209314..16209565))
FT                   /codon_start=1
FT                   /gene="Rsad1"
FT                   /locus_tag="mCG_10637"
FT                   /product="radical S-adenosyl methionine domain containing
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG10637.3 transcript_id=mCT175070.0
FT                   protein_id=mCP97989.0 isoform=CRA_b"
FT                   /protein_id="EDL15929.1"
FT                   /translation="MLGLPAQKVEPWLQQLQKLLYHCDDHLSLYQLTLERGTSLFAQVQ
FT                   QGTLPAPDPDLAAEMYQEGRTVLRDAGFRQYEVSNFARNGALSTHNWTYWQCGQYLGIG
FT                   PGAHGRFVPQGTGGHTREARIQTLEPDNWMKEVTLFGHGTRKCVRLGKLELLEEVLAMG
FT                   LRTDVGVTHQHWQQFEPQLTLWDVFGASKEVEELLAQGLLLLDYRGLRCSWEGLAVLDS
FT                   LLLTLLPQLQEAWQHRPSSPVSGG"
FT   gene            complement(16221780..16267758)
FT                   /gene="BC018371"
FT                   /locus_tag="mCG_10632"
FT                   /note="gene_id=mCG10632.2"
FT   mRNA            complement(join(16221780..16221824,16221863..16221909,
FT                   16223766..16224106,16224389..16224457,16224614..16224724,
FT                   16225212..16225353,16227010..16227161,16228580..16228687,
FT                   16235268..16235344,16235899..16235990,16236259..16236416,
FT                   16236570..16236665,16237227..16237392,16237518..16237636,
FT                   16238182..16238235,16238478..16238606,16238957..16239152,
FT                   16267610..>16267737))
FT                   /gene="BC018371"
FT                   /locus_tag="mCG_10632"
FT                   /product="cDNA sequence BC018371, transcript variant
FT                   mCT175069"
FT                   /note="gene_id=mCG10632.2 transcript_id=mCT175069.0 created
FT                   on 29-OCT-2002"
FT   mRNA            complement(join(<16222252..16222302,16224389..16224457,
FT                   16224614..16224724,16225212..16225353,16227010..16227161,
FT                   16228580..16228687,16235268..16235344,16235863..16235990,
FT                   16236259..16236416,16236570..16236665,16237227..16237392,
FT                   16237518..16237636,16238182..16238235,16238478..16238606,
FT                   16238957..16239152,16267610..16267758))
FT                   /gene="BC018371"
FT                   /locus_tag="mCG_10632"
FT                   /product="cDNA sequence BC018371, transcript variant
FT                   mCT10849"
FT                   /note="gene_id=mCG10632.2 transcript_id=mCT10849.2 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(16222252..16222302,16224389..16224457,
FT                   16224614..16224724,16225212..16225353,16227010..16227161,
FT                   16228580..16228687,16235268..16235344,16235863..16235990,
FT                   16236259..16236416,16236570..16236665,16237227..16237392,
FT                   16237518..16237636,16238182..16238235,16238478..16238606,
FT                   16238957..16239152,16267610..16267737))
FT                   /codon_start=1
FT                   /gene="BC018371"
FT                   /locus_tag="mCG_10632"
FT                   /product="cDNA sequence BC018371, isoform CRA_a"
FT                   /note="gene_id=mCG10632.2 transcript_id=mCT10849.2
FT                   protein_id=mCP7905.2 isoform=CRA_a"
FT                   /protein_id="EDL15931.1"
FT                   /translation="MAVYHGMLRFGRLCIASLGARGPRTLLSRPRPNSKLQSVRALSSG
FT                   MVNCTNPLPIGGLSYIQGHTDSHLVNTTVGECLDATAQRFPDREALVILHENIRLNFAQ
FT                   LKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVSVNPAYQSSEL
FT                   EYVLRKVGCKGIVFPKQFKTQQYYDILKQVCPELEKAQPGALKSERLPDLTTVISVDAP
FT                   LPGTLLLDDIVAAGGKEQNLAQLRYNQRFLSCYDPINIQFTSGTTGNPKGATLSHHNIV
FT                   NNSMLIGQRLKMPTKTAEELRLVLPSPLYHCLGSVGGTMVSMMHGATLLLSSPSFNGKK
FT                   ALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTSIRGGEVLSKAARLGEGVIAGSPA
FT                   PPELIRAIINKMNMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVN
FT                   VETGELTNLNVPGELYIRGYCVMQGYWGEPQKTFETVGQDKWYRTGDIALMDEQGFCKI
FT                   VGRSKDMIIRGGENIYPAELEDFFLKHPQVQEAQVVGVKDERMGEEICACIRLKSGETT
FT                   TAEEIKAFCKGKISHFKIPRYIVFVEGYPLTISGKIQKFKLREQMEQHLKL"
FT   mRNA            complement(join(16223071..16224000,16224045..16224106,
FT                   16224389..16224457,16224614..16224724,16225212..16225353,
FT                   16227010..16227161,16228580..16228687,16235268..16235344,
FT                   16235899..16235990,16236259..16236416,16236570..16236665,
FT                   16237227..16237392,16237518..16237636,16238182..16238235,
FT                   16238478..16238606,16238957..16239152,16267610..16267753))
FT                   /gene="BC018371"
FT                   /locus_tag="mCG_10632"
FT                   /product="cDNA sequence BC018371, transcript variant
FT                   mCT175068"
FT                   /note="gene_id=mCG10632.2 transcript_id=mCT175068.0 created
FT                   on 29-OCT-2002"
FT   CDS             complement(join(16224056..16224106,16224389..16224457,
FT                   16224614..16224724,16225212..16225353,16227010..16227161,
FT                   16228580..16228687,16235268..16235344,16235899..16235990,
FT                   16236259..16236416,16236570..16236665,16237227..16237392,
FT                   16237518..16237636,16238182..16238235,16238478..16238606,
FT                   16238957..16239152,16267610..16267737))
FT                   /codon_start=1
FT                   /gene="BC018371"
FT                   /locus_tag="mCG_10632"
FT                   /product="cDNA sequence BC018371, isoform CRA_b"
FT                   /note="gene_id=mCG10632.2 transcript_id=mCT175068.0
FT                   protein_id=mCP97988.0 isoform=CRA_b"
FT                   /protein_id="EDL15932.1"
FT                   /translation="MAVYHGMLRFGRLCIASLGARGPRTLLSRPRPNSKLQSVRALSSG
FT                   MVNCTNPLPIGGLSYIQGHTDSHLVNTTVGECLDATAQRFPDREALVILHENIRLNFAQ
FT                   LKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVSVNPAYQSSEL
FT                   EYVLRKVGCKGIVFPKQFKTQQYYDILKQVCPELEKAQPGALKSERLPDLTTVISVDAP
FT                   LPGTLLLDDIVAAGGKEQNLAQLRYNQRFLSCYDPINIQFTSGTTGNPKGATLSHHNIV
FT                   NNSMLIGQRLKMPTKTAEELRLVLPSPLYHCLGSVGGTMVSMMHGATLLLSSPSFNGKK
FT                   ALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTSIRGGVIAGSPAPPELIRAIINKM
FT                   NMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVNVETGELTNLNVP
FT                   GELYIRGYCVMQGYWGEPQKTFETVGQDKWYRTGDIALMDEQGFCKIVGRSKDMIIRGG
FT                   ENIYPAELEDFFLKHPQVQEAQVVGVKDERMGEEICACIRLKSGETTTAEEIKAFCKGK
FT                   ISHFKIPRYIVFVEGYPLTISGKIQKFKLREQMEQHLKL"
FT   CDS             complement(join(16224056..16224106,16224389..16224457,
FT                   16224614..16224724,16225212..16225353,16227010..16227161,
FT                   16228580..16228687,16235268..16235344,16235899..16235990,
FT                   16236259..16236416,16236570..16236665,16237227..16237392,
FT                   16237518..16237636,16238182..16238235,16238478..16238606,
FT                   16238957..16239152,16267610..16267737))
FT                   /codon_start=1
FT                   /gene="BC018371"
FT                   /locus_tag="mCG_10632"
FT                   /product="cDNA sequence BC018371, isoform CRA_b"
FT                   /note="gene_id=mCG10632.2 transcript_id=mCT175069.0
FT                   protein_id=mCP97987.0 isoform=CRA_b"
FT                   /protein_id="EDL15933.1"
FT                   /translation="MAVYHGMLRFGRLCIASLGARGPRTLLSRPRPNSKLQSVRALSSG
FT                   MVNCTNPLPIGGLSYIQGHTDSHLVNTTVGECLDATAQRFPDREALVILHENIRLNFAQ
FT                   LKEEVDKAASGLLSIGLRKGDRLGMWGPNSYAWVLIQLATAQAGIILVSVNPAYQSSEL
FT                   EYVLRKVGCKGIVFPKQFKTQQYYDILKQVCPELEKAQPGALKSERLPDLTTVISVDAP
FT                   LPGTLLLDDIVAAGGKEQNLAQLRYNQRFLSCYDPINIQFTSGTTGNPKGATLSHHNIV
FT                   NNSMLIGQRLKMPTKTAEELRLVLPSPLYHCLGSVGGTMVSMMHGATLLLSSPSFNGKK
FT                   ALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTSIRGGVIAGSPAPPELIRAIINKM
FT                   NMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTEAQIVNVETGELTNLNVP
FT                   GELYIRGYCVMQGYWGEPQKTFETVGQDKWYRTGDIALMDEQGFCKIVGRSKDMIIRGG
FT                   ENIYPAELEDFFLKHPQVQEAQVVGVKDERMGEEICACIRLKSGETTTAEEIKAFCKGK
FT                   ISHFKIPRYIVFVEGYPLTISGKIQKFKLREQMEQHLKL"
FT   gene            16231007..16235078
FT                   /gene="Chad"
FT                   /locus_tag="mCG_10622"
FT                   /note="gene_id=mCG10622.1"
FT   mRNA            join(16231007..16231826,16233756..16233919,
FT                   16234167..16234312,16234538..16235078)
FT                   /gene="Chad"
FT                   /locus_tag="mCG_10622"
FT                   /product="chondroadherin"
FT                   /note="gene_id=mCG10622.1 transcript_id=mCT10839.1 created
FT                   on 09-AUG-2002"
FT   CDS             join(16231056..16231826,16233756..16233919,
FT                   16234167..16234308)
FT                   /codon_start=1
FT                   /gene="Chad"
FT                   /locus_tag="mCG_10622"
FT                   /product="chondroadherin"
FT                   /note="gene_id=mCG10622.1 transcript_id=mCT10839.1
FT                   protein_id=mCP7912.2"
FT                   /db_xref="GOA:Q3TYW1"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:1096866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TYW1"
FT                   /protein_id="EDL15934.1"
FT                   /translation="MARALLFSLVFLAILLPALAACPQNCHCHGDLQHVICDKVGLQKI
FT                   PKVSETTKLLNLQRNNFPVLAANSFRTMPNLVSLHLQHCNIREVAAGAFRGLKQLIYLY
FT                   LSHNDIRVLRAGAFDDLTELTYLYLDHNKVSELPRGLLSPLVNLFILQLNNNKIRELRA
FT                   GAFQGAKDLRWLYLSENALSSLQPGSLDDVENLAKFHLDKNQLSSYPSAALSKLRVVEE
FT                   LKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDAAFSGVTTLKHVHLDNNRLNQ
FT                   LPSSFPFDNLETLTLTNNPWKCTCQLRGLRRWLEAKASRPDATCSSPAKFKGQRIRDTD
FT                   ALRSCKSPTKRSKKAGRH"
FT   gene            16289550..16307295
FT                   /gene="Lrrc59"
FT                   /locus_tag="mCG_1802"
FT                   /note="gene_id=mCG1802.2"
FT   mRNA            join(16289550..16289645,16291896..16292148,
FT                   16294121..16294180,16296585..16296743,16296952..16297056,
FT                   16300571..16300643,16303269..16303442,16305376..16307295)
FT                   /gene="Lrrc59"
FT                   /locus_tag="mCG_1802"
FT                   /product="leucine rich repeat containing 59, transcript
FT                   variant mCT1092"
FT                   /note="gene_id=mCG1802.2 transcript_id=mCT1092.2 created on
FT                   03-JAN-2003"
FT   mRNA            join(<16291835..16292148,16294121..16294180,
FT                   16296585..16296743,16296952..16297056,16300571..16300643,
FT                   16303269..16303442,16305376..16307292)
FT                   /gene="Lrrc59"
FT                   /locus_tag="mCG_1802"
FT                   /product="leucine rich repeat containing 59, transcript
FT                   variant mCT191057"
FT                   /note="gene_id=mCG1802.2 transcript_id=mCT191057.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<16291837..16292148,16294121..16294180,
FT                   16296585..16296743,16296952..16297056,16300571..16300643,
FT                   16303269..16303442,16305376..16305623)
FT                   /codon_start=1
FT                   /gene="Lrrc59"
FT                   /locus_tag="mCG_1802"
FT                   /product="leucine rich repeat containing 59, isoform CRA_b"
FT                   /note="gene_id=mCG1802.2 transcript_id=mCT191057.0
FT                   protein_id=mCP112007.0 isoform=CRA_b"
FT                   /protein_id="EDL15936.1"
FT                   /translation="TGGSGALGWECGGRADGRRRPRSGGGGDGGLRRRRGPLGVSPPSP
FT                   RAAPHPSLLPVGNREPGTRLAGVIMTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKEL
FT                   AALPKATVLDLSCNKLSTLPSDFCGLTHLVKLDLSKNKLQQLPADFGRLVNLQHLDLLN
FT                   NRLVTLPVSFAQLKNLKWLDLKDNPLDPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQA
FT                   DQERERQRRLEVEREAEKKREAKQQAKEAKERELRKREKAEEKERRRKEYDAQKASKRE
FT                   QEKKPKKEANQAPKSKSGSRPRKPPPRKHTRSWAVLKVLLLLLLLCVAGGLVVCRVTGL
FT                   HQQPLCTSVNTIYDNAVQGLRHHEILQWVLQTDSQQ"
FT   CDS             join(16292044..16292148,16294121..16294180,
FT                   16296585..16296743,16296952..16297056,16300571..16300643,
FT                   16303269..16303442,16305376..16305623)
FT                   /codon_start=1
FT                   /gene="Lrrc59"
FT                   /locus_tag="mCG_1802"
FT                   /product="leucine rich repeat containing 59, isoform CRA_a"
FT                   /note="gene_id=mCG1802.2 transcript_id=mCT1092.2
FT                   protein_id=mCP11303.2 isoform=CRA_a"
FT                   /protein_id="EDL15935.1"
FT                   /translation="MTKAGSKGGNLRDKLDGNELDLSLSDLNEVPVKELAALPKATVLD
FT                   LSCNKLSTLPSDFCGLTHLVKLDLSKNKLQQLPADFGRLVNLQHLDLLNNRLVTLPVSF
FT                   AQLKNLKWLDLKDNPLDPVLAKVAGDCLDEKQCKQCANKVLQHMKAVQADQERERQRRL
FT                   EVEREAEKKREAKQQAKEAKERELRKREKAEEKERRRKEYDAQKASKREQEKKPKKEAN
FT                   QAPKSKSGSRPRKPPPRKHTRSWAVLKVLLLLLLLCVAGGLVVCRVTGLHQQPLCTSVN
FT                   TIYDNAVQGLRHHEILQWVLQTDSQQ"
FT   gene            complement(16306611..>16315876)
FT                   /gene="Eme1"
FT                   /locus_tag="mCG_1803"
FT                   /note="gene_id=mCG1803.3"
FT   mRNA            complement(join(16306611..16307684,16307895..16308084,
FT                   16309370..16309485,16309707..16309827,16309897..16310141,
FT                   16310222..16310308,16312111..16313126,16315817..16315865))
FT                   /gene="Eme1"
FT                   /locus_tag="mCG_1803"
FT                   /product="essential meiotic endonuclease 1 homolog 1 (S.
FT                   pombe), transcript variant mCT1087"
FT                   /note="gene_id=mCG1803.3 transcript_id=mCT1087.2 created on
FT                   25-OCT-2002"
FT   mRNA            complement(join(16307075..16307349,16311595..16311622,
FT                   16312111..16313126))
FT                   /gene="Eme1"
FT                   /locus_tag="mCG_1803"
FT                   /product="essential meiotic endonuclease 1 homolog 1 (S.
FT                   pombe), transcript variant mCT174826"
FT                   /note="gene_id=mCG1803.3 transcript_id=mCT174826.0 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(16307081..16307684,16307895..16308084,
FT                   16309370..16309485,16309707..16309827,16310023..16310141,
FT                   16310222..16310308,16312111..16312241,16312326..16313126,
FT                   16315817..>16315876))
FT                   /gene="Eme1"
FT                   /locus_tag="mCG_1803"
FT                   /product="essential meiotic endonuclease 1 homolog 1 (S.
FT                   pombe), transcript variant mCT191059"
FT                   /note="gene_id=mCG1803.3 transcript_id=mCT191059.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16307225..16307349,16311595..16311622,
FT                   16312111..16312191))
FT                   /codon_start=1
FT                   /gene="Eme1"
FT                   /locus_tag="mCG_1803"
FT                   /product="essential meiotic endonuclease 1 homolog 1 (S.
FT                   pombe), isoform CRA_b"
FT                   /note="gene_id=mCG1803.3 transcript_id=mCT174826.0
FT                   protein_id=mCP97745.0 isoform=CRA_b"
FT                   /protein_id="EDL15938.1"
FT                   /translation="MECSCVIEAQAIPRSITWRRRRTELVELPVAERGATGQPSHPIPV
FT                   DPHSTKEKGRPLRHGFNNCRNPRNKHQISKSE"
FT   CDS             complement(join(16307508..16307684,16307895..16308084,
FT                   16309370..16309485,16309707..16309827,16310023..16310141,
FT                   16310222..16310308,16312111..16312241,16312326..16313126,
FT                   16315817..>16315868))
FT                   /codon_start=1
FT                   /gene="Eme1"
FT                   /locus_tag="mCG_1803"
FT                   /product="essential meiotic endonuclease 1 homolog 1 (S.
FT                   pombe), isoform CRA_c"
FT                   /note="gene_id=mCG1803.3 transcript_id=mCT191059.0
FT                   protein_id=mCP112008.0 isoform=CRA_c"
FT                   /protein_id="EDL15939.1"
FT                   /translation="IYFRVLRTIQRVAGAVAGSSFESSNGLMALRRLSLSRLSTESDSE
FT                   DLPTFAFLKKEPSSTNRKPPQRAKNIVVVTSDSEASCPPSPGLKGPPCVPSAAGAPPQA
FT                   GPVRVLSSSSEDEDVFVPLAERITCKLLTSKQLCPELSSSSLKTGLDGQNNASAPCDWK
FT                   RQPWPKIPDVPLHGALEKSAANDEDSLLDDQCRQLPTYQATCRELAVSKTNSDRPLPKK
FT                   RTKHIQTVQSGGSQGCWRPGQASRKENTPRQHERKKKAEMIKRLKAQRPEECLKHIVVV
FT                   LDPVLLQMEGGGQLLGALQAMECSCVIEAQAIPRSITWRRRRTELVEDGDDWMEEPTIL
FT                   VLVLAEVFMSMAYNLKQASPSSTEKGKETLRSFVTDVTAKTGKALSLVIVDQEKCFRPQ
FT                   NPPRRRKSGMANKQAKAKHQQRQESSTGLMVSRADMEKALVDLQLYTEAQAWMVQSWKE
FT                   LADFTCAFTKAVAEAPFKKLRDQVTFSFFLEKDWAGGMKVDQSGRGLALIWRRQIQQLN
FT                   RVSSEMASAIVDAYPSPQLLVQAYQRCFSEQERQNLLADIQVRRGEGVTATSRRVGPEL
FT                   SRRIYLQMTTAQPDLILDSVD"
FT   CDS             complement(join(16307508..16307684,16307895..16308084,
FT                   16309370..16309485,16309707..16309827,16309897..16310141,
FT                   16310222..16310308,16312111..16313097))
FT                   /codon_start=1
FT                   /gene="Eme1"
FT                   /locus_tag="mCG_1803"
FT                   /product="essential meiotic endonuclease 1 homolog 1 (S.
FT                   pombe), isoform CRA_a"
FT                   /note="gene_id=mCG1803.3 transcript_id=mCT1087.2
FT                   protein_id=mCP11304.2 isoform=CRA_a"
FT                   /protein_id="EDL15937.1"
FT                   /translation="MALRRLSLSRLSTESDSEDLPTFAFLKKEPSSTNRKPPQRAKNIV
FT                   VVTSDSEASCPPSPGLKGPPCVPSAAGAPPQAGPVRVLSSSSEDEDVFVPLAERITCKL
FT                   LTSKQLCPELSSSSLKTGLDGQNNASAPCDWKRQPWPKIPDVPLHGALEKSAANDEDSL
FT                   LDDQCRQLPTYQATCRELAVSKTNSDRPLPKKRTKHIQTVQSGGSQGCWRPGQASRKEN
FT                   TPRQHERKKKAEMIKRLKAQRPEECLKHIVVVLDPGPPRCQLPLSPDVCVLDSSMTNPF
FT                   LSIAVLLQMEGGGQLLGALQAMECSCVIEAQAIPRSITWRRRRTELVEDGDDWMEEPTI
FT                   LVLVLAEVFMSMAYNLKQASPSSTEKGKETLRSFVTDVTAKTGKALSLVIVDQEKCFRY
FT                   GYALKIEALKGQLTGYQGEIIHPGYKSFCKMVSLTSCGMCWPQNPPRRRKSGMANKQAK
FT                   AKHQQRQESSTGLMVSRADMEKALVDLQLYTEAQAWMVQSWKELADFTCAFTKAVAEAP
FT                   FKKLRDQVTFSFFLEKDWAGGMKVDQSGRGLALIWRRQIQQLNRVSSEMASAIVDAYPS
FT                   PQLLVQAYQRCFSEQERQNLLADIQVRRGEGVTATSRRVGPELSRRIYLQMTTAQPDLI
FT                   LDSVD"
FT   gene            16316991..16323706
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /note="gene_id=mCG1801.1"
FT   mRNA            join(16316991..16317041,16320029..16320239,
FT                   16320604..16320671,16323226..16323706)
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, transcript
FT                   variant mCT171449"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT171449.0 created
FT                   on 05-MAR-2003"
FT   mRNA            join(16316991..16317041,16320108..16320239,
FT                   16320604..16320671,16323226..16323706)
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, transcript
FT                   variant mCT1096"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT1096.1 created on
FT                   05-MAR-2003"
FT   mRNA            join(16316996..16317043,16320604..16320671,
FT                   16323226..16323487)
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, transcript
FT                   variant mCT180867"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT180867.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(16317002..16317041,16320108..16320239,
FT                   16320604..16320671,16323226..16323432)
FT                   /codon_start=1
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT1096.1
FT                   protein_id=mCP11306.2 isoform=CRA_a"
FT                   /protein_id="EDL15940.1"
FT                   /translation="MAAAALTLRTRAAVTALLSPTAPTALAVRHASKKTGGSSKNLGGK
FT                   SRGKHYGIKKMEGHYVHAGNILGTQRQFRWHPGAHVGLGRNKCLYALEEGIVRYTKDVY
FT                   VPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEGTFKLVDML"
FT   CDS             join(16317002..16317043,16320604..16320671,
FT                   16323226..16323274)
FT                   /codon_start=1
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT180867.0
FT                   protein_id=mCP103788.0 isoform=CRA_e"
FT                   /protein_id="EDL15945.1"
FT                   /translation="MAAAALTLRTRAAGVTTFTLATSLALSVSLDGTREPMWGLGGTSA
FT                   CMPWRRG"
FT   mRNA            join(16317462..16317518,16320108..16320239,
FT                   16320604..16320671,16323226..16323706)
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, transcript
FT                   variant mCT171448"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT171448.0 created
FT                   on 05-MAR-2003"
FT   mRNA            join(16317473..16317518,16320604..16320671,
FT                   16323226..16323588)
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, transcript
FT                   variant mCT180865"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT180865.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(16317479..16317518,16320108..16320239,
FT                   16320604..16320671,16323226..16323432)
FT                   /codon_start=1
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT171448.0
FT                   protein_id=mCP94368.0 isoform=CRA_b"
FT                   /protein_id="EDL15941.1"
FT                   /translation="MAAAALTLRTRAAVTALLSPTAPTALAVRHASKKTGGSSKNLGGK
FT                   SRGKHYGIKKMEGHYVHAGNILGTQRQFRWHPGAHVGLGRNKCLYALEEGIVRYTKDVY
FT                   VPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEGTFKLVDML"
FT   CDS             join(16317479..16317518,16320604..16320671,
FT                   16323226..16323432)
FT                   /codon_start=1
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT180865.0
FT                   protein_id=mCP103789.0 isoform=CRA_d"
FT                   /protein_id="EDL15943.1"
FT                   /translation="MAAAALTLRTRAAGHYVHAGNILGTQRQFRWHPGAHVGLGRNKCL
FT                   YALEEGIVRYTKDVYVPNPKNTEAVDLVTSLPKGAVLYKTFVHVVPAKPEGTFKLVDML
FT                   "
FT   mRNA            join(16317708..16317837,16320108..16320239,
FT                   16320604..16320671,16323226..16323334)
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, transcript
FT                   variant mCT180866"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT180866.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(16320156..16320239,16320604..16320671,
FT                   16323226..16323274)
FT                   /codon_start=1
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT171449.0
FT                   protein_id=mCP94367.0 isoform=CRA_c"
FT                   /protein_id="EDL15942.1"
FT                   /translation="MHPRRQVAALRTLVGNHEANTTASRKWKVTTFTLATSLALSVSLD
FT                   GTREPMWGLGGTSACMPWRRG"
FT   CDS             join(16320156..16320239,16320604..16320671,
FT                   16323226..16323274)
FT                   /codon_start=1
FT                   /gene="Mrpl27"
FT                   /locus_tag="mCG_1801"
FT                   /product="mitochondrial ribosomal protein L27, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1801.1 transcript_id=mCT180866.0
FT                   protein_id=mCP103787.0 isoform=CRA_c"
FT                   /protein_id="EDL15944.1"
FT                   /translation="MHPRRQVAALRTLVGNHEANTTASRKWKVTTFTLATSLALSVSLD
FT                   GTREPMWGLGGTSACMPWRRG"
FT   gene            complement(16327416..16341087)
FT                   /gene="Xylt2"
FT                   /locus_tag="mCG_1800"
FT                   /note="gene_id=mCG1800.1"
FT   mRNA            complement(join(16327416..16327642,16328207..16328525,
FT                   16329819..16330152,16330720..16330915,16331205..16331467,
FT                   16331682..16331858,16331934..16332162,16332348..16332428,
FT                   16333062..16333264,16333528..16333703,16333929..16334421,
FT                   16340958..16341087))
FT                   /gene="Xylt2"
FT                   /locus_tag="mCG_1800"
FT                   /product="xylosyltransferase II, transcript variant
FT                   mCT1095"
FT                   /note="gene_id=mCG1800.1 transcript_id=mCT1095.1 created on
FT                   25-OCT-2002"
FT   mRNA            complement(join(16327469..16328525,16329819..16330152,
FT                   16330720..16330915,16331205..16331467,16331682..16331858,
FT                   16331946..16332162,16332348..16332428,16333062..16333264,
FT                   16333528..16333703,16333929..16334421,16340916..16341053))
FT                   /gene="Xylt2"
FT                   /locus_tag="mCG_1800"
FT                   /product="xylosyltransferase II, transcript variant
FT                   mCT174825"
FT                   /note="gene_id=mCG1800.1 transcript_id=mCT174825.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(16327504..16327642,16328207..16328525,
FT                   16329819..16330152,16330720..16330915,16331205..16331467,
FT                   16331682..16331858,16331934..16332162,16332348..16332428,
FT                   16333062..16333264,16333528..16333703,16333929..16334421,
FT                   16340958..16341050))
FT                   /codon_start=1
FT                   /gene="Xylt2"
FT                   /locus_tag="mCG_1800"
FT                   /product="xylosyltransferase II, isoform CRA_b"
FT                   /note="gene_id=mCG1800.1 transcript_id=mCT1095.1
FT                   protein_id=mCP11305.2 isoform=CRA_b"
FT                   /protein_id="EDL15947.1"
FT                   /translation="MVASARVQKLVRRYKLAIATALAILLLQGLVKGRQRKPRPLDPGE
FT                   GSKDTDSSAGRRGSAGRRHGRWRGRAESPGVPVAKVVRAVTSRQRASRRVPPAPPPEAP
FT                   GRQNLSGAAAGEALIGAPGFPQHGDTGSVEGAPQPTDNTFTPKCEIVGKDALSALARAS
FT                   TKQCQQEIANVVCLHQAGNLMPKSVPRHCQLAGKMSPGVQWEEIRAQQPVGGPPVRIAY
FT                   MLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSNYLYREVVELAQHYENVRVTPWRMV
FT                   TIWGGASLLRMYLRSMKDLLEIPGWTWDFFINLSATDYPTRTNEELVAFLSKNRDKNFL
FT                   KSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGSDWFVLTRSFVEYVV
FT                   YTDDPLVAQLRQFYTYTLLPAEVGEQSFFHTVLENSPACASLVDNNLRVTNWNRKLGCK
FT                   CQYKHIVDWCGCSPNDFKPQDFLRLQQVSRPTFFARKFESTVNQEVLEILDFHLYGSYP
FT                   PSTPALKAYWENIYDVADGPGGLSDVLLTAYTAFARLSLRHAATAVSPLATAVCRFEPR
FT                   GLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMWLMPQRSLKLLGHSDQASRLQS
FT                   LEVGTEWDPKERLFRNFGGLLGPLDEPVAMQRWARGPNLTATVVWIDPTYVVATSYDIT
FT                   VDADTEVTQYKPPLSLPLRPGAWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASW
FT                   LHAGPPHNEYMEQSFQGLSGILNLPQAEALEEAARRHTELTGSALEAWTDGELSNFWSV
FT                   AGLCAIGPSACPSLELCRLTSWSSLSPDPKSELGPVKADGRLRKCAPSGPAEIHEVSLL
FT                   EEEAHWRHRKAVCQSSHKSRVVPEAQCEV"
FT   CDS             complement(join(16328203..16328525,16329819..16330152,
FT                   16330720..16330915,16331205..16331467,16331682..16331858,
FT                   16331946..16332162,16332348..16332428,16333062..16333264,
FT                   16333528..16333703,16333929..16334421,16340916..16341050))
FT                   /codon_start=1
FT                   /gene="Xylt2"
FT                   /locus_tag="mCG_1800"
FT                   /product="xylosyltransferase II, isoform CRA_a"
FT                   /note="gene_id=mCG1800.1 transcript_id=mCT174825.0
FT                   protein_id=mCP97744.0 isoform=CRA_a"
FT                   /protein_id="EDL15946.1"
FT                   /translation="MVASARVQKLVRRYKLAIATALAILLLQGLVVWSFSGLEEDEPGE
FT                   KGRQRKPRPLDPGEGSKDTDSSAGRRGSAGRRHGRWRGRAESPGVPVAKVVRAVTSRQR
FT                   ASRRVPPAPPPEAPGRQNLSGAAAGEALIGAPGFPQHGDTGSVEGAPQPTDNTFTPKCE
FT                   IVGKDALSALARASTKQCQQEIANVVCLHQAGNLMPKSVPRHCQLAGKMSPGVQWEEIR
FT                   AQQPVGGPPVRIAYMLVVHGRAIRQLKRLLKAVYHEQHFFYIHVDKRSNYLYREVVELA
FT                   QHYENVRVTPWRMVTIWGGASLLRMYLRSMKDLLEIPGWTWDFFINLSATDYPTRTNEE
FT                   LVAFLSKNRDKNFLKSHGRDNSRFIKKQGLDRLFHECDSHMWRLGERQIPAGIVVDGGS
FT                   DWFVLTRSFVEYVVYTDDPLVAQLRQFYTYTLLPAESFFHTVLENSPACASLVDNNLRV
FT                   TNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFLRLQQVSRPTFFARKFESTVNQEVLEI
FT                   LDFHLYGSYPPSTPALKAYWENIYDVADGPGGLSDVLLTAYTAFARLSLRHAATAVSPL
FT                   ATAVCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMWLMPQRSLKLLG
FT                   HSDQASRLQSLEVGTEWDPKERLFRNFGGLLGPLDEPVAMQRWARGPNLTATVVWIDPT
FT                   YVVATSYDITVDADTEVTQYKPPLSLPLRPGAWTVRLLQFWEPLGETRFLVLPLTFNRK
FT                   LPLRKDDASWLHAGPPHNEYMEQSFQGLSGILNLPQAEALEEAARRHTELTGSALEAWT
FT                   DGELSNFWSVAGLCAIGPSACPSLELCRLTSWSSLSPDPKSELGPVKADGRLR"
FT   gene            16341206..16353075
FT                   /locus_tag="mCG_147552"
FT                   /note="gene_id=mCG147552.0"
FT   mRNA            join(16341206..16342032,16352390..16353075)
FT                   /locus_tag="mCG_147552"
FT                   /product="mCG147552"
FT                   /note="gene_id=mCG147552.0 transcript_id=mCT187815.0
FT                   created on 13-JAN-2004"
FT   CDS             16352698..16352943
FT                   /codon_start=1
FT                   /locus_tag="mCG_147552"
FT                   /product="mCG147552"
FT                   /note="gene_id=mCG147552.0 transcript_id=mCT187815.0
FT                   protein_id=mCP109318.0"
FT                   /protein_id="EDL15948.1"
FT                   /translation="MSLHDNRKGTKTLTKSGPSLSPAVSLGLQSSSVSKGHEGSSVLGY
FT                   ICDKQKTKTTRQKRKETEKSTTQNPKCPAQNPDSRT"
FT   gene            complement(16364083..16374663)
FT                   /gene="RP23-290B5.6"
FT                   /locus_tag="mCG_147536"
FT                   /note="gene_id=mCG147536.0"
FT   mRNA            complement(join(16364083..16365339,16374245..16374663))
FT                   /gene="RP23-290B5.6"
FT                   /locus_tag="mCG_147536"
FT                   /product="hypothetical protein LOC432589"
FT                   /note="gene_id=mCG147536.0 transcript_id=mCT187799.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(16365172..16365339,16374245..16374403))
FT                   /codon_start=1
FT                   /gene="RP23-290B5.6"
FT                   /locus_tag="mCG_147536"
FT                   /product="hypothetical protein LOC432589"
FT                   /note="gene_id=mCG147536.0 transcript_id=mCT187799.0
FT                   protein_id=mCP109302.0"
FT                   /db_xref="GOA:Q8C4D8"
FT                   /db_xref="MGI:MGI:3650066"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C4D8"
FT                   /protein_id="EDL15949.1"
FT                   /translation="MKTRGRCPLVDSFEEVTLKEWSHVGKKQRLNPPPLRAIHPHFYRK
FT                   EAVEGTTRDEGYKKQLELYFTRQTLQMQFVVLLSSVRADISCSCLGRETKKGDVYSLKY
FT                   IHGA"
FT   gene            16412876..16413992
FT                   /locus_tag="mCG_49160"
FT                   /note="gene_id=mCG49160.2"
FT   mRNA            16412876..16413992
FT                   /locus_tag="mCG_49160"
FT                   /product="mCG49160"
FT                   /note="gene_id=mCG49160.2 transcript_id=mCT49343.2 created
FT                   on 25-OCT-2002"
FT   CDS             16412954..16413667
FT                   /codon_start=1
FT                   /locus_tag="mCG_49160"
FT                   /product="mCG49160"
FT                   /note="gene_id=mCG49160.2 transcript_id=mCT49343.2
FT                   protein_id=mCP25290.2"
FT                   /protein_id="EDL15950.1"
FT                   /translation="MAGPLVPSSQKVLLLELKGLQEEPVEGFRVTLVDEGDLYNWEVAI
FT                   FGPPNTYYEGGYFKAHLKFPIDYPYSPPTFWFLTKMWHPNIHETGFVCISILHPPDDNP
FT                   QGGELPSERWNPTQNVRTILLSVISLLNEPNTSSPANVDASVMYRKWKESKGKDHEYTD
FT                   IIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFDYYVDGEVEEADSCFG
FT                   DEEDDFGPKSPDPRP"
FT   gene            complement(16426819..16432058)
FT                   /locus_tag="mCG_13644"
FT                   /note="gene_id=mCG13644.1"
FT   mRNA            complement(join(16426819..16428057,16428264..16428462,
FT                   16428599..16428697,16429177..16429199,16431719..16432058))
FT                   /locus_tag="mCG_13644"
FT                   /product="mCG13644"
FT                   /note="gene_id=mCG13644.1 transcript_id=mCT16690.1 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(16427956..16428057,16428264..16428462,
FT                   16428599..16428697,16429177..16429199,16431719..16431799))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13644"
FT                   /product="mCG13644"
FT                   /note="gene_id=mCG13644.1 transcript_id=mCT16690.1
FT                   protein_id=mCP2274.2"
FT                   /protein_id="EDL15951.1"
FT                   /translation="MLDTWVPGRLTLIFVLISSLRRVSTNETVNTCDILNCPKGFTCCD
FT                   KDCCPERKVWGPESWNPKNEPFKIVVIILLVMLPLLCICGLVRRFCPNCRELQHDFRTA
FT                   DHQTSPSLPSVAPLENIWVTSLDPPPAYSQVVLKPTPTEPPPPYSLRPEGTSGQRRGHA
FT                   YATL"
FT   gene            complement(<16450148..16453562)
FT                   /locus_tag="mCG_125194"
FT                   /note="gene_id=mCG125194.0"
FT   mRNA            complement(join(<16450148..16450233,16450713..16450735,
FT                   16453243..16453562))
FT                   /locus_tag="mCG_125194"
FT                   /product="mCG125194"
FT                   /note="gene_id=mCG125194.0 transcript_id=mCT126453.0
FT                   created on 25-OCT-2002"
FT   CDS             complement(join(<16450148..16450233,16450713..16450735,
FT                   16453243..16453323))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125194"
FT                   /product="mCG125194"
FT                   /note="gene_id=mCG125194.0 transcript_id=mCT126453.0
FT                   protein_id=mCP85154.1"
FT                   /protein_id="EDL15952.1"
FT                   /translation="MLDTWVWGTLTLTFGLLSSLQGVSFNETANTCDILNCPKGFTCCV
FT                   KECCPERKVWDPANDRFR"
FT   gene            complement(16502177..16506845)
FT                   /locus_tag="mCG_13643"
FT                   /note="gene_id=mCG13643.1"
FT   mRNA            complement(join(16502177..16502886,16503057..16503249,
FT                   16503389..16503472,16503962..16503984,16506591..16506845))
FT                   /locus_tag="mCG_13643"
FT                   /product="mCG13643"
FT                   /note="gene_id=mCG13643.1 transcript_id=mCT16689.2 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(16502785..16502886,16503057..16503249,
FT                   16503389..16503472,16503962..16503984,16506591..16506671))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13643"
FT                   /product="mCG13643"
FT                   /note="gene_id=mCG13643.1 transcript_id=mCT16689.2
FT                   protein_id=mCP2273.2"
FT                   /protein_id="EDL15953.1"
FT                   /translation="MLDTWVWGTLTLTFGLLSSLQGVSANKTANTCDNLNCTKGFTCCH
FT                   NGCCPERELSDLANDHFRIVDLILWALLFVICGTIRHFYFKRTYLLHGVRTSDHQTPPE
FT                   PPSIAPLESIRVTTLDPPPPYSQVVQMTPPTEPPPPYSLRPEGPAGQMRGRAYATL"
FT   gene            complement(16517829..16565520)
FT                   /gene="A430060F13Rik"
FT                   /locus_tag="mCG_13647"
FT                   /note="gene_id=mCG13647.2"
FT   mRNA            complement(join(16517829..16518514,16518682..16518824,
FT                   16519022..16519105,16519584..16519606,16544323..16544413,
FT                   16565383..16565520))
FT                   /gene="A430060F13Rik"
FT                   /locus_tag="mCG_13647"
FT                   /product="RIKEN cDNA A430060F13, transcript variant
FT                   mCT16693"
FT                   /note="gene_id=mCG13647.2 transcript_id=mCT16693.2 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(16518339..16518514,16518682..16518953,
FT                   16519011..16519077))
FT                   /gene="A430060F13Rik"
FT                   /locus_tag="mCG_13647"
FT                   /product="RIKEN cDNA A430060F13, transcript variant
FT                   mCT175074"
FT                   /note="gene_id=mCG13647.2 transcript_id=mCT175074.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(16518413..16518514,16518682..16518824,
FT                   16519022..16519073))
FT                   /codon_start=1
FT                   /gene="A430060F13Rik"
FT                   /locus_tag="mCG_13647"
FT                   /product="RIKEN cDNA A430060F13, isoform CRA_a"
FT                   /note="gene_id=mCG13647.2 transcript_id=mCT16693.2
FT                   protein_id=mCP2279.2 isoform=CRA_a"
FT                   /protein_id="EDL15954.1"
FT                   /translation="MTAAQKESSGSLQITPSLKHFCPKCRELQHEFRTVDHQTPPEQPS
FT                   IVPLESIRVTSLDPPPPYSQVVQMPTPTEPPPPYSLRPEGPAGQMRGRAYATL"
FT   CDS             complement(join(16518413..16518514,16518682..16518936))
FT                   /codon_start=1
FT                   /gene="A430060F13Rik"
FT                   /locus_tag="mCG_13647"
FT                   /product="RIKEN cDNA A430060F13, isoform CRA_b"
FT                   /note="gene_id=mCG13647.2 transcript_id=mCT175074.0
FT                   protein_id=mCP97993.0 isoform=CRA_b"
FT                   /protein_id="EDL15955.1"
FT                   /translation="MAQEHGLGPSDNTIPHLPRIVFINVCIILPLLCVCALVKHFCPKC
FT                   RELQHEFRTVDHQTPPEQPSIVPLESIRVTSLDPPPPYSQVVQMPTPTEPPPPYSLRPE
FT                   GPAGQMRGRAYATL"
FT   gene            16594135..16611003
FT                   /gene="Col1a1"
FT                   /locus_tag="mCG_13651"
FT                   /note="gene_id=mCG13651.1"
FT   mRNA            join(16594135..16594327,16595793..16595987,
FT                   16596110..16596141,16596261..16596296,16596387..16596488,
FT                   16597274..16597342,16597580..16597624,16597787..16597840,
FT                   16598001..16598054,16598428..16598481,16598601..16598654,
FT                   16598985..16599038,16599120..16599164,16599263..16599316,
FT                   16599430..16599509,16599611..16599664,16599899..16599997,
FT                   16600087..16600131,16600225..16600323,16600443..16600496,
FT                   16600678..16600785,16600889..16600942,16601226..16601324,
FT                   16601560..16601613,16602325..16602378,16602568..16602621,
FT                   16602722..16602775,16602884..16602937,16603338..16603382,
FT                   16603470..16603568,16603781..16603880,16604245..16604352,
FT                   16604544..16604597,16604746..16604799,16605044..16605151,
FT                   16605240..16605293,16605404..16605457,16605588..16605749,
FT                   16605853..16605960,16606302..16606409,16606513..16606566,
FT                   16606676..16606783,16607151..16607204,16607326..16607433,
FT                   16607690..16607743,16608067..16608174,16608261..16608543,
FT                   16608679..16608869,16609071..16609313,16609443..16611003)
FT                   /gene="Col1a1"
FT                   /locus_tag="mCG_13651"
FT                   /product="procollagen, type I, alpha 1, transcript variant
FT                   mCT16697"
FT                   /note="gene_id=mCG13651.1 transcript_id=mCT16697.2 created
FT                   on 25-OCT-2002"
FT   mRNA            join(<16594252..16594327,16595793..16595987,
FT                   16596110..16596141,16596261..16596296,16596387..16596488,
FT                   16597274..16597342,16597580..16597624,16597787..16597840,
FT                   16598001..16598054,16598428..16598481,16598601..16598654,
FT                   16598985..16599038,16599120..16599164,16599263..16599316,
FT                   16599430..16599474,16599611..16599664,16599899..16599997,
FT                   16600087..16600131,16600225..16600323,16600443..16600496,
FT                   16600678..16600785,16600889..16600942,16601226..16601324,
FT                   16601560..16601613,16601703..16601801,16602325..16602378,
FT                   16602568..16602621,16602722..16602775,16602884..16602937,
FT                   16603338..16603382,16603470..16603568,16603781..16603888,
FT                   16604245..16604352,16604544..16604597,16604746..16604799,
FT                   16605044..16605151,16605240..16605293,16605404..16605457,
FT                   16605588..16605749,16605853..16605960,16606302..16606409,
FT                   16606513..16606566,16606676..16606783,16607151..16607204,
FT                   16607326..16607433,16607690..16607743,16608067..16608174,
FT                   16608261..16608543,16608679..16608869,16609071..16609313,
FT                   16609443..16609816)
FT                   /gene="Col1a1"
FT                   /locus_tag="mCG_13651"
FT                   /product="procollagen, type I, alpha 1, transcript variant
FT                   mCT191014"
FT                   /note="gene_id=mCG13651.1 transcript_id=mCT191014.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(16594252..16594327,16595793..16595987,
FT                   16596110..16596141,16596261..16596296,16596387..16596488,
FT                   16597274..16597342,16597580..16597624,16597787..16597840,
FT                   16598001..16598054,16598428..16598481,16598601..16598654,
FT                   16598985..16599038,16599120..16599164,16599263..16599316,
FT                   16599430..16599509,16599611..16599664,16599899..16599997,
FT                   16600087..16600131,16600225..16600323,16600443..16600496,
FT                   16600678..16600785,16600889..16600942,16601226..16601324,
FT                   16601560..16601613,16602325..16602378,16602568..16602621,
FT                   16602722..16602775,16602884..16602937,16603338..16603382,
FT                   16603470..16603568,16603781..16603880,16604245..16604352,
FT                   16604544..16604597,16604746..16604799,16605044..16605151,
FT                   16605240..16605293,16605404..16605457,16605588..16605749,
FT                   16605853..16605960,16606302..16606409,16606513..16606566,
FT                   16606676..16606783,16607151..16607204,16607326..16607433,
FT                   16607690..16607743,16608067..16608174,16608261..16608543,
FT                   16608679..16608869,16609071..16609313,16609443..16609589)
FT                   /codon_start=1
FT                   /gene="Col1a1"
FT                   /locus_tag="mCG_13651"
FT                   /product="procollagen, type I, alpha 1, isoform CRA_a"
FT                   /note="gene_id=mCG13651.1 transcript_id=mCT16697.2
FT                   protein_id=mCP2275.2 isoform=CRA_a"
FT                   /protein_id="EDL15956.1"
FT                   /translation="MFSFVDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWK
FT                   PEVCLICICHNGTAVCDDVQCNEELDCPNPQRREGECCAFCPEEYVSPNSEDVGVEGPK
FT                   GDPGPQGPRGPVGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFASQMSYGYDEKSAG
FT                   VSVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGGSGPMGPRGPPGPPGKNGDDG
FT                   EAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSP
FT                   GENGAPGQMGPRGLPGERGRPGPPGTAGARGNDGAVGAAGPPVSMALTLSMGVGVPPAP
FT                   LALLASLVQLVLRVKLVPKELEALKVPRVCVVSPDPLALLVLPALLETLVLMDNLALKV
FT                   PMVLLVLLVLLASLVPEAPLDPRAPAALQVPRVTVVNLVLLATKETLVPKENPVLLEFK
FT                   VPQALPEKKENEEPVVSLDLPDCLDLLASVVDLVAVVSLVLMVLLAPRVLPVNVVLPDL
FT                   LVPKVLLVKLVAPVKLVSLVPRVSLAVLAALVLMAKPAPLENLERLESEAFPDPLALLV
FT                   LLAKMEKLELREPLALLVLLVREVNKVPLAPLDSRVFLVLPVLLVKQASLVNRVFLETL
FT                   VPLDPLAQEAREVSLVNVVYKVPQVLLVPEETMVPPATMVPRVILVPPELPVARVPPVF
FT                   RECLVNVVQLVFQVLRGDAGPKGADGSPGKDGARGLTGPIGPPGPAGAPGDKGEAGPSG
FT                   PPGPTGARGAPGDRGEAGPPGPAGFAGPPGADGQPGAKGEPGDTGVKGDAGPPGPAGPA
FT                   GPPGPIGNVGAPGPKGPRGAAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPVGKEGG
FT                   KGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGSPGTPGPQGIAGQRGVVGLPG
FT                   QRGERGFPGLPGPSGEPGKQGPSGSSGERGPPGPMGPPGLAGPPGESGREGSPGAEGSP
FT                   GRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPAGA
FT                   RGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGSPGSPGEQGPSGASGPAGPRG
FT                   PPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPAGPPGPPGPPGPPGPPSGGYDFSFL
FT                   PQPPQEKSQDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCR
FT                   DLKMCHSDWKSGEYWIDPNQGCNLDAIKVYCNMETGQTCVFPTQPSVPQKNWYISPNPK
FT                   EKKHVWFGESMTDGFPFEYGSEGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMD
FT                   QQTGNLKKALLLQGSNEIELRGEGNSRFTYSTLVDGCTSHTGTWGKTVIEYKTTKTSRL
FT                   PIIDVAPLDIGAPDQEFGLDIGPACFV"
FT   CDS             join(16594252..16594327,16595793..16595987,
FT                   16596110..16596141,16596261..16596296,16596387..16596488,
FT                   16597274..16597342,16597580..16597624,16597787..16597840,
FT                   16598001..16598054,16598428..16598481,16598601..16598654,
FT                   16598985..16599038,16599120..16599164,16599263..16599316,
FT                   16599430..16599474,16599611..16599664,16599899..16599997,
FT                   16600087..16600131,16600225..16600323,16600443..16600496,
FT                   16600678..16600785,16600889..16600942,16601226..16601324,
FT                   16601560..16601613,16601703..16601801,16602325..16602378,
FT                   16602568..16602621,16602722..16602775,16602884..16602937,
FT                   16603338..16603382,16603470..16603568,16603781..16603888,
FT                   16604245..16604352,16604544..16604597,16604746..16604799,
FT                   16605044..16605151,16605240..16605293,16605404..16605457,
FT                   16605588..16605749,16605853..16605960,16606302..16606409,
FT                   16606513..16606566,16606676..16606783,16607151..16607204,
FT                   16607326..16607433,16607690..16607743,16608067..16608174,
FT                   16608261..16608543,16608679..16608869,16609071..16609313,
FT                   16609443..16609589)
FT                   /codon_start=1
FT                   /gene="Col1a1"
FT                   /locus_tag="mCG_13651"
FT                   /product="procollagen, type I, alpha 1, isoform CRA_b"
FT                   /note="gene_id=mCG13651.1 transcript_id=mCT191014.0
FT                   protein_id=mCP111966.0 isoform=CRA_b"
FT                   /protein_id="EDL15957.1"
FT                   /translation="MFSFVDLRLLLLLGATALLTHGQEDIPEVSCIHNGLRVPNGETWK
FT                   PEVCLICICHNGTAVCDDVQCNEELDCPNPQRREGECCAFCPEEYVSPNSEDVGVEGPK
FT                   GDPGPQGPRGPVGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFASQMSYGYDEKSAG
FT                   VSVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGGSGPMGPRGPPGPPGKNGDDG
FT                   EAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSP
FT                   GENGAPGQMGPRGLPGERGRPGPPGTAGARGNDGAVGAAGPPGPTGPTGPPGFPGAVGA
FT                   KGEAGPQGARGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPG
FT                   FPGARGPSGPQGPSGPPGPKGNSGEPGAPGNKGDTGAKGEPGATGVQGPPGPAGEEGKR
FT                   GARGEPGPSGLPGPPGERGGPGSRGFPGADGVAGPKGPSGERGAPGPAGPKGSPGEAGR
FT                   PGEAGLPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPAGPPGARGQAGVMGFPGPKG
FT                   TAGEPGKAGERGLPGPPGAVGPAGKDGEAGAQGAPGPAGPAGERGEQGPAGSPGFQGLP
FT                   GPAGPPGEAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGNNGAPGN
FT                   DGAKGDTGAPGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGARG
FT                   LTGPIGPPGPAGAPGDKGEAGPSGPPGPTGARGAPGDRGEAGPPGPAGFAGPPGADGQP
FT                   GAKGEPGDTGVKGDAGPPGPAGPAGPPGPIGNVGAPGPKGPRGAAGPPGATGFPGAAGR
FT                   VGPPGPSGNAGPPGPPGPVGKEGGKGPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADG
FT                   PAGSPGTPGPQGIAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGSSGERGPPGPM
FT                   GPPGLAGPPGESGREGSPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGP
FT                   AGKNGDRGETGPAGPAGPIGPAGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQG
FT                   PPGSPGSPGEQGPSGASGPAGPRGPPGSAGSPGKDGLNGLPGPIGPPGPRGRTGDSGPA
FT                   GPPGPPGPPGPPGPPSGGYDFSFLPQPPQEKSQDGGRYYRADDANVVRDRDLEVDTTLK
FT                   SLSQQIENIRSPEGSRKNPARTCRDLKMCHSDWKSGEYWIDPNQGCNLDAIKVYCNMET
FT                   GQTCVFPTQPSVPQKNWYISPNPKEKKHVWFGESMTDGFPFEYGSEGSDPADVAIQLTF
FT                   LRLMSTEASQNITYHCKNSVAYMDQQTGNLKKALLLQGSNEIELRGEGNSRFTYSTLVD
FT                   GCTSHTGTWGKTVIEYKTTKTSRLPIIDVAPLDIGAPDQEFGLDIGPACFV"
FT   gene            complement(16620781..16634235)
FT                   /gene="Sgca"
FT                   /locus_tag="mCG_13648"
FT                   /note="gene_id=mCG13648.2"
FT   mRNA            complement(join(16620781..16621039,16621161..16621358,
FT                   16626967..16626993,16627262..16627470,16628579..16628741,
FT                   16629149..16629347,16629878..16629950,16630122..16630276,
FT                   16630400..16630519,16631310..16631386,16634023..16634235))
FT                   /gene="Sgca"
FT                   /locus_tag="mCG_13648"
FT                   /product="sarcoglycan, alpha (dystrophin-associated
FT                   glycoprotein), transcript variant mCT16694"
FT                   /note="gene_id=mCG13648.2 transcript_id=mCT16694.2 created
FT                   on 09-AUG-2002"
FT   mRNA            complement(join(16620783..16620925,16621161..16621358,
FT                   16626967..16626993,16627262..16627470,16628579..16628741,
FT                   16629149..16629347,16629878..16629950,16630122..16630276,
FT                   16630400..16630519,16631310..16631386,16634023..16634235))
FT                   /gene="Sgca"
FT                   /locus_tag="mCG_13648"
FT                   /product="sarcoglycan, alpha (dystrophin-associated
FT                   glycoprotein), transcript variant mCT171444"
FT                   /note="gene_id=mCG13648.2 transcript_id=mCT171444.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(16621178..16621358,16626967..16626993,
FT                   16627262..16627470,16628579..16628741,16629149..16629347,
FT                   16629878..16629950,16630122..16630276,16630400..16630519,
FT                   16631310..16631346))
FT                   /codon_start=1
FT                   /gene="Sgca"
FT                   /locus_tag="mCG_13648"
FT                   /product="sarcoglycan, alpha (dystrophin-associated
FT                   glycoprotein), isoform CRA_a"
FT                   /note="gene_id=mCG13648.2 transcript_id=mCT16694.2
FT                   protein_id=mCP2277.1 isoform=CRA_a"
FT                   /protein_id="EDL15958.1"
FT                   /translation="MAAAVTWIPLLAGLLAGLRDTKAQQTTLHLLVGRVFVHPLEHATF
FT                   LRLPEHVAVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGYQVIE
FT                   VTAYNRDSFDTTRQRLLLLIGDPEGPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGG
FT                   LWEPGELQLLNITSALDRGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARC
FT                   AQGQPPLLSCYDTLAPHFRVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEA
FT                   TDRDFLTDALVTLLVPLLVALLLTLLLAYIMCFRREGRLKRDMATSDIQMFHHCSIHGN
FT                   TEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQMPLILDQH"
FT   CDS             complement(join(16621178..16621358,16626967..16626993,
FT                   16627262..16627470,16628579..16628741,16629149..16629347,
FT                   16629878..16629950,16630122..16630276,16630400..16630519,
FT                   16631310..16631346))
FT                   /codon_start=1
FT                   /gene="Sgca"
FT                   /locus_tag="mCG_13648"
FT                   /product="sarcoglycan, alpha (dystrophin-associated
FT                   glycoprotein), isoform CRA_a"
FT                   /note="gene_id=mCG13648.2 transcript_id=mCT171444.0
FT                   protein_id=mCP94363.0 isoform=CRA_a"
FT                   /protein_id="EDL15959.1"
FT                   /translation="MAAAVTWIPLLAGLLAGLRDTKAQQTTLHLLVGRVFVHPLEHATF
FT                   LRLPEHVAVPPTVRLTYHAHLQGHPDLPRWLHYTQRSPYNPGFLYGSPTPEDRGYQVIE
FT                   VTAYNRDSFDTTRQRLLLLIGDPEGPRLPYQAEFLVRSHDVEEVLPTTPANRFLTALGG
FT                   LWEPGELQLLNITSALDRGGRVPLPIEGRKEGVYIKVGSATPFSTCLKMVASPDSYARC
FT                   AQGQPPLLSCYDTLAPHFRVDWCNVSLVDKSVPEPLDEVPTPGDGILEHDPFFCPPTEA
FT                   TDRDFLTDALVTLLVPLLVALLLTLLLAYIMCFRREGRLKRDMATSDIQMFHHCSIHGN
FT                   TEELRQMAASREVPRPLSTLPMFNVRTGERLPPRVDSAQMPLILDQH"
FT   gene            16625537..16626364
FT                   /gene="Hils1"
FT                   /locus_tag="mCG_13649"
FT                   /note="gene_id=mCG13649.2"
FT   mRNA            16625537..16626364
FT                   /gene="Hils1"
FT                   /locus_tag="mCG_13649"
FT                   /product="histone H1-like protein in spermatids 1"
FT                   /note="gene_id=mCG13649.2 transcript_id=mCT16695.2 created
FT                   on 13-AUG-2002"
FT   CDS             16625789..16626301
FT                   /codon_start=1
FT                   /gene="Hils1"
FT                   /locus_tag="mCG_13649"
FT                   /product="histone H1-like protein in spermatids 1"
FT                   /note="gene_id=mCG13649.2 transcript_id=mCT16695.2
FT                   protein_id=mCP2272.2"
FT                   /db_xref="GOA:Q5SWB1"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="MGI:MGI:2136691"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SWB1"
FT                   /protein_id="EDL15960.1"
FT                   /translation="MAQMVAGDQDAGTLWVPSQSESQTESDISTQSLRKPTMSYVILKT
FT                   LADKRVHNCVSLATLKKAVSITGYNMTHNTWRFKRVLQNLLDKGMIMHVTCCKGASGSL
FT                   CLCKERALKSNHRAKRCQDRQKSQKPQKPGQRESEPCQLLLSSKKKNDQLFKGVRRVAK
FT                   GNRHCHY"
FT   gene            16649298..16681013
FT                   /locus_tag="mCG_13650"
FT                   /note="gene_id=mCG13650.2"
FT   mRNA            join(16649298..16650805,16654423..16654555,
FT                   16655882..16656002,16658095..16658199,16659107..16659242,
FT                   16659730..16659882,16659967..16660046,16662431..16662679,
FT                   16662910..16663006,16663974..16664071,16664538..16664614,
FT                   16674284..16674450,16674853..16675141,16676121..16676208,
FT                   16676309..16676383,16676472..16676631,16678182..16678301,
FT                   16678383..16678538,16679505..16681013)
FT                   /locus_tag="mCG_13650"
FT                   /product="mCG13650, transcript variant mCT126450"
FT                   /note="gene_id=mCG13650.2 transcript_id=mCT126450.1 created
FT                   on 19-JUN-2003"
FT   mRNA            join(16649298..16650805,16654423..16654555,
FT                   16655882..16656002,16658095..16658199,16659107..16659242,
FT                   16659730..16659882,16659967..16660046,16662431..16662679,
FT                   16662910..16663006,16674284..16674450,16674873..16675141,
FT                   16676121..16676208,16676309..16676383,16676472..16676631,
FT                   16678182..16678301,16678383..16678538,16679505..16681013)
FT                   /locus_tag="mCG_13650"
FT                   /product="mCG13650, transcript variant mCT16696"
FT                   /note="gene_id=mCG13650.2 transcript_id=mCT16696.2 created
FT                   on 19-JUN-2003"
FT   CDS             join(16654480..16654555,16655882..16656002,
FT                   16658095..16658199,16659107..16659242,16659730..16659882,
FT                   16659967..16660046,16662431..16662679,16662910..16663006,
FT                   16663974..16664071,16664538..16664614,16674284..16674450,
FT                   16674853..16675141,16676121..16676208,16676309..16676383,
FT                   16676472..16676631,16678182..16678301,16678383..16678538,
FT                   16679505..16679660)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13650"
FT                   /product="mCG13650, isoform CRA_a"
FT                   /note="gene_id=mCG13650.2 transcript_id=mCT126450.1
FT                   protein_id=mCP85459.1 isoform=CRA_a"
FT                   /protein_id="EDL15961.1"
FT                   /translation="MAASAEYELEKRVERLELFPVELEKDSEGLGISIIGMGAGADMGL
FT                   EKLGIFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMI
FT                   GRERPGEQSEVAQLIQQTLEQERWQREMMEQRYAQYGEDDEETGEYATDEDEELSPTFP
FT                   GGEMAIEVFELAENEDALSPVEMEPEKLVHKFKELQIKHAVTEAEIQQLKRKVRVRVPV
FT                   CSAALFSQLQSLEQEKGRWRVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLR
FT                   ETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKV
FT                   PNSHRRPPGTALRPLWASGFLGLAQECQEGGRRAPDSPERAGCHCARPLHFTQADGGDL
FT                   DLAVPETTRLDSSLHKARAQLLAKGRRHRPSRSRLRDSASSAEDGEGSDGPGGKVTDGC
FT                   GSPLHRLRSPLHSGPGSPASGSFCLEPPGLRRSLDEDEPPPSPLARYRPLHNAASHEGL
FT                   AATSGSPPRSAPSSDSSPSFVRRYPRAEPHSEDDSRDASPPEPASPTIGLDKKTRRKFL
FT                   DLGVTLRRASTSRSRKEKGSNRLSMGSRESVEGSGRTGSSPFLPFSWFTDSGKGSASSG
FT                   STTSPTCSPKHEGFSPKKSASQESTLSDDSTPPSSSPKIPGGPRQETKCSYPYHTLSQS
FT                   SDEFLDESLPAVQHWTSQQVGQWLHSLNLEQYAAEFAARQVDGPQLLQLDGSKLKSLGL
FT                   SNSHDRALVKRKLKELAAAAEKERKAQEKTAKQREKLRRRENDAKKS"
FT   CDS             join(16654480..16654555,16655882..16656002,
FT                   16658095..16658199,16659107..16659242,16659730..16659882,
FT                   16659967..16660046,16662431..16662679,16662910..16663006,
FT                   16674284..16674450,16674873..16675141,16676121..16676208,
FT                   16676309..16676383,16676472..16676631,16678182..16678301,
FT                   16678383..16678538,16679505..16679660)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13650"
FT                   /product="mCG13650, isoform CRA_b"
FT                   /note="gene_id=mCG13650.2 transcript_id=mCT16696.2
FT                   protein_id=mCP2270.2 isoform=CRA_b"
FT                   /protein_id="EDL15962.1"
FT                   /translation="MAASAEYELEKRVERLELFPVELEKDSEGLGISIIGMGAGADMGL
FT                   EKLGIFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGVTQSFAASVLRNTKGRVRFMI
FT                   GRERPGEQSEVAQLIQQTLEQERWQREMMEQRYAQYGEDDEETGEYATDEDEELSPTFP
FT                   GGEMAIEVFELAENEDALSPVEMEPEKLVHKFKELQIKHAVTEAEIQQLKRKVRVRVPV
FT                   CSAALFSQLQSLEQEKGRWRVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLR
FT                   ETQAQYQALERKYSKAKRLIKDYQQKEIEFLKKETAQRRVLEESELARKEEMDKLLDKT
FT                   WTWLYQRPPDWTAAYTKPGLNCWPRAGDTGLPVPGYETVPALPRTVKALMGPEASPLHR
FT                   LRSPLHSGPGSPASGSFCLEPPGLRRSLDEDEPPPSPLARYRPLHNAASHEGLAATSGS
FT                   PPRSAPSSDSSPSFVRRYPRAEPHSEDDSRDASPPEPASPTIGLDKKTRRKFLDLGVTL
FT                   RRASTSRSRKEKGSNRLSMGSRESVEGSGRTGSSPFLPFSWFTDSGKGSASSGSTTSPT
FT                   CSPKHEGFSPKKSASQESTLSDDSTPPSSSPKIPGGPRQETKCSYPYHTLSQSSDEFLD
FT                   ESLPAVQHWTSQQVGQWLHSLNLEQYAAEFAARQVDGPQLLQLDGSKLKSLGLSNSHDR
FT                   ALVKRKLKELAAAAEKERKAQEKTAKQREKLRRRENDAKKS"
FT   gene            complement(16681186..16696267)
FT                   /gene="Pdk2"
FT                   /locus_tag="mCG_13652"
FT                   /note="gene_id=mCG13652.2"
FT   mRNA            complement(join(16681186..16682249,16682792..16682905,
FT                   16683406..16683513,16683625..16683723,16683849..16683925,
FT                   16684581..16684658,16684844..16684933,16686763..16686947,
FT                   16687392..16687463,16694276..16694417,16696066..16696267))
FT                   /gene="Pdk2"
FT                   /locus_tag="mCG_13652"
FT                   /product="pyruvate dehydrogenase kinase, isoenzyme 2,
FT                   transcript variant mCT16698"
FT                   /note="gene_id=mCG13652.2 transcript_id=mCT16698.2 created
FT                   on 13-AUG-2002"
FT   mRNA            complement(join(16681186..16682249,16682792..16682905,
FT                   16683406..16683513,16683625..16683723,16683849..16683925,
FT                   16684581..16684658,16684844..16684881,16695312..16695516))
FT                   /gene="Pdk2"
FT                   /locus_tag="mCG_13652"
FT                   /product="pyruvate dehydrogenase kinase, isoenzyme 2,
FT                   transcript variant mCT171900"
FT                   /note="gene_id=mCG13652.2 transcript_id=mCT171900.0 created
FT                   on 13-AUG-2002"
FT   mRNA            complement(join(16681186..16682262,16686763..16686947,
FT                   16687392..16687463,16694276..16694317))
FT                   /gene="Pdk2"
FT                   /locus_tag="mCG_13652"
FT                   /product="pyruvate dehydrogenase kinase, isoenzyme 2,
FT                   transcript variant mCT171899"
FT                   /note="gene_id=mCG13652.2 transcript_id=mCT171899.0 created
FT                   on 13-AUG-2002"
FT   CDS             complement(join(16682066..16682262,16686763..16686947,
FT                   16687392..16687438))
FT                   /codon_start=1
FT                   /gene="Pdk2"
FT                   /locus_tag="mCG_13652"
FT                   /product="pyruvate dehydrogenase kinase, isoenzyme 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG13652.2 transcript_id=mCT171899.0
FT                   protein_id=mCP94819.0 isoform=CRA_c"
FT                   /protein_id="EDL15965.1"
FT                   /translation="MEFLDKDPEDHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDT
FT                   YGDDPVSNQNIQYFLDRFYLSRISIRMLINQHTMLSRPCPRTQWSACLSTTSLPGATTR
FT                   PSRRPATGVCPAQSPRTHRRIGSARGLPSLAPVGCCHL"
FT   CDS             complement(join(16682109..16682249,16682792..16682905,
FT                   16683406..16683513,16683625..16683723,16683849..16683925,
FT                   16684581..16684658,16684844..16684933,16686763..16686947,
FT                   16687392..16687463,16694276..16694417,16696066..16696183))
FT                   /codon_start=1
FT                   /gene="Pdk2"
FT                   /locus_tag="mCG_13652"
FT                   /product="pyruvate dehydrogenase kinase, isoenzyme 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13652.2 transcript_id=mCT16698.2
FT                   protein_id=mCP2278.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JK42"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR018955"
FT                   /db_xref="MGI:MGI:1343087"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JK42"
FT                   /protein_id="EDL15963.1"
FT                   /translation="MRWVRALLKNASLAGAPKYIEHFSKFSPSPLSMKQFLDFGSSNAC
FT                   EKTSFTFLRQELPVRLANIMKEINLLPDRVLGTPSVQLVQSWYVQSLLDIMEFLDKDPE
FT                   DHRTLSQFTDALVTIRNRHNDVVPTMAQGVLEYKDTYGDDPVSNQNIQYFLDRFYLSRI
FT                   SIRMLINQHTLIFDGSTNPAHPKHIGSIDPNCSVSDVVKDAYDMAKLLCDKYYMASPDL
FT                   EIQEVNATNANQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLTLPPIKIMVALGE
FT                   EDLSIKMSDRGGGVPLRKIERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYF
FT                   QGDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPK
FT                   NTSTYRVS"
FT   CDS             complement(join(16682109..16682249,16682792..16682905,
FT                   16683406..16683513,16683625..16683723,16683849..16683925,
FT                   16684581..16684658,16684844..16684881,16695312..16695346))
FT                   /codon_start=1
FT                   /gene="Pdk2"
FT                   /locus_tag="mCG_13652"
FT                   /product="pyruvate dehydrogenase kinase, isoenzyme 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13652.2 transcript_id=mCT171900.0
FT                   protein_id=mCP94818.0 isoform=CRA_b"
FT                   /protein_id="EDL15964.1"
FT                   /translation="METLCGPHLSASIDPNCSVSDVVKDAYDMAKLLCDKYYMASPDLE
FT                   IQEVNATNANQPIHMVYVPSHLYHMLFELFKNAMRATVESHESSLTLPPIKIMVALGEE
FT                   DLSIKMSDRGGGVPLRKIERLFSYMYSTAPTPQPGTGGTPLAGFGYGLPISRLYAKYFQ
FT                   GDLQLFSMEGFGTDAVIYLKALSTDSVERLPVYNKSAWRHYQTIQEAGDWCVPSTEPKN
FT                   TSTYRVS"
FT   gene            complement(16700044..16731826)
FT                   /gene="Itga3"
FT                   /locus_tag="mCG_13646"
FT                   /note="gene_id=mCG13646.2"
FT   mRNA            complement(join(16700044..16700691,16701377..16701518,
FT                   16701849..16701974,16706401..16706499,16707393..16707506,
FT                   16708174..16708296,16708681..16708863,16709024..16709126,
FT                   16710645..16710722,16710806..16710885,16711390..16711461,
FT                   16711653..16711800,16712033..16712130,16712220..16712369,
FT                   16712916..16713052,16713161..16713228,16714273..16714359,
FT                   16714505..16714644,16717385..16717581,16718060..16718270,
FT                   16718642..16718728,16721273..16721522,16723735..16723814,
FT                   16724222..16724349,16731621..16731826))
FT                   /gene="Itga3"
FT                   /locus_tag="mCG_13646"
FT                   /product="integrin alpha 3"
FT                   /note="gene_id=mCG13646.2 transcript_id=mCT16692.2 created
FT                   on 13-AUG-2002"
FT   CDS             complement(join(16701408..16701518,16701849..16701974,
FT                   16706401..16706499,16707393..16707506,16708174..16708296,
FT                   16708681..16708863,16709024..16709126,16710645..16710722,
FT                   16710806..16710885,16711390..16711461,16711653..16711800,
FT                   16712033..16712130,16712220..16712369,16712916..16713052,
FT                   16713161..16713228,16714273..16714359,16714505..16714644,
FT                   16717385..16717396))
FT                   /codon_start=1
FT                   /gene="Itga3"
FT                   /locus_tag="mCG_13646"
FT                   /product="integrin alpha 3"
FT                   /note="gene_id=mCG13646.2 transcript_id=mCT16692.2
FT                   protein_id=mCP2271.2"
FT                   /protein_id="EDL15966.1"
FT                   /translation="MDSRQIIHGEKLGLPGLATFGYSLSGKMDVDENLYPDLLVGSLSD
FT                   HIVLLRARPVINILHRTLVARPAVLDPALCTATSCVQVELCFAYNQSAGNPNYRRNITL
FT                   AYTLEADRDRRPPRLRFARSQSSVFHGFFSMPETHCQTLELLLMDNVRDKLRPIVIAMN
FT                   YSLPLRMPDRLKLGLRSLDAYPVLNQAQAMENHTEVHFQKECGPDNKCDSNLQMRAAFL
FT                   SEQLQPLSRLQYSRDTKKLFLSINVTNSPSSQRAGEDAHEALLTLEVPSALLLSSVRPS
FT                   GTCQANNETILCELGNPFKRNQRMELLIAFEVIGVTLHTRDLPVLLQLSTSSHQDNLQP
FT                   VLLTLQVDYTLQASLSLMNHRLQSFFGGTVMGEAAMKTAEDVGSPLKYEFQVSPVGDGL
FT                   AALGTLVLGLEWPYEVTNGKWLLYPTEITIHSNGSWPCQPSGNLVNPLNLTLSDPGVTP
FT                   LSPQRRRRQLDPGGDQSSPPVTLAAAKKAKSETVLTCSNGRARCVWLECPLPDTSNITN
FT                   VTVKARVWNSTFIEDYKDFDRVRVDGWATLFLRTSIPTINMENKTTWFSVDIDSELVEE
FT                   LPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQPSET
FT                   ERLTDDY"
FT   gene            16775581..16780724
FT                   /gene="Dlx3"
FT                   /locus_tag="mCG_8462"
FT                   /note="gene_id=mCG8462.2"
FT   mRNA            join(16775581..16776091,16777153..16777343,
FT                   16778854..16780724)
FT                   /gene="Dlx3"
FT                   /locus_tag="mCG_8462"
FT                   /product="distal-less homeobox 3"
FT                   /note="gene_id=mCG8462.2 transcript_id=mCT7485.2 created on
FT                   13-AUG-2002"
FT   CDS             join(16775767..16776091,16777153..16777343,
FT                   16778854..16779201)
FT                   /codon_start=1
FT                   /gene="Dlx3"
FT                   /locus_tag="mCG_8462"
FT                   /product="distal-less homeobox 3"
FT                   /note="gene_id=mCG8462.2 transcript_id=mCT7485.2
FT                   protein_id=mCP18296.1"
FT                   /db_xref="GOA:Q78ZZ8"
FT                   /db_xref="InterPro:IPR000047"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="InterPro:IPR022135"
FT                   /db_xref="MGI:MGI:94903"
FT                   /db_xref="UniProtKB/TrEMBL:Q78ZZ8"
FT                   /protein_id="EDL15967.1"
FT                   /translation="MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESTVTDLGYYSA
FT                   PQHDYYSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGGSYRQYGAYREQPLP
FT                   AQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQKAQYLALPERAELA
FT                   AQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPNNSDSMACNSPPSPALWDTSSHS
FT                   TPAPARNPLPPPLPYSASPNYLDDPTNSWYHTQNLSGPHLQQQPPQPATLHHASPGPPP
FT                   NPGAVY"
FT   gene            complement(16795855..>16800889)
FT                   /gene="Dlx4"
FT                   /locus_tag="mCG_8467"
FT                   /note="gene_id=mCG8467.1"
FT   mRNA            complement(join(16795855..16796877,16797197..16797387,
FT                   16800604..>16800889))
FT                   /gene="Dlx4"
FT                   /locus_tag="mCG_8467"
FT                   /product="distal-less homeobox 4"
FT                   /note="gene_id=mCG8467.1 transcript_id=mCT7478.1 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(16796632..16796877,16797197..16797387,
FT                   16800604..16800889))
FT                   /codon_start=1
FT                   /gene="Dlx4"
FT                   /locus_tag="mCG_8467"
FT                   /product="distal-less homeobox 4"
FT                   /note="gene_id=mCG8467.1 transcript_id=mCT7478.1
FT                   protein_id=mCP18301.0"
FT                   /protein_id="EDL15968.1"
FT                   /translation="MTSLPCPLPDRGASNVVFPDLAPALSVVAAYPLGLSPGTAASPDL
FT                   SYSQSYGHPRSYSHPGPATPGDSYLPRQQQLVAPSQPFHRPAEHPQELEAESEKLALSL
FT                   VPSQQQSLTRKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQLAAQLGLTQTQVKIW
FT                   FQNKRSKYKKLLKQSSGEPEEDFSGRPPSLSPHSPALPFIWGLPKADTLPSSGYDNSHF
FT                   GAWYQHRSPDVLALPQMM"
FT   gene            <16800460..16814292
FT                   /locus_tag="mCG_146192"
FT                   /note="gene_id=mCG146192.0"
FT   mRNA            join(<16800460..16800682,16810785..16810939,
FT                   16813196..16814292)
FT                   /locus_tag="mCG_146192"
FT                   /product="mCG146192"
FT                   /note="gene_id=mCG146192.0 transcript_id=mCT186295.0
FT                   created on 14-JUL-2003"
FT   CDS             <16813517..16813873
FT                   /codon_start=1
FT                   /locus_tag="mCG_146192"
FT                   /product="mCG146192"
FT                   /note="gene_id=mCG146192.0 transcript_id=mCT186295.0
FT                   protein_id=mCP107523.0"
FT                   /protein_id="EDL15969.1"
FT                   /translation="RGSAWKVVVASECQAPSRAGRSTWQPVDKPSASTLWGCSVTMVPL
FT                   CVSVCVRQRSASGVFLNSCPVLNLELHNSAQLMARKPQDPPVSSSCWNCRHVCCVQLLP
FT                   WCSGSKARSSCVHV"
FT   gene            16920696..16928474
FT                   /gene="Tac4"
FT                   /locus_tag="mCG_8465"
FT                   /note="gene_id=mCG8465.2"
FT   mRNA            join(16920696..16920986,16924400..16924493,
FT                   16926581..16926640,16927672..16928474)
FT                   /gene="Tac4"
FT                   /locus_tag="mCG_8465"
FT                   /product="tachykinin 4"
FT                   /note="gene_id=mCG8465.2 transcript_id=mCT7480.2 created on
FT                   13-AUG-2002"
FT   CDS             join(16920867..16920986,16924400..16924493,
FT                   16926581..16926640,16927672..16927784)
FT                   /codon_start=1
FT                   /gene="Tac4"
FT                   /locus_tag="mCG_8465"
FT                   /product="tachykinin 4"
FT                   /note="gene_id=mCG8465.2 transcript_id=mCT7480.2
FT                   protein_id=mCP18299.2"
FT                   /protein_id="EDL15970.1"
FT                   /translation="MLPLLALLLLIGPSVCTTAGDREELAFGAEAESWVTVNLKGIPVP
FT                   SIELKLQELKRSRTRQFYGLMGKRVGGYQLGRIVQDLLGTRGLSIEGTCRQAASQQRAR
FT                   PGAVTRESLQSREEDEAPLTTSNV"
FT   gene            complement(16933481..>16974247)
FT                   /gene="Myst2"
FT                   /locus_tag="mCG_8466"
FT                   /note="gene_id=mCG8466.3"
FT   mRNA            complement(join(16933481..16935110,16935666..16935772,
FT                   16936692..16936838,16939612..16939705,16940725..16940865,
FT                   16941063..16941152,16943253..16943444,16945554..16945664,
FT                   16948996..16949094,16950746..16950835,16958332..16958414,
FT                   16964017..16964256,16967173..16967349,16970089..16970236,
FT                   16974081..16974225))
FT                   /gene="Myst2"
FT                   /locus_tag="mCG_8466"
FT                   /product="MYST histone acetyltransferase 2, transcript
FT                   variant mCT7481"
FT                   /note="gene_id=mCG8466.3 transcript_id=mCT7481.1 created on
FT                   25-OCT-2002"
FT   mRNA            complement(join(16933482..16935110,16935666..16935772,
FT                   16936692..16936838,16939612..16939705,16940725..16940865,
FT                   16941063..16941152,16943253..16943444,16945554..16945664,
FT                   16948996..16949094,16958332..16958414,16964017..16964256,
FT                   16970089..16970236,16974081..>16974247))
FT                   /gene="Myst2"
FT                   /locus_tag="mCG_8466"
FT                   /product="MYST histone acetyltransferase 2, transcript
FT                   variant mCT191029"
FT                   /note="gene_id=mCG8466.3 transcript_id=mCT191029.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16935009..16935110,16935666..16935772,
FT                   16936692..16936838,16939612..16939705,16940725..16940865,
FT                   16941063..16941152,16943253..16943444,16945554..16945664,
FT                   16948996..16949094,16958332..16958414,16964017..16964256,
FT                   16970089..16970236,16974081..>16974236))
FT                   /codon_start=1
FT                   /gene="Myst2"
FT                   /locus_tag="mCG_8466"
FT                   /product="MYST histone acetyltransferase 2, isoform CRA_b"
FT                   /note="gene_id=mCG8466.3 transcript_id=mCT191029.0
FT                   protein_id=mCP111994.0 isoform=CRA_b"
FT                   /protein_id="EDL15972.1"
FT                   /translation="TLRGRRHLGSSAGFGTATEAATEPAGAPVPAGAAAARIGTVGLQP
FT                   PAMPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQETK
FT                   NTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRF
FT                   HESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKAPTERQLRYKEKV
FT                   AELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEK
FT                   LRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILR
FT                   RHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPF
FT                   LFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKV
FT                   EEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTL
FT                   QALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT"
FT   CDS             complement(join(16935009..16935110,16935666..16935772,
FT                   16936692..16936838,16939612..16939705,16940725..16940865,
FT                   16941063..16941152,16943253..16943444,16945554..16945664,
FT                   16948996..16949094,16950746..16950835,16958332..16958414,
FT                   16964017..16964256,16967173..16967349,16970089..16970236,
FT                   16974081..16974095))
FT                   /codon_start=1
FT                   /gene="Myst2"
FT                   /locus_tag="mCG_8466"
FT                   /product="MYST histone acetyltransferase 2, isoform CRA_c"
FT                   /note="gene_id=mCG8466.3 transcript_id=mCT7481.1
FT                   protein_id=mCP18300.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q1AJD0"
FT                   /db_xref="InterPro:IPR002515"
FT                   /db_xref="InterPro:IPR002717"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="MGI:MGI:2182799"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AJD0"
FT                   /protein_id="EDL15973.1"
FT                   /translation="MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRS
FT                   SARLSQSSQDSSPVRNLPSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSET
FT                   EQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSG
FT                   SDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKV
FT                   RAQSRDKQIEERMLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKE
FT                   KYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTI
FT                   AFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIY
FT                   RKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIG
FT                   YFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLI
FT                   SYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLK
FT                   RQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT"
FT   mRNA            complement(join(<16945548..16945664,16948996..16949094,
FT                   16958332..16958414,16964017..16964256,16967173..16967349,
FT                   16970089..16970236,16974081..16974244))
FT                   /gene="Myst2"
FT                   /locus_tag="mCG_8466"
FT                   /product="MYST histone acetyltransferase 2, transcript
FT                   variant mCT174829"
FT                   /note="gene_id=mCG8466.3 transcript_id=mCT174829.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(<16945548..16945664,16948996..16949094,
FT                   16958332..16958414,16964017..16964256,16967173..16967349,
FT                   16970089..16970236,16974081..16974095))
FT                   /codon_start=1
FT                   /gene="Myst2"
FT                   /locus_tag="mCG_8466"
FT                   /product="MYST histone acetyltransferase 2, isoform CRA_a"
FT                   /note="gene_id=mCG8466.3 transcript_id=mCT174829.0
FT                   protein_id=mCP97748.0 isoform=CRA_a"
FT                   /protein_id="EDL15971.1"
FT                   /translation="MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRS
FT                   SARLSQSSQDSSPVRNLPSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSET
FT                   EQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSG
FT                   SDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKA
FT                   PTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFR
FT                   RAQARASEDLVS"
FT   gene            complement(17002258..17003554)
FT                   /locus_tag="mCG_57617"
FT                   /note="gene_id=mCG57617.2"
FT   mRNA            complement(join(17002258..17002408,17002944..17003033,
FT                   17003481..17003554))
FT                   /locus_tag="mCG_57617"
FT                   /product="mCG57617"
FT                   /note="gene_id=mCG57617.2 transcript_id=mCT57800.2 created
FT                   on 31-MAR-2003"
FT   CDS             complement(join(17002271..17002408,17002944..17002985))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57617"
FT                   /product="mCG57617"
FT                   /note="gene_id=mCG57617.2 transcript_id=mCT57800.2
FT                   protein_id=mCP38913.2"
FT                   /protein_id="EDL15974.1"
FT                   /translation="MRRFKGEDRHTQSQLSCSLTYKSKTRWSPKRILASCENYMLCICE
FT                   HIFGKKKKQYLRYY"
FT   gene            17003263..17050344
FT                   /gene="5730593F17Rik"
FT                   /locus_tag="mCG_8464"
FT                   /note="gene_id=mCG8464.2"
FT   mRNA            join(17003263..17003508,17030400..17030569,
FT                   17038168..17038263,17041840..17041950,17044062..17044196,
FT                   17045939..17046137,17047275..17047425,17049136..17050344)
FT                   /gene="5730593F17Rik"
FT                   /locus_tag="mCG_8464"
FT                   /product="RIKEN cDNA 5730593F17, transcript variant
FT                   mCT174828"
FT                   /note="gene_id=mCG8464.2 transcript_id=mCT174828.0 created
FT                   on 05-MAR-2003"
FT   mRNA            join(17003263..17003285,17003466..17003508,
FT                   17030400..17030569,17038168..17038263,17041840..17041950,
FT                   17044062..17044196,17045939..17046137,17047275..17047425,
FT                   17049136..17050344)
FT                   /gene="5730593F17Rik"
FT                   /locus_tag="mCG_8464"
FT                   /product="RIKEN cDNA 5730593F17, transcript variant
FT                   mCT180887"
FT                   /note="gene_id=mCG8464.2 transcript_id=mCT180887.0 created
FT                   on 05-MAR-2003"
FT   mRNA            join(17003266..17003297,17003466..17003508,
FT                   17030400..17030569,17038168..17038263,17041840..17041950,
FT                   17044062..17044196,17045939..17046137,17047275..17047425,
FT                   17049136..17050344)
FT                   /gene="5730593F17Rik"
FT                   /locus_tag="mCG_8464"
FT                   /product="RIKEN cDNA 5730593F17, transcript variant
FT                   mCT7479"
FT                   /note="gene_id=mCG8464.2 transcript_id=mCT7479.2 created on
FT                   05-MAR-2003"
FT   CDS             join(17003313..17003508,17030400..17030569,
FT                   17038168..17038263,17041840..17041950,17044062..17044196,
FT                   17045939..17046137,17047275..17047425,17049136..17049433)
FT                   /codon_start=1
FT                   /gene="5730593F17Rik"
FT                   /locus_tag="mCG_8464"
FT                   /product="RIKEN cDNA 5730593F17, isoform CRA_a"
FT                   /note="gene_id=mCG8464.2 transcript_id=mCT174828.0
FT                   protein_id=mCP97747.0 isoform=CRA_a"
FT                   /protein_id="EDL15975.1"
FT                   /translation="MSGAAAGGRGGGSWGPGRGGAGGLRRGCSPPAPAGSPRVGLQPLR
FT                   ATVPFQLQQPHQRRDGGGRAASVPCSVAPEKSVCRPQPPQVRRTFSLDTILSSYLLGQW
FT                   PRDADGAFTCCTNDKATQTPLSWQEPEGERASFCMHKRSASWGSTDHRKEITKLKQQLQ
FT                   RTKLSRSGKEKERSCPVQGDHAALGAGRASLPSHPPGPPVLRLSPCLHRSLEGLNQELE
FT                   EVFVKEQGEEELLRILEVPDGHRAPAPPQNSSCDHSLLLEPGNLTSSPSVPLASPQPPS
FT                   QASREEHQGATEELASIHGNKASSPGNPAFLEDGSPSPVLAFAASPRPNHSYVFKREPP
FT                   EGCERVRVFEEATSPGPDLAFLTSCPDKNKVHFNPTGSAFCPVSLIKPLFPSMGFIFRN
FT                   CPSSPGSPLPTASPRAPRKGPEASKASSLPSEPWQRSPPSEESVLFQSSLVV"
FT   CDS             join(17038216..17038263,17041840..17041950,
FT                   17044062..17044196,17045939..17046137,17047275..17047425,
FT                   17049136..17049433)
FT                   /codon_start=1
FT                   /gene="5730593F17Rik"
FT                   /locus_tag="mCG_8464"
FT                   /product="RIKEN cDNA 5730593F17, isoform CRA_b"
FT                   /note="gene_id=mCG8464.2 transcript_id=mCT180887.0
FT                   protein_id=mCP103809.0 isoform=CRA_b"
FT                   /protein_id="EDL15976.1"
FT                   /translation="MHKRSASWGSTDHRKEITKLKQQLQRTKLSRSGKEKERSCPVQGD
FT                   HAALGAGRASLPSHPPGPPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILEVPD
FT                   GHRAPAPPQNSSCDHSLLLEPGNLTSSPSVPLASPQPPSQASREEHQGATEELASIHGN
FT                   KASSPGNPAFLEDGSPSPVLAFAASPRPNHSYVFKREPPEGCERVRVFEEATSPGPDLA
FT                   FLTSCPDKNKVHFNPTGSAFCPVSLIKPLFPSMGFIFRNCPSSPGSPLPTASPRAPRKG
FT                   PEASKASSLPSEPWQRSPPSEESVLFQSSLVV"
FT   CDS             join(17038216..17038263,17041840..17041950,
FT                   17044062..17044196,17045939..17046137,17047275..17047425,
FT                   17049136..17049433)
FT                   /codon_start=1
FT                   /gene="5730593F17Rik"
FT                   /locus_tag="mCG_8464"
FT                   /product="RIKEN cDNA 5730593F17, isoform CRA_b"
FT                   /note="gene_id=mCG8464.2 transcript_id=mCT7479.2
FT                   protein_id=mCP18298.2 isoform=CRA_b"
FT                   /protein_id="EDL15977.1"
FT                   /translation="MHKRSASWGSTDHRKEITKLKQQLQRTKLSRSGKEKERSCPVQGD
FT                   HAALGAGRASLPSHPPGPPVLRLSPCLHRSLEGLNQELEEVFVKEQGEEELLRILEVPD
FT                   GHRAPAPPQNSSCDHSLLLEPGNLTSSPSVPLASPQPPSQASREEHQGATEELASIHGN
FT                   KASSPGNPAFLEDGSPSPVLAFAASPRPNHSYVFKREPPEGCERVRVFEEATSPGPDLA
FT                   FLTSCPDKNKVHFNPTGSAFCPVSLIKPLFPSMGFIFRNCPSSPGSPLPTASPRAPRKG
FT                   PEASKASSLPSEPWQRSPPSEESVLFQSSLVV"
FT   gene            17053241..17060227
FT                   /gene="Slc35b1"
FT                   /locus_tag="mCG_8469"
FT                   /note="gene_id=mCG8469.2"
FT   mRNA            join(17053241..17053587,17054275..17054378,
FT                   17054960..17055090,17055685..17055715,17056244..17056401,
FT                   17057554..17057680,17058752..17058858,17058999..17059152,
FT                   17059948..17060227)
FT                   /gene="Slc35b1"
FT                   /locus_tag="mCG_8469"
FT                   /product="solute carrier family 35, member B1, transcript
FT                   variant mCT7475"
FT                   /note="gene_id=mCG8469.2 transcript_id=mCT7475.1 created on
FT                   04-MAR-2003"
FT   mRNA            join(17053241..17053587,17054275..17054346,
FT                   17054985..17055090,17055685..17055715,17056244..17056401,
FT                   17057554..17057680,17058752..17058858,17058999..17059123,
FT                   17059948..17060227)
FT                   /gene="Slc35b1"
FT                   /locus_tag="mCG_8469"
FT                   /product="solute carrier family 35, member B1, transcript
FT                   variant mCT180888"
FT                   /note="gene_id=mCG8469.2 transcript_id=mCT180888.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(17053376..17053587,17054275..17054378,
FT                   17054960..17055090,17055685..17055715,17056244..17056401,
FT                   17057554..17057680,17058752..17058858,17058999..17059152,
FT                   17059948..17060000)
FT                   /codon_start=1
FT                   /gene="Slc35b1"
FT                   /locus_tag="mCG_8469"
FT                   /product="solute carrier family 35, member B1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG8469.2 transcript_id=mCT7475.1
FT                   protein_id=mCP18302.1 isoform=CRA_c"
FT                   /protein_id="EDL15980.1"
FT                   /translation="MRSLPPAGDVRLELSPSPPVPLPALNGSSADSSVRLMAASRSLVP
FT                   DRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGPKQETFTFALTLVFIQCVINAMFAK
FT                   ILIQFFDTARVDRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLL
FT                   GVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTVGFGELLLLMSLTLDGLT
FT                   GVSQDHMRAHYQTGSNHMMLNINLWSTFLLGAGILFTGELWEFLSFAERYPTIIYNILL
FT                   FGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISSMQWVGTVLVF
FT                   LGLGLDAKFGKGTKKTSH"
FT   CDS             join(17053376..17053587,17054275..17054346,
FT                   17054985..17055090,17055685..17055715,17056244..17056401,
FT                   17057554..17057680,17058752..17058858,17058999..17059123,
FT                   17059948..17059960)
FT                   /codon_start=1
FT                   /gene="Slc35b1"
FT                   /locus_tag="mCG_8469"
FT                   /product="solute carrier family 35, member B1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG8469.2 transcript_id=mCT180888.0
FT                   protein_id=mCP103810.0 isoform=CRA_a"
FT                   /protein_id="EDL15978.1"
FT                   /translation="MRSLPPAGDVRLELSPSPPVPLPALNGSSADSSVRLMAASRSLVP
FT                   DRLRLPLCFLGVFVCYFYYGILQEKITRGKYGEGPKQETFTFALTLVFIQVDRTRTWLY
FT                   AACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPIPVMLLGVTLLKKKYPLAKYLCVLL
FT                   IVAGVALFMYKPKKVVGIEEHTVGFGELLLLMSLTLDGLTGVSQDHMRAHYQTGSNHMM
FT                   LNINLWSTFLLGAGILFTGELWEFLSFAERYPTIIYNILLFGLTSALGQSFIFMTVVYF
FT                   GPLTCSIITTTRKFFTILASVILFANPISSMQSRS"
FT   mRNA            join(<17053377..17053587,17054275..17054378,
FT                   17054985..17055090,17055685..17055715,17056244..17056401,
FT                   17057554..17057680,17058752..17058858,17058999..17059152,
FT                   17059948..17060227)
FT                   /gene="Slc35b1"
FT                   /locus_tag="mCG_8469"
FT                   /product="solute carrier family 35, member B1, transcript
FT                   variant mCT191031"
FT                   /note="gene_id=mCG8469.2 transcript_id=mCT191031.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<17053513..17053587,17054275..17054378,
FT                   17054985..17055090,17055685..17055715,17056244..17056401,
FT                   17057554..17057680,17058752..17058858,17058999..17059152,
FT                   17059948..17060000)
FT                   /codon_start=1
FT                   /gene="Slc35b1"
FT                   /locus_tag="mCG_8469"
FT                   /product="solute carrier family 35, member B1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG8469.2 transcript_id=mCT191031.0
FT                   protein_id=mCP111995.0 isoform=CRA_b"
FT                   /protein_id="EDL15979.1"
FT                   /translation="SAAPAALLLGCLCLLFLLWDPAGEDHKREVWRRTQTGDIHLCLNF
FT                   GFHPVCDQCYVCQDLVDRTRTWLYAACSVSYVGAMVSSNSALQFVNYPTQVLGKSCKPI
FT                   PVMLLGVTLLKKKYPLAKYLCVLLIVAGVALFMYKPKKVVGIEEHTVGFGELLLLMSLT
FT                   LDGLTGVSQDHMRAHYQTGSNHMMLNINLWSTFLLGAGILFTGELWEFLSFAERYPTII
FT                   YNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISSMQWVG
FT                   TVLVFLGLGLDAKFGKGTKKTSH"
FT   gene            <17082266..17176290
FT                   /gene="Spop"
FT                   /locus_tag="mCG_8470"
FT                   /note="gene_id=mCG8470.2"
FT   mRNA            join(<17082266..17082400,17082792..17082864,
FT                   17153864..17154007,17154565..17154686,17157573..17157724,
FT                   17157827..17157954,17165194..>17165247)
FT                   /gene="Spop"
FT                   /locus_tag="mCG_8470"
FT                   /product="speckle-type POZ protein, transcript variant
FT                   mCT191052"
FT                   /note="gene_id=mCG8470.2 transcript_id=mCT191052.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(17082570..17082588,17082792..17082864,
FT                   17153864..17154007,17154565..17154686,17157573..17157724,
FT                   17157827..17157954,17165194..17165371,17168569..17168624,
FT                   17169114..17169236,17173562..17173704,17174974..17176290)
FT                   /gene="Spop"
FT                   /locus_tag="mCG_8470"
FT                   /product="speckle-type POZ protein, transcript variant
FT                   mCT7476"
FT                   /note="gene_id=mCG8470.2 transcript_id=mCT7476.1 created on
FT                   04-MAR-2003"
FT   mRNA            join(<17082724..17082864,17153864..17154007,
FT                   17154565..17154686,17157573..17157724,17157827..17157954,
FT                   17165194..17165371,17168569..17168624,17169114..17169236,
FT                   17173562..17173704,17174974..17176287)
FT                   /gene="Spop"
FT                   /locus_tag="mCG_8470"
FT                   /product="speckle-type POZ protein, transcript variant
FT                   mCT191053"
FT                   /note="gene_id=mCG8470.2 transcript_id=mCT191053.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<17153897..17154007,17154565..17154686,
FT                   17157573..17157724,17157827..17157954,17165194..17165371,
FT                   17168569..17168624,17169114..17169236,17173562..17173704,
FT                   17174974..17175118)
FT                   /codon_start=1
FT                   /gene="Spop"
FT                   /locus_tag="mCG_8470"
FT                   /product="speckle-type POZ protein, isoform CRA_b"
FT                   /note="gene_id=mCG8470.2 transcript_id=mCT191053.0
FT                   protein_id=mCP112021.0 isoform=CRA_b"
FT                   /protein_id="EDL15982.1"
FT                   /translation="LWRLSLTFKLAMSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSY
FT                   MWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSC
FT                   PKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPD
FT                   DKLTLFCEVSVVQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEF
FT                   QAHKAILAARSPVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMA
FT                   DDLLAAADKYALERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHA
FT                   SDVLETSGWKSMVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS"
FT   CDS             join(<17153897..17154007,17154565..17154686,
FT                   17157573..17157724,17157827..17157954,17165194..>17165247)
FT                   /codon_start=1
FT                   /gene="Spop"
FT                   /locus_tag="mCG_8470"
FT                   /product="speckle-type POZ protein, isoform CRA_a"
FT                   /note="gene_id=mCG8470.2 transcript_id=mCT191052.0
FT                   protein_id=mCP112020.0 isoform=CRA_a"
FT                   /protein_id="EDL15981.1"
FT                   /translation="LWRLSLTFKLAMSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSY
FT                   MWTINNFSFCREEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSC
FT                   PKSEVRAKFKFSILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPD
FT                   DKLTLFCEVSVVQDSVNISGQNTMNM"
FT   CDS             join(17153930..17154007,17154565..17154686,
FT                   17157573..17157724,17157827..17157954,17165194..17165371,
FT                   17168569..17168624,17169114..17169236,17173562..17173704,
FT                   17174974..17175118)
FT                   /codon_start=1
FT                   /gene="Spop"
FT                   /locus_tag="mCG_8470"
FT                   /product="speckle-type POZ protein, isoform CRA_c"
FT                   /note="gene_id=mCG8470.2 transcript_id=mCT7476.1
FT                   protein_id=mCP18293.1 isoform=CRA_c"
FT                   /protein_id="EDL15983.1"
FT                   /translation="MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCR
FT                   EEMGEVIKSSTFSSGANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKF
FT                   SILNAKGEETKAMESQRAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSV
FT                   VQDSVNISGQNTMNMVKVPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARS
FT                   PVFSAMFEHEMEESKKNRVEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYA
FT                   LERLKVMCEDALCSNLSVENAAEILILADLHSADQLKTQAVDFINYHASDVLETSGWKS
FT                   MVVSHPHLVAEAYRSLASAQCPFLGPPRKRLKQS"
FT   gene            complement(17193117..17197936)
FT                   /gene="Nxph3"
FT                   /locus_tag="mCG_8468"
FT                   /note="gene_id=mCG8468.2"
FT   mRNA            complement(join(17193117..17194796,17197425..17197936))
FT                   /gene="Nxph3"
FT                   /locus_tag="mCG_8468"
FT                   /product="neurexophilin 3"
FT                   /note="gene_id=mCG8468.2 transcript_id=mCT7474.2 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(17194092..17194796,17197425..17197478))
FT                   /codon_start=1
FT                   /gene="Nxph3"
FT                   /locus_tag="mCG_8468"
FT                   /product="neurexophilin 3"
FT                   /note="gene_id=mCG8468.2 transcript_id=mCT7474.2
FT                   protein_id=mCP18294.2"
FT                   /db_xref="GOA:Q544G3"
FT                   /db_xref="InterPro:IPR010450"
FT                   /db_xref="InterPro:IPR026845"
FT                   /db_xref="MGI:MGI:1336188"
FT                   /db_xref="UniProtKB/TrEMBL:Q544G3"
FT                   /protein_id="EDL15984.1"
FT                   /translation="MQLTRCCFVFLVQGSLYLVICGQDDGPPGSEDPEHDDHEGQPRPR
FT                   VPRKRGHISPKSRPLANSTLLGLLAPPGEVWGVLGQPPNRPKQSPLPSTKVKKIFGWGD
FT                   FYSNIKTVALNLLVTGKIVDHGNGTFSVHFRHNATGQGNISISLVPPSKAVEFHQEQQI
FT                   FIEAKASKIFNCRMEWEKVERGRRTSLCTHDPAKICSRDHAQSSATWSCSQPFKVVCVY
FT                   IAFYSTDYRLVQKVCPDYNYHSDTPYYPSG"
FT   gene            complement(17254006..17270924)
FT                   /gene="Ngfr"
FT                   /locus_tag="mCG_8463"
FT                   /note="gene_id=mCG8463.2"
FT   mRNA            complement(join(17254006..17254337,17255062..17255222,
FT                   17257416..17257668,17261199..17261558,17264178..17264319,
FT                   17270709..17270924))
FT                   /gene="Ngfr"
FT                   /locus_tag="mCG_8463"
FT                   /product="nerve growth factor receptor (TNFR superfamily,
FT                   member 16)"
FT                   /note="gene_id=mCG8463.2 transcript_id=mCT7482.2 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(17254045..17254337,17255062..17255222,
FT                   17257416..17257668,17261199..17261558,17264178..17264319,
FT                   17270709..17270753))
FT                   /codon_start=1
FT                   /gene="Ngfr"
FT                   /locus_tag="mCG_8463"
FT                   /product="nerve growth factor receptor (TNFR superfamily,
FT                   member 16)"
FT                   /note="gene_id=mCG8463.2 transcript_id=mCT7482.2
FT                   protein_id=mCP18297.2"
FT                   /db_xref="GOA:Q8BYY1"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR001368"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR022325"
FT                   /db_xref="MGI:MGI:97323"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BYY1"
FT                   /protein_id="EDL15985.1"
FT                   /translation="MDRLRLLLLLLLLLGVSFGGAKETCSTGMYTHSGECCKACNLGEG
FT                   VAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMSAPCVEADDAVCRCSY
FT                   GYYQDEETGRCEACSVCGVGSGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLPCTVC
FT                   EDTERQLRECTPWADAECEEIPGRWITRSTPPEGSDVTTPSTQEPEAPPERDLIASTVA
FT                   DTVTTVMGSSQPVVTRGTADNLIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSR
FT                   PVNQTPPPEGEKLHSDSGISVDSQSLHDQQTHTQTASGQALKGDGNLYSSLPLTKREEV
FT                   EKLLNGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWGAQDSATLDALLAALRRIQ
FT                   RADIVESLCSESTATSPV"
FT   gene            17350745..17366916
FT                   /locus_tag="mCG_8461"
FT                   /note="gene_id=mCG8461.3"
FT   mRNA            join(17350745..17350789,17351782..17351896,
FT                   17355128..17355289,17360827..17360969,17361317..17361433,
FT                   17363798..17363899,17365845..17366916)
FT                   /locus_tag="mCG_8461"
FT                   /product="mCG8461, transcript variant mCT171906"
FT                   /note="gene_id=mCG8461.3 transcript_id=mCT171906.2 created
FT                   on 30-NOV-2004"
FT   mRNA            join(17350745..17350789,17351782..17351896,
FT                   17355128..17355289,17360827..17360969,17361317..17361433,
FT                   17363798..17363897,17365845..17366916)
FT                   /locus_tag="mCG_8461"
FT                   /product="mCG8461, transcript variant mCT180886"
FT                   /note="gene_id=mCG8461.3 transcript_id=mCT180886.1 created
FT                   on 30-NOV-2004"
FT   mRNA            join(17350745..17350789,17351782..17351896,
FT                   17355128..17355289,17360827..17360969,17361317..17361433,
FT                   17363798..17363893,17365845..17366916)
FT                   /locus_tag="mCG_8461"
FT                   /product="mCG8461, transcript variant mCT7484"
FT                   /note="gene_id=mCG8461.3 transcript_id=mCT7484.4 created on
FT                   30-NOV-2004"
FT   mRNA            join(17350745..17350773,17351782..17351896,
FT                   17355128..17355289,17360827..17360969,17361317..17361433,
FT                   17363798..17363893,17365845..17366916)
FT                   /locus_tag="mCG_8461"
FT                   /product="mCG8461, transcript variant mCT171905"
FT                   /note="gene_id=mCG8461.3 transcript_id=mCT171905.1 created
FT                   on 30-NOV-2004"
FT   CDS             join(17351809..17351896,17355128..17355289,
FT                   17360827..17360969,17361317..17361433,17363798..17363899,
FT                   17365845..17366057)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8461"
FT                   /product="mCG8461, isoform CRA_c"
FT                   /note="gene_id=mCG8461.3 transcript_id=mCT171906.2
FT                   protein_id=mCP94824.2 isoform=CRA_c"
FT                   /protein_id="EDL15989.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKVSAEQQKKAAIISAEGDSKA
FT                   AELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   CDS             join(17351809..17351896,17355128..17355289,
FT                   17360827..17360969,17361317..17361433,17363798..17363893,
FT                   17365845..17366057)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8461"
FT                   /product="mCG8461, isoform CRA_a"
FT                   /note="gene_id=mCG8461.3 transcript_id=mCT7484.4
FT                   protein_id=mCP18295.2 isoform=CRA_a"
FT                   /protein_id="EDL15986.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   CDS             join(17351809..17351896,17355128..17355289,
FT                   17360827..17360969,17361317..17361433,17363798..17363893,
FT                   17365845..17366057)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8461"
FT                   /product="mCG8461, isoform CRA_a"
FT                   /note="gene_id=mCG8461.3 transcript_id=mCT171905.1
FT                   protein_id=mCP94825.1 isoform=CRA_a"
FT                   /protein_id="EDL15987.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAE
FT                   LIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ"
FT   CDS             join(17351809..17351896,17355128..17355289,
FT                   17360827..17360969,17361317..17361433,17363798..17363897,
FT                   17365845..17365849)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8461"
FT                   /product="mCG8461, isoform CRA_b"
FT                   /note="gene_id=mCG8461.3 transcript_id=mCT180886.1
FT                   protein_id=mCP103808.1 isoform=CRA_b"
FT                   /protein_id="EDL15988.1"
FT                   /translation="MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGV
FT                   QDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLP
FT                   RIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGL
FT                   ILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKVS"
FT   gene            complement(17383242..17385489)
FT                   /locus_tag="mCG_147546"
FT                   /note="gene_id=mCG147546.0"
FT   mRNA            complement(17383242..17385489)
FT                   /locus_tag="mCG_147546"
FT                   /product="mCG147546"
FT                   /note="gene_id=mCG147546.0 transcript_id=mCT187809.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17384168..17384638)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147546"
FT                   /product="mCG147546"
FT                   /note="gene_id=mCG147546.0 transcript_id=mCT187809.0
FT                   protein_id=mCP109312.0"
FT                   /protein_id="EDL15990.1"
FT                   /translation="MGSFPSVLLQRSHTQPFPAQPIRVSKSFSLATSFIHHPASMGRFG
FT                   LTRPKPTEVKDAQPLGNLGFSEKQSTCPAWPRALSHRPICIWSVQRPEALHLNRCSQGT
FT                   SLDGFLIVYSPRIFPKLVVLTSDQWGGGAGESLSRFQYTSTILISRMLSSPG"
FT   gene            17419301..17421017
FT                   /locus_tag="mCG_147545"
FT                   /note="gene_id=mCG147545.0"
FT   mRNA            17419301..17421017
FT                   /locus_tag="mCG_147545"
FT                   /product="mCG147545"
FT                   /note="gene_id=mCG147545.0 transcript_id=mCT187808.1
FT                   created on 19-MAR-2004"
FT   CDS             17420599..17420820
FT                   /codon_start=1
FT                   /locus_tag="mCG_147545"
FT                   /product="mCG147545"
FT                   /note="gene_id=mCG147545.0 transcript_id=mCT187808.1
FT                   protein_id=mCP109311.1"
FT                   /protein_id="EDL15991.1"
FT                   /translation="MHKTLELSLTLQLKHQRIVSEDMVCQLRALAALSEDLHLIPCTHM
FT                   AAVCNSSSRDLVPCSKAEGWGNHPSLFF"
FT   gene            17435758..17451933
FT                   /locus_tag="mCG_3800"
FT                   /note="gene_id=mCG3800.2"
FT   mRNA            join(17435758..17435821,17435975..17436905,
FT                   17439633..17439780,17440120..17440235,17440669..17440813,
FT                   17450297..17451933)
FT                   /locus_tag="mCG_3800"
FT                   /product="mCG3800"
FT                   /note="gene_id=mCG3800.2 transcript_id=mCT2630.1 created on
FT                   25-OCT-2002"
FT   CDS             join(17435763..17435821,17435975..17436905,
FT                   17439633..17439780,17440120..17440235,17440669..17440813,
FT                   17450297..17450817)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3800"
FT                   /product="mCG3800"
FT                   /note="gene_id=mCG3800.2 transcript_id=mCT2630.1
FT                   protein_id=mCP23537.1"
FT                   /protein_id="EDL15992.1"
FT                   /translation="MLQVPCSSLRKKTRSALRLPCSVSSELGHFLMSYTASPCPELVEP
FT                   CAVHAEGMAQEESHRSQAPPTFYHGASQELDLSTKVYKRESGSPYSVLADTKMSKPHLH
FT                   ETEEQPYFREPRAVSDVHTVKEDRENSDDTEEEEEVSYKREQIIVEVNLNNQTLNVSKG
FT                   EKGVSSQSKETPVLKTSSEEDEEETEEEATDNSSDYGENGRQKKKEKQVERVRVTQRRT
FT                   RRAASAAAATTSPAPRTTRGRRKSAELPKRKKRATKEAKAPVQKAKCEEKETLTCEKCP
FT                   RVFNTRWYLEKHMNVTHRRMQICDKCGKKFVLESELSLHQQTDCEKNIQCVSCNKSFKK
FT                   LWSLHEHIKIVHGYAEKKFACEICEKKFYTMAHVRKHMVAHTKDMPFTCETCGKSFKRS
FT                   MSLKVHSLQHSGEKPFRCENCDERFQYKYQLRSHMSIHIGHKQFMCQWCGKDFNMKQYF
FT                   DEHMKTHTGEKPFICEICGKSFTSRPNMKRHRRTHTGEKPYPCDVCGQRFRFSNMLKAH
FT                   KEKCFRVTSPVNVPPAVQIPLASAPAAPAPAVANTPTSPAPAVSMSPVGAVLPSRPVPH
FT                   PFSHLHIHTHPHHAHHLPIPPVPHLPPPPALFKSEPLNHRSQSEDTFLRHLAEKNSAAP
FT                   AQHH"
FT   gene            17511264..17518864
FT                   /gene="Phospho1"
FT                   /locus_tag="mCG_50995"
FT                   /note="gene_id=mCG50995.2"
FT   mRNA            join(17511264..17511478,17515391..17515500,
FT                   17517158..17518864)
FT                   /gene="Phospho1"
FT                   /locus_tag="mCG_50995"
FT                   /product="phosphatase, orphan 1, transcript variant
FT                   mCT51178"
FT                   /note="gene_id=mCG50995.2 transcript_id=mCT51178.2 created
FT                   on 04-MAR-2003"
FT   mRNA            join(<17511269..17511478,17515391..17515500,
FT                   17517276..>17518034)
FT                   /gene="Phospho1"
FT                   /locus_tag="mCG_50995"
FT                   /product="phosphatase, orphan 1, transcript variant
FT                   mCT191010"
FT                   /note="gene_id=mCG50995.2 transcript_id=mCT191010.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<17515441..17515500,17517276..17518034)
FT                   /codon_start=1
FT                   /gene="Phospho1"
FT                   /locus_tag="mCG_50995"
FT                   /product="phosphatase, orphan 1, isoform CRA_a"
FT                   /note="gene_id=mCG50995.2 transcript_id=mCT191010.0
FT                   protein_id=mCP111990.0 isoform=CRA_a"
FT                   /protein_id="EDL15993.1"
FT                   /translation="DNILTMSGCFPAVGLRCLSRDGRMAAPGAPRFLLTFDFDETIVDE
FT                   NSDDSIVRAAPGQQLPESLRATYREGYYNEYMQRVFKYLGEQGVRPRDLRAVYETIPLS
FT                   PGMGDLLQFIAKQGSCFEVILISDANTFGVESALRAAGHHSLFRRILSNPSGPDARGLL
FT                   TLRPFHTHSCSRCPANMCKHKVLSEYLRERARDGVHFERLFYVGDGANDFCPMGLLAGG
FT                   DVAFPRRGYPMHRLIQEAQKAEPSSFRAHVVPWETAADVRQHLQQVLKMC"
FT   CDS             17517165..17518034
FT                   /codon_start=1
FT                   /gene="Phospho1"
FT                   /locus_tag="mCG_50995"
FT                   /product="phosphatase, orphan 1, isoform CRA_b"
FT                   /note="gene_id=mCG50995.2 transcript_id=mCT51178.2
FT                   protein_id=mCP42960.2 isoform=CRA_b"
FT                   /protein_id="EDL15994.1"
FT                   /translation="MCQRPWLWPANQLLPGRLPPRRLSLASSSCSSSPCSQDGRMAAPG
FT                   APRFLLTFDFDETIVDENSDDSIVRAAPGQQLPESLRATYREGYYNEYMQRVFKYLGEQ
FT                   GVRPRDLRAVYETIPLSPGMGDLLQFIAKQGSCFEVILISDANTFGVESALRAAGHHSL
FT                   FRRILSNPSGPDARGLLTLRPFHTHSCSRCPANMCKHKVLSEYLRERARDGVHFERLFY
FT                   VGDGANDFCPMGLLAGGDVAFPRRGYPMHRLIQEAQKAEPSSFRAHVVPWETAADVRQH
FT                   LQQVLKMC"
FT   gene            complement(17518665..17529204)
FT                   /gene="Abi3"
FT                   /locus_tag="mCG_3789"
FT                   /note="gene_id=mCG3789.2"
FT   mRNA            complement(join(17518665..17519601,17519934..17520059,
FT                   17520365..17520525,17520728..17520823,17521031..17521116,
FT                   17522506..17522682,17523797..17523964,17528748..17529171))
FT                   /gene="Abi3"
FT                   /locus_tag="mCG_3789"
FT                   /product="ABI gene family, member 3, transcript variant
FT                   mCT2645"
FT                   /note="gene_id=mCG3789.2 transcript_id=mCT2645.1 created on
FT                   04-MAR-2003"
FT   mRNA            complement(join(17518666..17519601,17519934..17520059,
FT                   17520365..17520525,17520728..17520823,17521031..17521116,
FT                   17522506..17522682,17523797..17523964,17529136..17529204))
FT                   /gene="Abi3"
FT                   /locus_tag="mCG_3789"
FT                   /product="ABI gene family, member 3, transcript variant
FT                   mCT180877"
FT                   /note="gene_id=mCG3789.2 transcript_id=mCT180877.0 created
FT                   on 04-MAR-2003"
FT   CDS             complement(join(17519438..17519601,17519934..17520059,
FT                   17520365..17520525,17520728..17520823,17521031..17521116,
FT                   17522506..17522682,17523797..17523964,17528748..17528873))
FT                   /codon_start=1
FT                   /gene="Abi3"
FT                   /locus_tag="mCG_3789"
FT                   /product="ABI gene family, member 3, isoform CRA_a"
FT                   /note="gene_id=mCG3789.2 transcript_id=mCT2645.1
FT                   protein_id=mCP23538.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BYZ1"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR012849"
FT                   /db_xref="InterPro:IPR028455"
FT                   /db_xref="InterPro:IPR028457"
FT                   /db_xref="MGI:MGI:1913860"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BYZ1"
FT                   /protein_id="EDL15995.1"
FT                   /translation="MAELQQLQQLQEFDIPTGREALRGNHSALLRVANYCEDNYLQATD
FT                   KRKALEETMAFTTQALASVAYQVGNLAGHTLRMLDLQGAALRQVEAKMSTLGQMVNMHM
FT                   EKVARREIGTLATVVRLPSNQKVIPPESLPSLTPYHRKPLNFACLDDIGHGVKDLSTQL
FT                   SRTGTLSRKSIKAPATPVSATLGRPPRIPEPVQLPAVPDGKLSAASSASSLASAGSAEG
FT                   ASGIPQSKGQVAPATPPPPPVAPVTPPPPPLSAEVFLPPPPLEVSQPPLEAELPLPPPP
FT                   ALEGDELGLLPPPPPGFGPDEPSWVPASYLEKVVTLYPYTRQKDNELSFSEGTVICVTR
FT                   RYSDGWCEGVSSEGTGFFPGNYVEPSC"
FT   CDS             complement(join(17519438..17519601,17519934..17520059,
FT                   17520365..17520525,17520728..17520823,17521031..17521116,
FT                   17522506..17522682,17523797..17523931))
FT                   /codon_start=1
FT                   /gene="Abi3"
FT                   /locus_tag="mCG_3789"
FT                   /product="ABI gene family, member 3, isoform CRA_b"
FT                   /note="gene_id=mCG3789.2 transcript_id=mCT180877.0
FT                   protein_id=mCP103799.0 isoform=CRA_b"
FT                   /protein_id="EDL15996.1"
FT                   /translation="MAFTTQALASVAYQVGNLAGHTLRMLDLQGAALRQVEAKMSTLGQ
FT                   MVNMHMEKVARREIGTLATVVRLPSNQKVIPPESLPSLTPYHRKPLNFACLDDIGHGVK
FT                   DLSTQLSRTGTLSRKSIKAPATPVSATLGRPPRIPEPVQLPAVPDGKLSAASSASSLAS
FT                   AGSAEGASGIPQSKGQVAPATPPPPPVAPVTPPPPPLSAEVFLPPPPLEVSQPPLEAEL
FT                   PLPPPPALEGDELGLLPPPPPGFGPDEPSWVPASYLEKVVTLYPYTRQKDNELSFSEGT
FT                   VICVTRRYSDGWCEGVSSEGTGFFPGNYVEPSC"
FT   gene            17523942..17532515
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /note="gene_id=mCG3791.2"
FT   mRNA            join(17523942..17524098,17531785..17531874,
FT                   17532265..17532405)
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, transcript
FT                   variant mCT180880"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT180880.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(17524090..17524098,17531785..17531874,
FT                   17532265..17532390)
FT                   /codon_start=1
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, isoform CRA_b"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT180880.0
FT                   protein_id=mCP103802.0 isoform=CRA_b"
FT                   /protein_id="EDL15999.1"
FT                   /translation="MPEGRMAQDLSEKELLRMEVEQLKKEVKNPRDLISKTGKEIKDYV
FT                   EAQAGTDPLLKGIPEDKNPFKEKGTCVLS"
FT   mRNA            join(17528989..17529009,17530537..17530620,
FT                   17531785..17531874,17532265..17532487)
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, transcript
FT                   variant mCT180879"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT180879.0 created
FT                   on 04-MAR-2003"
FT   mRNA            join(17529092..17529153,17530537..17530620,
FT                   17531766..17531874,17532265..17532511)
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, transcript
FT                   variant mCT180878"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT180878.0 created
FT                   on 04-MAR-2003"
FT   mRNA            join(17529387..17530620,17531766..17531874,
FT                   17532265..17532515)
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, transcript
FT                   variant mCT2633"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT2633.2 created on
FT                   04-MAR-2003"
FT   mRNA            join(17529387..17529520,17530537..17530620,
FT                   17531766..17531864,17532265..17532465)
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, transcript
FT                   variant mCT173333"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT173333.0 created
FT                   on 04-MAR-2003"
FT   CDS             17529553..17529930
FT                   /codon_start=1
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, isoform CRA_c"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT2633.2
FT                   protein_id=mCP23543.2 isoform=CRA_c"
FT                   /protein_id="EDL16000.1"
FT                   /translation="MMVGEGEIDQITSTGTRISNRKALDVRQHWSRWMCGLEAALVNRA
FT                   LSALTRSWKVQWFCLKLEFKEVPDVSGGDLILHLGWLYRAPPPPSLSSSWQKRNLSNHT
FT                   GSLTFPQECPLLLDKCQPELC"
FT   CDS             join(17531791..17531874,17532265..17532390)
FT                   /codon_start=1
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, isoform CRA_a"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT180878.0
FT                   protein_id=mCP103801.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2A614"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:893584"
FT                   /db_xref="UniProtKB/TrEMBL:A2A614"
FT                   /protein_id="EDL15997.1"
FT                   /translation="MAQDLSEKELLRMEVEQLKKEVKNPRDLISKTGKEIKDYVEAQAG
FT                   TDPLLKGIPEDKNPFKEKGTCVLS"
FT   CDS             join(17531791..17531874,17532265..17532390)
FT                   /codon_start=1
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, isoform CRA_a"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT180879.0
FT                   protein_id=mCP103800.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2A614"
FT                   /db_xref="InterPro:IPR001770"
FT                   /db_xref="InterPro:IPR015898"
FT                   /db_xref="MGI:MGI:893584"
FT                   /db_xref="UniProtKB/TrEMBL:A2A614"
FT                   /protein_id="EDL15998.1"
FT                   /translation="MAQDLSEKELLRMEVEQLKKEVKNPRDLISKTGKEIKDYVEAQAG
FT                   TDPLLKGIPEDKNPFKEKGTCVLS"
FT   CDS             join(17531791..17531864,17532265..17532301)
FT                   /codon_start=1
FT                   /gene="Gngt2"
FT                   /locus_tag="mCG_3791"
FT                   /product="guanine nucleotide binding protein (G protein),
FT                   gamma transducing activity polypeptide 2, isoform CRA_d"
FT                   /note="gene_id=mCG3791.2 transcript_id=mCT173333.0
FT                   protein_id=mCP96252.0 isoform=CRA_d"
FT                   /protein_id="EDL16001.1"
FT                   /translation="MAQDLSEKELLRMEVEQLKKEVKNPFPRQERKSRIM"
FT   gene            17545691..17547873
FT                   /locus_tag="mCG_147547"
FT                   /note="gene_id=mCG147547.0"
FT   mRNA            join(17545691..17545911,17546823..17547873)
FT                   /locus_tag="mCG_147547"
FT                   /product="mCG147547"
FT                   /note="gene_id=mCG147547.0 transcript_id=mCT187810.0
FT                   created on 13-JAN-2004"
FT   CDS             17547744..17547851
FT                   /codon_start=1
FT                   /locus_tag="mCG_147547"
FT                   /product="mCG147547"
FT                   /note="gene_id=mCG147547.0 transcript_id=mCT187810.0
FT                   protein_id=mCP109313.0"
FT                   /protein_id="EDL16002.1"
FT                   /translation="MYRAVYLLCDLVLGFYRIATYGMNIFNYNRLLHII"
FT   gene            complement(17552850..17601691)
FT                   /gene="B4galnt2"
FT                   /locus_tag="mCG_117861"
FT                   /note="gene_id=mCG117861.0"
FT   mRNA            complement(join(17552850..17553105,17553579..17553798,
FT                   17555179..17555319,17556067..17556254,17560689..17560775,
FT                   17562925..17563105,17570770..17570807,17575634..17575740,
FT                   17577788..17577925,17578573..17578788,17601640..17601691))
FT                   /gene="B4galnt2"
FT                   /locus_tag="mCG_117861"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 2"
FT                   /note="gene_id=mCG117861.0 transcript_id=mCT119007.0
FT                   created on 13-AUG-2002"
FT   CDS             complement(join(17552900..17553105,17553579..17553798,
FT                   17555179..17555319,17556067..17556254,17560689..17560775,
FT                   17562925..17563105,17570770..17570807,17575634..17575740,
FT                   17577788..17577925,17578573..17578788,17601640..17601650))
FT                   /codon_start=1
FT                   /gene="B4galnt2"
FT                   /locus_tag="mCG_117861"
FT                   /product="beta-1,4-N-acetyl-galactosaminyl transferase 2"
FT                   /note="gene_id=mCG117861.0 transcript_id=mCT119007.0
FT                   protein_id=mCP85550.1"
FT                   /db_xref="GOA:A2A615"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR011143"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="MGI:MGI:1342058"
FT                   /db_xref="UniProtKB/TrEMBL:A2A615"
FT                   /protein_id="EDL16003.1"
FT                   /translation="MTSSVSFASFRFPWLLKTFVLMVGLATVAFMVRKVSLTTDFSTFK
FT                   PKFPEPARVDPVLKLLPEEHLRKLFTYSDIWLFPKNQCDCNSGKLRMKYKFQDAYNQKD
FT                   LPAVNARRQAEFEHFQRREGLPRPPPLLAPPNLPFGYPVHGVEVMPLHTILIPGLQYEG
FT                   PDAPVYEVILKASLGTLNTLADVPDDEVQGRGQRQLTISTRHRKVLNFILQHVTYTSTE
FT                   YYLHKVDTVSMEYESSVAKFPVTIKQQTVPKLYDPGPERKIRNLVTIATKTFLRPHKLK
FT                   ILLQSIRKYYPDITVIVADDSKEPLEINDDYVEYYTMPFGKGWFAGRNLAISQVTTKYV
FT                   LWVDDDFLFSDKTKIEVLVDVLEKTELDVVGGSVQGNTYQFRLLYEQTKNGSCLHQRWG
FT                   SFQALDGFPGCTLTSGVVNFFLAHTEQLRRVGFDPILQRVAHGEFFIDGLGRLLVGSCP
FT                   GVIINHQVRTPPKDPKLAALEKTYDKYRANTNSVIQFKVALQYFKNHLYCST"
FT   gene            complement(17657956..17701115)
FT                   /gene="Igf2bp1"
FT                   /locus_tag="mCG_3796"
FT                   /note="gene_id=mCG3796.2"
FT   mRNA            complement(join(17657956..17658816,17661405..17661518,
FT                   17661882..17662013,17662780..17662854,17663594..17663713,
FT                   17664030..17664152,17665080..17665215,17665900..17666022,
FT                   17668276..17668410,17669170..17669451,17670491..17670554,
FT                   17674513..17674564,17674852..17674900,17699461..17699521,
FT                   17700631..17701115))
FT                   /gene="Igf2bp1"
FT                   /locus_tag="mCG_3796"
FT                   /product="insulin-like growth factor 2 mRNA binding protein
FT                   1"
FT                   /note="gene_id=mCG3796.2 transcript_id=mCT2631.2 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(17658724..17658816,17661405..17661518,
FT                   17661882..17662013,17662780..17662854,17663594..17663713,
FT                   17664030..17664152,17665080..17665215,17665900..17666022,
FT                   17668276..17668410,17669170..17669451,17670491..17670554,
FT                   17674513..17674564,17674852..17674900,17699461..17699521,
FT                   17700631..17700805))
FT                   /codon_start=1
FT                   /gene="Igf2bp1"
FT                   /locus_tag="mCG_3796"
FT                   /product="insulin-like growth factor 2 mRNA binding protein
FT                   1"
FT                   /note="gene_id=mCG3796.2 transcript_id=mCT2631.2
FT                   protein_id=mCP23585.2"
FT                   /protein_id="EDL16004.1"
FT                   /translation="MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCP
FT                   DEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQY
FT                   GTVENCEQVNTESETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQITQGP
FT                   ENGRRGGFGSRGQPRQGSPVAAGAPAKQQPVDIPLRLLVPTQYVGAIIGKEGATIRNIT
FT                   KQTQSKIDVHRKENAGAAEKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKI
FT                   LAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAE
FT                   QEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSF
FT                   MQAPEQEMVQVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVVITG
FT                   PPEAQFKAQGRIYGKLKEENFFGPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLT
FT                   AAEVVVPRDQTPDENDQVIVKIIGHFYASQMAQRKIRDILAQVKQQHQKGQSNLAQARR
FT                   K"
FT   gene            17719553..17725801
FT                   /gene="Gip"
FT                   /locus_tag="mCG_117860"
FT                   /note="gene_id=mCG117860.1"
FT   mRNA            join(17719553..17719632,17720363..17720470,
FT                   17721593..17721739,17723655..17723744,17724461..17724562,
FT                   17725680..17725801)
FT                   /gene="Gip"
FT                   /locus_tag="mCG_117860"
FT                   /product="gastric inhibitory polypeptide"
FT                   /note="gene_id=mCG117860.1 transcript_id=mCT119006.1
FT                   created on 13-AUG-2002"
FT   CDS             join(17720385..17720470,17721593..17721739,
FT                   17723655..17723744,17724461..17724562,17725680..17725689)
FT                   /codon_start=1
FT                   /gene="Gip"
FT                   /locus_tag="mCG_117860"
FT                   /product="gastric inhibitory polypeptide"
FT                   /note="gene_id=mCG117860.1 transcript_id=mCT119006.1
FT                   protein_id=mCP85548.1"
FT                   /db_xref="GOA:P48756"
FT                   /db_xref="InterPro:IPR000532"
FT                   /db_xref="MGI:MGI:107504"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48756"
FT                   /protein_id="EDL16005.1"
FT                   /translation="MVALKTCSLLLVLLFLAVGLGEKEEVEFRSHAKFAGPRPRGPRYA
FT                   EGTFISDYSIAMDKIRQQDFVNWLLAQRGKKSDWKHNITQREARALVLAGQSQGKEDKE
FT                   AQESSLPKSLSDDDVLRDLLIQELLAWMVDQTELCRLRSQ"
FT   gene            17729887..17742262
FT                   /gene="Snf8"
FT                   /locus_tag="mCG_3802"
FT                   /note="gene_id=mCG3802.2"
FT   mRNA            join(17729887..17730040,17730292..17730342,
FT                   17734212..17734350,17736558..17736662,17738234..17738306,
FT                   17739992..17740133,17741111..17741185,17742026..17742262)
FT                   /gene="Snf8"
FT                   /locus_tag="mCG_3802"
FT                   /product="SNF8, ESCRT-II complex subunit, homolog (S.
FT                   cerevisiae), transcript variant mCT2627"
FT                   /note="gene_id=mCG3802.2 transcript_id=mCT2627.2 created on
FT                   04-MAR-2003"
FT   mRNA            join(17729887..17730040,17730292..17730342,
FT                   17734212..17734350,17736558..17736662,17738234..17738306,
FT                   17739992..17740133,17742026..17742252)
FT                   /gene="Snf8"
FT                   /locus_tag="mCG_3802"
FT                   /product="SNF8, ESCRT-II complex subunit, homolog (S.
FT                   cerevisiae), transcript variant mCT171904"
FT                   /note="gene_id=mCG3802.2 transcript_id=mCT171904.0 created
FT                   on 04-MAR-2003"
FT   mRNA            join(17729959..17730040,17730292..17730342,
FT                   17734212..17734350,17736558..17736662,17738234..17738306,
FT                   17739992..17740133,17741111..17741632)
FT                   /gene="Snf8"
FT                   /locus_tag="mCG_3802"
FT                   /product="SNF8, ESCRT-II complex subunit, homolog (S.
FT                   cerevisiae), transcript variant mCT180883"
FT                   /note="gene_id=mCG3802.2 transcript_id=mCT180883.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(17729987..17730040,17730292..17730342,
FT                   17734212..17734350,17736558..17736662,17738234..17738306,
FT                   17739992..17740133,17741111..17741185,17742026..17742247)
FT                   /codon_start=1
FT                   /gene="Snf8"
FT                   /locus_tag="mCG_3802"
FT                   /product="SNF8, ESCRT-II complex subunit, homolog (S.
FT                   cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG3802.2 transcript_id=mCT2627.2
FT                   protein_id=mCP23600.2 isoform=CRA_c"
FT                   /protein_id="EDL16008.1"
FT                   /translation="MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKT
FT                   NLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQI
FT                   IEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPV
FT                   GGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKTSLKWETERARQVLEHLLKEGLA
FT                   WLDLQAPGEAHYWLPALFTDLYSQEISAEEAKEASLDSLTECGGVDSSRPEDALSVNKP
FT                   GQLCL"
FT   CDS             join(17729987..17730040,17730292..17730342,
FT                   17734212..17734350,17736558..17736662,17738234..17738306,
FT                   17739992..17740133,17742026..17742247)
FT                   /codon_start=1
FT                   /gene="Snf8"
FT                   /locus_tag="mCG_3802"
FT                   /product="SNF8, ESCRT-II complex subunit, homolog (S.
FT                   cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG3802.2 transcript_id=mCT171904.0
FT                   protein_id=mCP94823.0 isoform=CRA_a"
FT                   /protein_id="EDL16006.1"
FT                   /translation="MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKT
FT                   NLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQI
FT                   IEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPV
FT                   GGTYLIQSVPAELNMDHTVVLQLAEEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQE
FT                   ISAEEAKEASLDSLTECGGVDSSRPEDALSVNKPGQLCL"
FT   CDS             join(17729987..17730040,17730292..17730342,
FT                   17734212..17734350,17736558..17736662,17738234..17738306,
FT                   17739992..17740133,17741111..17741374)
FT                   /codon_start=1
FT                   /gene="Snf8"
FT                   /locus_tag="mCG_3802"
FT                   /product="SNF8, ESCRT-II complex subunit, homolog (S.
FT                   cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG3802.2 transcript_id=mCT180883.0
FT                   protein_id=mCP103805.0 isoform=CRA_b"
FT                   /protein_id="EDL16007.1"
FT                   /translation="MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKT
FT                   NLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQI
FT                   IEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPV
FT                   GGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKTSLKWETERARQVLVCDRWSWGL
FT                   ETDLLYSLLTLYQEAQHLSVTLRRQNFPKAGLFLDNAHLLLRDQWYPPTFLKT"
FT   gene            complement(17743367..17760150)
FT                   /gene="Ube2z"
FT                   /locus_tag="mCG_3794"
FT                   /note="gene_id=mCG3794.5"
FT   mRNA            complement(join(17743367..17745252,17746572..17746662,
FT                   17750662..17750774,17753140..17753251,17755761..17755948,
FT                   17757819..17757891,17759776..>17759813))
FT                   /gene="Ube2z"
FT                   /locus_tag="mCG_3794"
FT                   /product="ubiquitin-conjugating enzyme E2Z (putative),
FT                   transcript variant mCT191016"
FT                   /note="gene_id=mCG3794.5 transcript_id=mCT191016.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(17743401..17745252,17746572..17746662,
FT                   17750662..17750774,17753140..17753251,17755761..17755948,
FT                   17757819..17757891,17759530..17759598,17759776..17759893,
FT                   17760016..17760150))
FT                   /gene="Ube2z"
FT                   /locus_tag="mCG_3794"
FT                   /product="ubiquitin-conjugating enzyme E2Z (putative),
FT                   transcript variant mCT2636"
FT                   /note="gene_id=mCG3794.5 transcript_id=mCT2636.2 created on
FT                   19-JUN-2003"
FT   CDS             complement(join(17745082..17745252,17746572..17746662,
FT                   17750662..17750774,17753140..17753251,17755761..17755948,
FT                   17757819..17757891,17759530..17759598,17759776..17759893,
FT                   17760016..17760097))
FT                   /codon_start=1
FT                   /gene="Ube2z"
FT                   /locus_tag="mCG_3794"
FT                   /product="ubiquitin-conjugating enzyme E2Z (putative),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3794.5 transcript_id=mCT2636.2
FT                   protein_id=mCP23561.2 isoform=CRA_b"
FT                   /protein_id="EDL16010.1"
FT                   /translation="MAESPTEEAATATAGAGAAGPGSSGVAGLPPSAAAHGAALLSHWD
FT                   PTLSSDWDGERTAPQCLLRIKRARPYSPNRSAIALGPTPPLSDLRDIMSIYKEPPPGMF
FT                   VVPDTVDMTKIHALITGPFDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNP
FT                   NFYRNGKVCLSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSK
FT                   NYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTM
FT                   QDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV"
FT   CDS             complement(join(17745082..17745252,17746572..17746662,
FT                   17750662..17750774,17753140..17753251,17755761..17755948,
FT                   17757819..17757891,17759776..>17759813))
FT                   /codon_start=1
FT                   /gene="Ube2z"
FT                   /locus_tag="mCG_3794"
FT                   /product="ubiquitin-conjugating enzyme E2Z (putative),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3794.5 transcript_id=mCT191016.0
FT                   protein_id=mCP111986.0 isoform=CRA_a"
FT                   /protein_id="EDL16009.1"
FT                   /translation="ERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALITGP
FT                   FDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVCLSILGTWTG
FT                   PAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCDM
FT                   MEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQGQTMQDPFGEKRGHFDYQSLLM
FT                   RLGLIRQKVLERLHNENAEMDSDSSSSGTETDLHGSLRV"
FT   gene            complement(17767804..17770498)
FT                   /gene="Atp5g1"
FT                   /locus_tag="mCG_3782"
FT                   /note="gene_id=mCG3782.2"
FT   mRNA            complement(join(17767804..17768041,17768346..17768524,
FT                   17768785..17768862,17769810..17769856,17770250..17770404))
FT                   /gene="Atp5g1"
FT                   /locus_tag="mCG_3782"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit c (subunit 9), isoform 1, transcript
FT                   variant mCT180876"
FT                   /note="gene_id=mCG3782.2 transcript_id=mCT180876.0 created
FT                   on 04-MAR-2003"
FT   mRNA            complement(join(17767806..17768041,17768346..17768524,
FT                   17768785..17768862,17769810..17769856,17770380..17770435))
FT                   /gene="Atp5g1"
FT                   /locus_tag="mCG_3782"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit c (subunit 9), isoform 1, transcript
FT                   variant mCT2652"
FT                   /note="gene_id=mCG3782.2 transcript_id=mCT2652.2 created on
FT                   04-MAR-2003"
FT   mRNA            complement(join(17767840..17768041,17768346..17768524,
FT                   17768785..17768862,17769810..17769856,17770450..17770498))
FT                   /gene="Atp5g1"
FT                   /locus_tag="mCG_3782"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit c (subunit 9), isoform 1, transcript
FT                   variant mCT171901"
FT                   /note="gene_id=mCG3782.2 transcript_id=mCT171901.0 created
FT                   on 04-MAR-2003"
FT   CDS             complement(join(17767927..17768041,17768346..17768524,
FT                   17768785..17768862,17769810..17769848))
FT                   /codon_start=1
FT                   /gene="Atp5g1"
FT                   /locus_tag="mCG_3782"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit c (subunit 9), isoform 1, isoform CRA_a"
FT                   /note="gene_id=mCG3782.2 transcript_id=mCT180876.0
FT                   protein_id=mCP103798.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CR84"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="MGI:MGI:107653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CR84"
FT                   /protein_id="EDL16011.1"
FT                   /translation="MQTTKALLISPALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSS
FT                   PLQVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLK
FT                   QQLFSYAILGFALSEAMGLFCLMVAFLILFAM"
FT   CDS             complement(join(17767927..17768041,17768346..17768524,
FT                   17768785..17768862,17769810..17769848))
FT                   /codon_start=1
FT                   /gene="Atp5g1"
FT                   /locus_tag="mCG_3782"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit c (subunit 9), isoform 1, isoform CRA_a"
FT                   /note="gene_id=mCG3782.2 transcript_id=mCT171901.0
FT                   protein_id=mCP94820.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CR84"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="MGI:MGI:107653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CR84"
FT                   /protein_id="EDL16012.1"
FT                   /translation="MQTTKALLISPALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSS
FT                   PLQVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLK
FT                   QQLFSYAILGFALSEAMGLFCLMVAFLILFAM"
FT   CDS             complement(join(17767927..17768041,17768346..17768524,
FT                   17768785..17768862,17769810..17769848))
FT                   /codon_start=1
FT                   /gene="Atp5g1"
FT                   /locus_tag="mCG_3782"
FT                   /product="ATP synthase, H+ transporting, mitochondrial F0
FT                   complex, subunit c (subunit 9), isoform 1, isoform CRA_a"
FT                   /note="gene_id=mCG3782.2 transcript_id=mCT2652.2
FT                   protein_id=mCP23479.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CR84"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="MGI:MGI:107653"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CR84"
FT                   /protein_id="EDL16013.1"
FT                   /translation="MQTTKALLISPALIRSCTRGLIRPVSASLLSRPEAPSKQPSCSSS
FT                   PLQVARREFQTSVISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLK
FT                   QQLFSYAILGFALSEAMGLFCLMVAFLILFAM"
FT   gene            complement(17794457..17807391)
FT                   /locus_tag="mCG_3797"
FT                   /note="gene_id=mCG3797.1"
FT   mRNA            complement(join(17794457..17795838,17798080..17798184,
FT                   17798649..17798782,17798890..17798992,17802865..17803038,
FT                   17807368..17807391))
FT                   /locus_tag="mCG_3797"
FT                   /product="mCG3797"
FT                   /note="gene_id=mCG3797.1 transcript_id=mCT2639.1 created on
FT                   26-SEP-2002"
FT   CDS             complement(join(17795455..17795838,17798080..17798184,
FT                   17798649..17798782,17798890..17798992,17802865..17803029))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3797"
FT                   /product="mCG3797"
FT                   /note="gene_id=mCG3797.1 transcript_id=mCT2639.1
FT                   protein_id=mCP23577.2"
FT                   /protein_id="EDL16014.1"
FT                   /translation="MDQCPIPTLLEHGNFSQVLFNNVEKFYAPRGDIMCYYTLTEKFIP
FT                   RRKDWIGIFKVGWKTTQEYYTFMWAPLPKDQNKDSATQQEIQFKAYYLPKDVERYQFCY
FT                   VDEDGLVRGTSVPFQFCPDPDEDIMVVINKEKVEEMEQLSEELYQQNQELKDKYADLHE
FT                   QLQRKQVALEATQRVNKTLEHKVEEKASWEKEKASWEEEKASWEEEKASWEEEKASWEE
FT                   EKASWEEEKASWEEEKASWEEEKASWEEEKASWEKEKASWEEEKASWEKEKAPWEVEKA
FT                   PWKEVKAYWWNDLHR"
FT   gene            17830329..>17850256
FT                   /locus_tag="mCG_117877"
FT                   /note="gene_id=mCG117877.1"
FT   mRNA            join(17830329..17830921,17831043..17831173,
FT                   17834045..17834201,17834948..17835091,17835750..17835835,
FT                   17840721..17840946,17842725..17842900,17847115..17847303,
FT                   17848296..17848384,17849824..17850086,17850164..>17850256)
FT                   /locus_tag="mCG_117877"
FT                   /product="mCG117877"
FT                   /note="gene_id=mCG117877.1 transcript_id=mCT119029.1
FT                   created on 25-OCT-2002"
FT   CDS             join(17830901..17830921,17831043..17831173,
FT                   17834045..17834201,17834948..17835091,17835750..17835835,
FT                   17840721..17840946,17842725..17842900,17847115..17847303,
FT                   17848296..17848384,17849824..17850086,17850164..17850256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117877"
FT                   /product="mCG117877"
FT                   /note="gene_id=mCG117877.1 transcript_id=mCT119029.1
FT                   protein_id=mCP85346.1"
FT                   /protein_id="EDL16015.1"
FT                   /translation="MEMKSYQKINHFPGMSEICRKDLLARNMSRMLKLFPKDFHFFPRT
FT                   WCLPADWGDLQTYSRTRKNKTYICKPDSGCQGRGIFITRSVKEIKPGEDMICQLYISKP
FT                   FIIDGFKFDLRVYVLVTSCDPLRVFVYNEGLARFATTSYSHPNLDNLDEICMHLTNYSI
FT                   NKHSSNFVQDAFSGSKRKLSTFNSYMKTHGYDVEQIWRGIEDVIIKTLISAHPVIKHNY
FT                   HTCFPSHTLNSACFEILGFDILLDRKLKPWLLEVNHSPSFSTDSKLDKEVKDSLLYDAL
FT                   VLINLGNCDKKKVLEEERQRGRFLQQCPNREIRLEEVKGFQAMRLQKTEEYEKKNCGGF
FT                   RLIYPGLNLEKYDKFFQDNSSLFQNTVASRARELYARQLIQELRQKQEKKVFLKKARKE
FT                   ETQGESAVTLVSCTSGLLLNIRGLKKGEISESLEQKDTKEAMLIPCKPVSARNYSSVPD
FT                   LRSANPSCFEPEFHVPNAKVKEVKSAFMVNIESTAQLFKYPPKYPPLLFEPQFRYFEAQ
FT                   TVERHIC"
FT   gene            <17851773..17860676
FT                   /locus_tag="mCG_64686"
FT                   /note="gene_id=mCG64686.2"
FT   mRNA            join(<17851773..17852034,17853916..17854186,
FT                   17859973..17860375)
FT                   /locus_tag="mCG_64686"
FT                   /product="mCG64686, transcript variant mCT64869"
FT                   /note="gene_id=mCG64686.2 transcript_id=mCT64869.2 created
FT                   on 25-OCT-2002"
FT   CDS             join(17851773..17852034,17853916..17854154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64686"
FT                   /product="mCG64686, isoform CRA_b"
FT                   /note="gene_id=mCG64686.2 transcript_id=mCT64869.2
FT                   protein_id=mCP42951.1 isoform=CRA_b"
FT                   /protein_id="EDL16017.1"
FT                   /translation="MSLSTSPECSSPESVHMVSYNHKQQKASFHKPMQEKKSKPLMFSK
FT                   SRHLDLNCTSMKNDINRQYLMSEILQKVQMKKKRPLFPAPKSQYPTLSKERCPHSRSSS
FT                   RKKEMNSPSVFVLQASHSRAESLNDLLVVATQARLDPRPSRSHSGTTTRDSSTQDPKHT
FT                   ATA"
FT   mRNA            join(17851841..17852034,17853916..17854186,
FT                   17860169..17860676)
FT                   /locus_tag="mCG_64686"
FT                   /product="mCG64686, transcript variant mCT174827"
FT                   /note="gene_id=mCG64686.2 transcript_id=mCT174827.0 created
FT                   on 25-OCT-2002"
FT   CDS             join(17851869..17852034,17853916..17854154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_64686"
FT                   /product="mCG64686, isoform CRA_a"
FT                   /note="gene_id=mCG64686.2 transcript_id=mCT174827.0
FT                   protein_id=mCP97746.0 isoform=CRA_a"
FT                   /protein_id="EDL16016.1"
FT                   /translation="MQEKKSKPLMFSKSRHLDLNCTSMKNDINRQYLMSEILQKVQMKK
FT                   KRPLFPAPKSQYPTLSKERCPHSRSSSRKKEMNSPSVFVLQASHSRAESLNDLLVVATQ
FT                   ARLDPRPSRSHSGTTTRDSSTQDPKHTATA"
FT   gene            17889905..17892181
FT                   /gene="Hoxb13"
FT                   /locus_tag="mCG_3783"
FT                   /note="gene_id=mCG3783.2"
FT   mRNA            join(17889905..17890629,17891556..17892181)
FT                   /gene="Hoxb13"
FT                   /locus_tag="mCG_3783"
FT                   /product="homeobox B13"
FT                   /note="gene_id=mCG3783.2 transcript_id=mCT2646.2 created on
FT                   13-AUG-2002"
FT   CDS             join(17890026..17890629,17891556..17891812)
FT                   /codon_start=1
FT                   /gene="Hoxb13"
FT                   /locus_tag="mCG_3783"
FT                   /product="homeobox B13"
FT                   /note="gene_id=mCG3783.2 transcript_id=mCT2646.2
FT                   protein_id=mCP23486.1"
FT                   /protein_id="EDL16018.1"
FT                   /translation="MEPGNYATLDGAKDIEGLLGAGGGRNLVSHSSPLASHPAAPTLMP
FT                   TVNYAPLDLPGSAEPPKQCHPCPGVPQGASPAPVPYGYFGGGYYSCRVSRSSLKPCAQT
FT                   AALATYPSETPAPGEEYPSRPTEFAFYPGYPGPYQPMASYLDVSVVQTLGAPGEPRHDS
FT                   LLPVDSYQPWALAGGWNSQMCCQGEQNPPGPFWKAAFAEPSVQHPPPDGCAFRRGRKKR
FT                   IPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKKVLAKVK
FT                   TSTTP"
FT   gene            17899032..17900964
FT                   /locus_tag="mCG_147538"
FT                   /note="gene_id=mCG147538.0"
FT   mRNA            join(17899032..17899279,17899362..17900964)
FT                   /locus_tag="mCG_147538"
FT                   /product="mCG147538"
FT                   /note="gene_id=mCG147538.0 transcript_id=mCT187801.0
FT                   created on 13-JAN-2004"
FT   CDS             17899640..17899837
FT                   /codon_start=1
FT                   /locus_tag="mCG_147538"
FT                   /product="mCG147538"
FT                   /note="gene_id=mCG147538.0 transcript_id=mCT187801.0
FT                   protein_id=mCP109304.0"
FT                   /protein_id="EDL16019.1"
FT                   /translation="MAGENCQEADSQWQKGSGRVNYQDNVMDALSPSSYRRLFGIKNWV
FT                   FSSSALQAQERIQPFPLPLS"
FT   gene            17944184..17944811
FT                   /pseudo
FT                   /locus_tag="mCG_117882"
FT                   /note="gene_id=mCG117882.1"
FT   mRNA            17944184..17944811
FT                   /pseudo
FT                   /locus_tag="mCG_117882"
FT                   /note="gene_id=mCG117882.1 transcript_id=mCT119034.1
FT                   created on 29-OCT-2002"
FT   gene            17947276..17960069
FT                   /locus_tag="mCG_3804"
FT                   /note="gene_id=mCG3804.2"
FT   mRNA            join(17947276..17947400,17957199..17957350,
FT                   17959759..17960069)
FT                   /locus_tag="mCG_3804"
FT                   /product="mCG3804, transcript variant mCT2624"
FT                   /note="gene_id=mCG3804.2 transcript_id=mCT2624.2 created on
FT                   05-MAR-2003"
FT   mRNA            join(17947358..17947400,17957199..17957823)
FT                   /locus_tag="mCG_3804"
FT                   /product="mCG3804, transcript variant mCT180884"
FT                   /note="gene_id=mCG3804.2 transcript_id=mCT180884.0 created
FT                   on 05-MAR-2003"
FT   CDS             join(17947376..17947400,17957199..17957350,
FT                   17959759..17959974)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3804"
FT                   /product="mCG3804, isoform CRA_b"
FT                   /note="gene_id=mCG3804.2 transcript_id=mCT2624.2
FT                   protein_id=mCP23576.2 isoform=CRA_b"
FT                   /protein_id="EDL16021.1"
FT                   /translation="MEDSAVPREGAKGDALAASSKPTRPIASVCRNLSLHPALDTELRR
FT                   IWLRADSTPGRRLEDKRGYKLFEVHQHGEVLLYFRSLKEKPAARQTPSLSPSFHARDTH
FT                   VAKRTLAFGSREGESPLRSTLPHRLR"
FT   CDS             join(17947376..17947400,17957199..17957419)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3804"
FT                   /product="mCG3804, isoform CRA_a"
FT                   /note="gene_id=mCG3804.2 transcript_id=mCT180884.0
FT                   protein_id=mCP103806.0 isoform=CRA_a"
FT                   /protein_id="EDL16020.1"
FT                   /translation="MEDSAVPREGAKGDALAASSKPTRPIASVCRNLSLHPALDTELRR
FT                   IWLRADSTPGRRLEVGRVLGLAHRPQSCLSKPQCQT"
FT   gene            <17967128..17972179
FT                   /gene="Hoxb9"
FT                   /locus_tag="mCG_3785"
FT                   /note="gene_id=mCG3785.2"
FT   mRNA            join(<17967128..17967644,17970210..17972179)
FT                   /gene="Hoxb9"
FT                   /locus_tag="mCG_3785"
FT                   /product="homeobox B9"
FT                   /note="gene_id=mCG3785.2 transcript_id=mCT2641.2 created on
FT                   29-OCT-2002"
FT   CDS             join(17967128..17967644,17970210..17970445)
FT                   /codon_start=1
FT                   /gene="Hoxb9"
FT                   /locus_tag="mCG_3785"
FT                   /product="homeobox B9"
FT                   /note="gene_id=mCG3785.2 transcript_id=mCT2641.2
FT                   protein_id=mCP23614.2"
FT                   /db_xref="GOA:P20615"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR006711"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017112"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96190"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20615"
FT                   /protein_id="EDL16022.1"
FT                   /translation="MSISGTLSSYYVDSIISHESEDAPPAKFPSGQYANPRQPGHAEHL
FT                   DFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYLQPQGAPAAESRYLRTWLEPAPR
FT                   AEAAPGQGQAAVKAEPLLGAPGELLKQGTPEYSLETSAGREAVLSNQRAGYGDNKICEG
FT                   SEDKERPDQTNPSANWLHARSSRKKRCPYTKYQTLELEKEFLFNMYLTRDRRHEVARLL
FT                   NLSERQVKIWFQNRRMKMKKMNKEQGKE"
FT   gene            17977490..17980910
FT                   /gene="Hoxb8"
FT                   /locus_tag="mCG_3803"
FT                   /note="gene_id=mCG3803.4"
FT   mRNA            join(17977490..17978971,17979748..17980910)
FT                   /gene="Hoxb8"
FT                   /locus_tag="mCG_3803"
FT                   /product="homeobox B8"
FT                   /note="gene_id=mCG3803.4 transcript_id=mCT2623.4 created on
FT                   11-FEB-2004"
FT   CDS             join(17978548..17978971,17979748..17980055)
FT                   /codon_start=1
FT                   /gene="Hoxb8"
FT                   /locus_tag="mCG_3803"
FT                   /product="homeobox B8"
FT                   /note="gene_id=mCG3803.4 transcript_id=mCT2623.4
FT                   protein_id=mCP23559.4"
FT                   /db_xref="GOA:A2A9Z8"
FT                   /db_xref="InterPro:IPR000047"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR001827"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="InterPro:IPR020479"
FT                   /db_xref="MGI:MGI:96189"
FT                   /db_xref="UniProtKB/TrEMBL:A2A9Z8"
FT                   /protein_id="EDL16023.1"
FT                   /translation="MSSYFVNSLFSKYKTGESLRPNYYDCGFAQDLGGRPTVVYGPSSG
FT                   GSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFYGYDPLQRQSLFGAQDPDL
FT                   VQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQAAAGRRRGRQTYSRYQTLELEK
FT                   EFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSKCEQEELEK
FT                   EKLERAPETAEQGDAQKGDKK"
FT   gene            17980148..17985724
FT                   /gene="Hoxb7"
FT                   /locus_tag="mCG_142743"
FT                   /note="gene_id=mCG142743.0"
FT   mRNA            join(17980148..17982712,17984773..17985724)
FT                   /gene="Hoxb7"
FT                   /locus_tag="mCG_142743"
FT                   /product="homeobox B7"
FT                   /note="gene_id=mCG142743.0 transcript_id=mCT182030.0
FT                   created on 15-APR-2003"
FT   CDS             join(17982313..17982712,17984773..17985026)
FT                   /codon_start=1
FT                   /gene="Hoxb7"
FT                   /locus_tag="mCG_142743"
FT                   /product="homeobox B7"
FT                   /note="gene_id=mCG142743.0 transcript_id=mCT182030.0
FT                   protein_id=mCP104952.0"
FT                   /protein_id="EDL16024.1"
FT                   /translation="MSSLYYANALFSKYPAASSVFAPGAFPEQTSCAFASNPQRPGYGA
FT                   GPGAPFSASVQGLYSGGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDP
FT                   AKAAGAKEQRDSDLAAESNFRIYPWMRSSGPDRKRGRQTYTRYQTLELEKEFHYNRYLT
FT                   RRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTSGPGTTGQDKAEAEEEEEE"
FT   gene            complement(17986439..18002325)
FT                   /locus_tag="mCG_3788"
FT                   /note="gene_id=mCG3788.2"
FT   mRNA            complement(join(17986439..17986659,17988775..17988954,
FT                   18002151..18002325))
FT                   /locus_tag="mCG_3788"
FT                   /product="mCG3788"
FT                   /note="gene_id=mCG3788.2 transcript_id=mCT2644.2 created on
FT                   26-SEP-2002"
FT   CDS             complement(join(17986557..17986659,17988775..17988866))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3788"
FT                   /product="mCG3788"
FT                   /note="gene_id=mCG3788.2 transcript_id=mCT2644.2
FT                   protein_id=mCP23578.2"
FT                   /protein_id="EDL16025.1"
FT                   /translation="MQPGNRHYPHWARETARGQSERPGKGRDGGRRFQVGRTQEQAERP
FT                   RGSPGGRCYQAHCGRTPAR"
FT   gene            17994485..17996983
FT                   /gene="Hoxb6"
FT                   /locus_tag="mCG_117884"
FT                   /note="gene_id=mCG117884.0"
FT   mRNA            join(17994485..17995005,17996083..17996983)
FT                   /gene="Hoxb6"
FT                   /locus_tag="mCG_117884"
FT                   /product="homeobox B6"
FT                   /note="gene_id=mCG117884.0 transcript_id=mCT119035.0
FT                   created on 26-SEP-2002"
FT   CDS             join(17994591..17995005,17996083..17996342)
FT                   /codon_start=1
FT                   /gene="Hoxb6"
FT                   /locus_tag="mCG_117884"
FT                   /product="homeobox B6"
FT                   /note="gene_id=mCG117884.0 transcript_id=mCT119035.0
FT                   protein_id=mCP85086.1"
FT                   /protein_id="EDL16026.1"
FT                   /translation="MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGP
FT                   GPGQDKGFAASSYYPPAGGGYGRAAPCDYGPAPAFYREKDAACALSGADEPPPFHPEPR
FT                   KSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGRQTYTRYQTLELEK
FT                   EFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKLLSASQLSAEEEEEKP
FT                   AE"
FT   gene            17998926..18001534
FT                   /gene="Hoxb5"
FT                   /locus_tag="mCG_3784"
FT                   /note="gene_id=mCG3784.2"
FT   mRNA            join(17998926..17999589,18000304..18001534)
FT                   /gene="Hoxb5"
FT                   /locus_tag="mCG_3784"
FT                   /product="homeobox B5"
FT                   /note="gene_id=mCG3784.2 transcript_id=mCT2640.2 created on
FT                   13-AUG-2002"
FT   CDS             join(17999028..17999589,18000304..18000551)
FT                   /codon_start=1
FT                   /gene="Hoxb5"
FT                   /locus_tag="mCG_3784"
FT                   /product="homeobox B5"
FT                   /note="gene_id=mCG3784.2 transcript_id=mCT2640.2
FT                   protein_id=mCP23503.2"
FT                   /protein_id="EDL16027.1"
FT                   /translation="MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSY
FT                   GYNYNGMDLSVNRSSASSSHFGAVGESSRAFPASAQEPRFRQATSSCSLSSPESLPCTN
FT                   GDSHGAKPSASSPSDQATPASSSANFTEIDEASASSEPEEAASQLSSPSLARAQPEPMA
FT                   TSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRR
FT                   RRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLKSMSLATAGSAFQP"
FT   gene            18014097..18017031
FT                   /gene="Hoxb4"
FT                   /locus_tag="mCG_3795"
FT                   /note="gene_id=mCG3795.1"
FT   mRNA            join(18014097..18014624,18015431..18017031)
FT                   /gene="Hoxb4"
FT                   /locus_tag="mCG_3795"
FT                   /product="homeobox B4"
FT                   /note="gene_id=mCG3795.1 transcript_id=mCT2638.1 created on
FT                   29-OCT-2002"
FT   CDS             join(18014171..18014624,18015431..18015729)
FT                   /codon_start=1
FT                   /gene="Hoxb4"
FT                   /locus_tag="mCG_3795"
FT                   /product="homeobox B4"
FT                   /note="gene_id=mCG3795.1 transcript_id=mCT2638.1
FT                   protein_id=mCP23407.2"
FT                   /protein_id="EDL16028.1"
FT                   /translation="MAMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRE
FT                   SGFQPEAAFGRRAPCTVQRYAACRDPGPPPPPPPPPPPPPPGLSPRAPVQPTAGALLPE
FT                   PGQRSEAVSSSPPPPPCAQNPLHPSPSHSACKEPVVYPWMRKVHVSTVNPNYAGGEPKR
FT                   SRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKDHKL
FT                   PNTKIRSGGTAGAAGGPPGRPNGGPPAL"
FT   gene            complement(<18038467..18048815)
FT                   /locus_tag="mCG_119996"
FT                   /note="gene_id=mCG119996.1"
FT   mRNA            complement(join(<18038467..18038627,18042229..18042287,
FT                   18043691..18043790,18048675..18048815))
FT                   /locus_tag="mCG_119996"
FT                   /product="mCG119996, transcript variant mCT121175"
FT                   /note="gene_id=mCG119996.1 transcript_id=mCT121175.1
FT                   created on 29-OCT-2002"
FT   CDS             complement(join(<18038467..18038627,18042229..18042235))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119996"
FT                   /product="mCG119996, isoform CRA_a"
FT                   /note="gene_id=mCG119996.1 transcript_id=mCT121175.1
FT                   protein_id=mCP85416.1 isoform=CRA_a"
FT                   /protein_id="EDL16029.1"
FT                   /translation="MQGKKKKEKEKLCICWNLFSTEMGEIIQDEKDSQNNLNTILLWIQ
FT                   RGGCLLRFPTA"
FT   gene            18039170..18041909
FT                   /gene="Hoxb3"
FT                   /locus_tag="mCG_3790"
FT                   /note="gene_id=mCG3790.2"
FT   mRNA            join(18039170..18040098,18040948..18041909)
FT                   /gene="Hoxb3"
FT                   /locus_tag="mCG_3790"
FT                   /product="homeobox B3"
FT                   /note="gene_id=mCG3790.2 transcript_id=mCT2637.2 created on
FT                   13-AUG-2002"
FT   CDS             join(18039651..18040098,18040948..18041801)
FT                   /codon_start=1
FT                   /gene="Hoxb3"
FT                   /locus_tag="mCG_3790"
FT                   /product="homeobox B3"
FT                   /note="gene_id=mCG3790.2 transcript_id=mCT2637.2
FT                   protein_id=mCP23392.2"
FT                   /protein_id="EDL16031.1"
FT                   /translation="MQKATYYDNTAAALFGGYSSYPGSNGFGYDGPPQPPFQAATHLEG
FT                   DYQRSACSLQSLGNAAPHAKSKELNGSCMRPGLAPEPLPAPPGSPPPSAAPTSTTSNSN
FT                   NGGGPSKSGPPKCGAGSNSTLTKQIFPWMKESRQTSKLKNSSPGTAEGCGGGGGGGGGG
FT                   GGGGGGSSGGGGGGGGGGDKSPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRV
FT                   EMANLLNLSERQIKIWFQNRRMKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNA
FT                   LHSMTPSYDSPSPPAFGKGHQNAYALPSNYQPPLKGCGAPQKYPPTPASEYEPHVLQAN
FT                   GGAYGTPTMQGSPVYVGGGGYADPLPPPAGPSLYGLNHLSHHPSGNLDYNGAAPMGPNQ
FT                   HHGPCDPHPTYTDLSSHHAPPQGRIQEAPKLTHL"
FT   mRNA            complement(join(<18041456..18041814,18042229..18042287,
FT                   18043691..18043790,18045411..18045454))
FT                   /locus_tag="mCG_119996"
FT                   /product="mCG119996, transcript variant mCT175073"
FT                   /note="gene_id=mCG119996.1 transcript_id=mCT175073.0
FT                   created on 29-OCT-2002"
FT   CDS             complement(<18041456..18041702)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119996"
FT                   /product="mCG119996, isoform CRA_b"
FT                   /note="gene_id=mCG119996.1 transcript_id=mCT175073.0
FT                   protein_id=mCP97992.0 isoform=CRA_b"
FT                   /protein_id="EDL16030.1"
FT                   /translation="MMLVGAHRGRPVVVQVPRGVVGKVIEAVEGGAGRGRQRIRVATPA
FT                   HIHRTALHGGRPVGAPVSLEDVGLILRRRGRGVLLWG"
FT   gene            18048203..18049414
FT                   /gene="Hoxb2"
FT                   /locus_tag="mCG_140864"
FT                   /note="gene_id=mCG140864.2"
FT   mRNA            18048203..18049414
FT                   /gene="Hoxb2"
FT                   /locus_tag="mCG_140864"
FT                   /product="homeobox B2"
FT                   /note="gene_id=mCG140864.2 transcript_id=mCT171902.1
FT                   created on 11-FEB-2004"
FT   CDS             18048546..18049031
FT                   /codon_start=1
FT                   /gene="Hoxb2"
FT                   /locus_tag="mCG_140864"
FT                   /product="homeobox B2"
FT                   /note="gene_id=mCG140864.2 transcript_id=mCT171902.1
FT                   protein_id=mCP94822.1"
FT                   /protein_id="EDL16032.1"
FT                   /translation="MKHKRQTQHREPPEGEPGGPSAQDDAGEPAEEPTVSPGDVATHRL
FT                   REACFHPAEAAQGPRGAPPSALPATTLESVGASSPGCTMLRAGGRQSEPLPEDACPERQ
FT                   DSPFLPDLNFFAADSCLQMSGGLSPSLQGSLDSPVPFSEEELDFFTSTLCAIDLQFP"
FT   gene            18061118..18063042
FT                   /gene="Hoxb1"
FT                   /locus_tag="mCG_3786"
FT                   /note="gene_id=mCG3786.2"
FT   mRNA            join(18061118..18061757,18062177..18063042)
FT                   /gene="Hoxb1"
FT                   /locus_tag="mCG_3786"
FT                   /product="homeobox B1"
FT                   /note="gene_id=mCG3786.2 transcript_id=mCT2642.2 created on
FT                   28-SEP-2004"
FT   CDS             join(18061193..18061757,18062177..18062505)
FT                   /codon_start=1
FT                   /gene="Hoxb1"
FT                   /locus_tag="mCG_3786"
FT                   /product="homeobox B1"
FT                   /note="gene_id=mCG3786.2 transcript_id=mCT2642.2
FT                   protein_id=mCP23504.2"
FT                   /protein_id="EDL16033.1"
FT                   /translation="MDYNRMSSFLEYPLCNRGPSAYSAPTSFPPCSAPAVDSYAGESRY
FT                   GGGLPSSALQQNSGYPVQQPPSSLGVSFPSPAPSGYAPAACNPSYGPSQYYSVGQSEGD
FT                   GSYFHPSSYGAQLGGLPDSYGAGGVGSGPYPPPQPPYGTEQTATFASAYDLLSEDKESP
FT                   CSSEPSTLTPRTFDWMKVKRNPPKTAKVSELGLGAPGGLRTNFTTRQLTELEKEFHFNK
FT                   YLSRARRVEIAATLELNETQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKEAAGDASD
FT                   QSACTSPEASPSSITS"
FT   gene            18087333..18087954
FT                   /locus_tag="mCG_3798"
FT                   /note="gene_id=mCG3798.2"
FT   mRNA            18087333..18087954
FT                   /locus_tag="mCG_3798"
FT                   /product="mCG3798"
FT                   /note="gene_id=mCG3798.2 transcript_id=mCT2628.2 created on
FT                   11-NOV-2002"
FT   CDS             18087367..18087921
FT                   /codon_start=1
FT                   /locus_tag="mCG_3798"
FT                   /product="mCG3798"
FT                   /note="gene_id=mCG3798.2 transcript_id=mCT2628.2
FT                   protein_id=mCP23535.1"
FT                   /protein_id="EDL16034.1"
FT                   /translation="MVRYSLDPENPTKSCKSRGSNLPVHFKNTRKTAQAIKGMHIRKAT
FT                   KYLKDVTLKKQCVPFRRYNGGVSRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESNAEL
FT                   KGLHVDSLVIEHIQVNKAPKMRRRTYRAHGWINPYMSSPCHSEMILTEKEQIVPKPEEE
FT                   IAQKKKISQKKLKKQKLMAGE"
FT   gene            18159087..18398731
FT                   /locus_tag="mCG_119977"
FT                   /note="gene_id=mCG119977.1"
FT   mRNA            join(18159087..18159205,18184328..18184433,
FT                   18218131..18218156,18233433..18233534,18273233..18273560)
FT                   /locus_tag="mCG_119977"
FT                   /product="mCG119977, transcript variant mCT121173"
FT                   /note="gene_id=mCG119977.1 transcript_id=mCT121173.0
FT                   created on 29-OCT-2002"
FT   mRNA            join(18159087..18159205,18184328..18184433,
FT                   18187297..18188138)
FT                   /locus_tag="mCG_119977"
FT                   /product="mCG119977, transcript variant mCT121182"
FT                   /note="gene_id=mCG119977.1 transcript_id=mCT121182.0
FT                   created on 29-OCT-2002"
FT   CDS             join(18159160..18159205,18184328..18184433,
FT                   18218131..18218156,18233433..18233534,18273233..18273450)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119977"
FT                   /product="mCG119977, isoform CRA_a"
FT                   /note="gene_id=mCG119977.1 transcript_id=mCT121173.0
FT                   protein_id=mCP85403.1 isoform=CRA_a"
FT                   /protein_id="EDL16035.1"
FT                   /translation="MQAVALPEEICWLLEDTEDFLAEGLQNENLSPGAQDQRAHILRGF
FT                   QQIKSRYCWDFQLQGGDLGQDGSDDNLSGTHGPPLTSEASFWSDYQDEERSQTPSFGFL
FT                   TARRHLENAPLPVFMKSMNALLVEQLCLKVLTNKGGLSSSRYSTAHLALMCQELLQVIY
FT                   VY"
FT   mRNA            join(18184318..18184433,18218131..18218156,
FT                   18233433..18233534,18392739..18392816,18394193..18394276,
FT                   18398696..18398731)
FT                   /locus_tag="mCG_119977"
FT                   /product="mCG119977, transcript variant mCT175071"
FT                   /note="gene_id=mCG119977.1 transcript_id=mCT175071.0
FT                   created on 29-OCT-2002"
FT   mRNA            join(18184318..18184433,18218131..18218156,
FT                   18233433..18233534,18369603..18369834)
FT                   /locus_tag="mCG_119977"
FT                   /product="mCG119977, transcript variant mCT175072"
FT                   /note="gene_id=mCG119977.1 transcript_id=mCT175072.0
FT                   created on 29-OCT-2002"
FT   CDS             join(18184361..18184433,18218131..18218156,
FT                   18233433..18233471)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119977"
FT                   /product="mCG119977, isoform CRA_c"
FT                   /note="gene_id=mCG119977.1 transcript_id=mCT175071.0
FT                   protein_id=mCP97990.0 isoform=CRA_c"
FT                   /protein_id="EDL16037.1"
FT                   /translation="MRTSALGHRIREPTFFGVSSKSNPGTVGIFSSKEVTLARTALMTI
FT                   "
FT   CDS             join(18184361..18184433,18218131..18218156,
FT                   18233433..18233471)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119977"
FT                   /product="mCG119977, isoform CRA_c"
FT                   /note="gene_id=mCG119977.1 transcript_id=mCT175072.0
FT                   protein_id=mCP97991.0 isoform=CRA_c"
FT                   /protein_id="EDL16038.1"
FT                   /translation="MRTSALGHRIREPTFFGVSSKSNPGTVGIFSSKEVTLARTALMTI
FT                   "
FT   CDS             18187618..18187956
FT                   /codon_start=1
FT                   /locus_tag="mCG_119977"
FT                   /product="mCG119977, isoform CRA_b"
FT                   /note="gene_id=mCG119977.1 transcript_id=mCT121182.0
FT                   protein_id=mCP85172.1 isoform=CRA_b"
FT                   /protein_id="EDL16036.1"
FT                   /translation="MFRNLMTYLRIWRNSGGISSVFDPAETICQQSYTESEGRDKKQKI
FT                   FIIGIEINPLLMAPFWGSSLTRSLLEVKARANGHKHGVLFPSVKLNNTKGVPTGDKQIY
FT                   KMLKWKKQ"
FT   gene            18412808..18450358
FT                   /locus_tag="mCG_147553"
FT                   /note="gene_id=mCG147553.0"
FT   mRNA            join(18412808..18413268,18420910..18421010,
FT                   18445316..18445424,18450038..18450358)
FT                   /locus_tag="mCG_147553"
FT                   /product="mCG147553"
FT                   /note="gene_id=mCG147553.0 transcript_id=mCT187816.0
FT                   created on 13-JAN-2004"
FT   gene            complement(18437268..18438653)
FT                   /locus_tag="mCG_147550"
FT                   /note="gene_id=mCG147550.0"
FT   mRNA            complement(join(18437268..18437872,18438248..18438653))
FT                   /locus_tag="mCG_147550"
FT                   /product="mCG147550"
FT                   /note="gene_id=mCG147550.0 transcript_id=mCT187813.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(18438320..18438568)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147550"
FT                   /product="mCG147550"
FT                   /note="gene_id=mCG147550.0 transcript_id=mCT187813.0
FT                   protein_id=mCP109316.0"
FT                   /protein_id="EDL16040.1"
FT                   /translation="MEWAQHSGETRNELRAALCPSKQKSRQKSEEESRVSETICVMLWK
FT                   PGSLIKAPTGPGIRLSFPDFIPWLDTEERAAGLRFKA"
FT   CDS             18450154..18450309
FT                   /codon_start=1
FT                   /locus_tag="mCG_147553"
FT                   /product="mCG147553"
FT                   /note="gene_id=mCG147553.0 transcript_id=mCT187816.0
FT                   protein_id=mCP109319.0"
FT                   /protein_id="EDL16039.1"
FT                   /translation="MSRKKTVHQTCFSSSQLLASCPLCVPTSISLSYKPATKKTATKEI
FT                   MGGRGY"
FT   gene            18458204..18459685
FT                   /locus_tag="mCG_120000"
FT                   /note="gene_id=mCG120000.1"
FT   mRNA            join(18458204..18458319,18458998..18459685)
FT                   /locus_tag="mCG_120000"
FT                   /product="mCG120000"
FT                   /note="gene_id=mCG120000.1 transcript_id=mCT121179.1
FT                   created on 29-OCT-2002"
FT   gene            complement(18458968..18468947)
FT                   /gene="Snx11"
FT                   /locus_tag="mCG_13233"
FT                   /note="gene_id=mCG13233.3"
FT   mRNA            complement(join(18458968..18460735,18462052..18462264,
FT                   18462442..18462537,18464195..18464295,18464549..18464635,
FT                   18465852..18465906,18468379..18468472,18468866..18468947))
FT                   /gene="Snx11"
FT                   /locus_tag="mCG_13233"
FT                   /product="sorting nexin 11, transcript variant mCT12738"
FT                   /note="gene_id=mCG13233.3 transcript_id=mCT12738.3 created
FT                   on 16-JUN-2003"
FT   mRNA            complement(join(18458968..18460735,18462052..18462264,
FT                   18462442..18462537,18464195..18464295,18464549..18464635,
FT                   18465852..18465906,18466785..18466844,18468379..18468472,
FT                   18468866..18468947))
FT                   /gene="Snx11"
FT                   /locus_tag="mCG_13233"
FT                   /product="sorting nexin 11, transcript variant mCT173978"
FT                   /note="gene_id=mCG13233.3 transcript_id=mCT173978.1 created
FT                   on 16-JUN-2003"
FT   CDS             18459358..18459606
FT                   /codon_start=1
FT                   /locus_tag="mCG_120000"
FT                   /product="mCG120000"
FT                   /note="gene_id=mCG120000.1 transcript_id=mCT121179.1
FT                   protein_id=mCP85128.1"
FT                   /protein_id="EDL16041.1"
FT                   /translation="MQARSPSAGVDPQPGWMARRETHTNLRAARQHQGGPGTQPAQPPR
FT                   QPPLLSADFSSRRQEPPHRLKESLWLLSPSPEPSLPG"
FT   CDS             complement(join(18460459..18460735,18462052..18462264,
FT                   18462442..18462537,18464195..18464295,18464549..18464635,
FT                   18465852..18465893))
FT                   /codon_start=1
FT                   /gene="Snx11"
FT                   /locus_tag="mCG_13233"
FT                   /product="sorting nexin 11, isoform CRA_a"
FT                   /note="gene_id=mCG13233.3 transcript_id=mCT12738.3
FT                   protein_id=mCP23421.2 isoform=CRA_a"
FT                   /protein_id="EDL16042.1"
FT                   /translation="MGLWYRMLENQDLEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTN
FT                   SKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGGSDEFIEKRRQGLQ
FT                   HFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRGAMTVSDAILSYAMSNCGWAQ
FT                   EERQSTSHLAKGDQLNSCCFLPRSGRRSSPSPPLSEEKEQLETWAPVMDSEGPSSESPT
FT                   LLPSSSLPACWDPARPEEGLSVSQPARRAVAADQAGPMEPTQLDTAWDK"
FT   CDS             complement(join(18460459..18460735,18462052..18462264,
FT                   18462442..18462537,18464195..18464295,18464549..18464635,
FT                   18465852..18465893))
FT                   /codon_start=1
FT                   /gene="Snx11"
FT                   /locus_tag="mCG_13233"
FT                   /product="sorting nexin 11, isoform CRA_a"
FT                   /note="gene_id=mCG13233.3 transcript_id=mCT173978.1
FT                   protein_id=mCP96897.0 isoform=CRA_a"
FT                   /protein_id="EDL16043.1"
FT                   /translation="MGLWYRMLENQDLEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTN
FT                   SKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGGSDEFIEKRRQGLQ
FT                   HFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRGAMTVSDAILSYAMSNCGWAQ
FT                   EERQSTSHLAKGDQLNSCCFLPRSGRRSSPSPPLSEEKEQLETWAPVMDSEGPSSESPT
FT                   LLPSSSLPACWDPARPEEGLSVSQPARRAVAADQAGPMEPTQLDTAWDK"
FT   gene            complement(18487008..18489736)
FT                   /locus_tag="mCG_13235"
FT                   /note="gene_id=mCG13235.2"
FT   mRNA            complement(join(18487008..18487541,18489686..18489736))
FT                   /locus_tag="mCG_13235"
FT                   /product="mCG13235"
FT                   /note="gene_id=mCG13235.2 transcript_id=mCT11077.2 created
FT                   on 11-NOV-2002"
FT   CDS             complement(18487114..18487518)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13235"
FT                   /product="mCG13235"
FT                   /note="gene_id=mCG13235.2 transcript_id=mCT11077.2
FT                   protein_id=mCP23549.1"
FT                   /protein_id="EDL16044.1"
FT                   /translation="MQIFANMQIFVKTLMGKTITLEVEPSDTIENVKAKIQDKEGLPPD
FT                   QQRLIFAGKQLEDGHTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRK
FT                   CYARLHPRAVNCRKRKCGHSNNLRPKKKGK"
FT   gene            18492448..18500330
FT                   /gene="Cbx1"
FT                   /locus_tag="mCG_13242"
FT                   /note="gene_id=mCG13242.2"
FT   mRNA            join(18492448..18492631,18493113..18493290,
FT                   18494411..18494505,18499871..18500330)
FT                   /gene="Cbx1"
FT                   /locus_tag="mCG_13242"
FT                   /product="chromobox homolog 1 (Drosophila HP1 beta),
FT                   transcript variant mCT172281"
FT                   /note="gene_id=mCG13242.2 transcript_id=mCT172281.0 created
FT                   on 19-AUG-2002"
FT   mRNA            join(18492448..18492631,18493113..18493290,
FT                   18494411..18494505,18498302..18498450,18499490..18499834)
FT                   /gene="Cbx1"
FT                   /locus_tag="mCG_13242"
FT                   /product="chromobox homolog 1 (Drosophila HP1 beta),
FT                   transcript variant mCT11081"
FT                   /note="gene_id=mCG13242.2 transcript_id=mCT11081.2 created
FT                   on 19-AUG-2002"
FT   mRNA            join(18492448..18492631,18493113..18493290,
FT                   18494411..18494505,18498302..18499039)
FT                   /gene="Cbx1"
FT                   /locus_tag="mCG_13242"
FT                   /product="chromobox homolog 1 (Drosophila HP1 beta),
FT                   transcript variant mCT172282"
FT                   /note="gene_id=mCG13242.2 transcript_id=mCT172282.0 created
FT                   on 19-AUG-2002"
FT   CDS             join(18492492..18492631,18493113..18493290,
FT                   18494411..18494505,18499871..18499910)
FT                   /codon_start=1
FT                   /gene="Cbx1"
FT                   /locus_tag="mCG_13242"
FT                   /product="chromobox homolog 1 (Drosophila HP1 beta),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13242.2 transcript_id=mCT172281.0
FT                   protein_id=mCP95201.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CYJ8"
FT                   /db_xref="InterPro:IPR000953"
FT                   /db_xref="InterPro:IPR008251"
FT                   /db_xref="InterPro:IPR016197"
FT                   /db_xref="InterPro:IPR017984"
FT                   /db_xref="InterPro:IPR023779"
FT                   /db_xref="InterPro:IPR023780"
FT                   /db_xref="MGI:MGI:105369"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CYJ8"
FT                   /protein_id="EDL16045.1"
FT                   /translation="MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGF
FT                   SDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKK
FT                   EESEKPRGFARGLEPERIIGATDSSGELMFLMKWSSSRVAQSGLEL"
FT   CDS             join(18492492..18492631,18493113..18493290,
FT                   18494411..18494505,18498302..18498446)
FT                   /codon_start=1
FT                   /gene="Cbx1"
FT                   /locus_tag="mCG_13242"
FT                   /product="chromobox homolog 1 (Drosophila HP1 beta),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13242.2 transcript_id=mCT172282.0
FT                   protein_id=mCP95200.0 isoform=CRA_b"
FT                   /protein_id="EDL16046.1"
FT                   /translation="MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGF
FT                   SDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKK
FT                   EESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISF
FT                   YEERLTWHSYPSEDDDKKDDKN"
FT   CDS             join(18492492..18492631,18493113..18493290,
FT                   18494411..18494505,18498302..18498446)
FT                   /codon_start=1
FT                   /gene="Cbx1"
FT                   /locus_tag="mCG_13242"
FT                   /product="chromobox homolog 1 (Drosophila HP1 beta),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13242.2 transcript_id=mCT11081.2
FT                   protein_id=mCP23567.1 isoform=CRA_b"
FT                   /protein_id="EDL16047.1"
FT                   /translation="MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGF
FT                   SDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKK
FT                   EESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISF
FT                   YEERLTWHSYPSEDDDKKDDKN"
FT   gene            complement(18511311..18521620)
FT                   /gene="Nfe2l1"
FT                   /locus_tag="mCG_13245"
FT                   /note="gene_id=mCG13245.1"
FT   mRNA            complement(join(18511311..18514407,18515142..18515300,
FT                   18515995..18516210,18521068..18521620))
FT                   /gene="Nfe2l1"
FT                   /locus_tag="mCG_13245"
FT                   /product="nuclear factor, erythroid derived 2,-like 1"
FT                   /note="gene_id=mCG13245.1 transcript_id=mCT13005.1 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(18513067..18514407,18515142..18515300,
FT                   18515995..18516210,18521068..18521577))
FT                   /codon_start=1
FT                   /gene="Nfe2l1"
FT                   /locus_tag="mCG_13245"
FT                   /product="nuclear factor, erythroid derived 2,-like 1"
FT                   /note="gene_id=mCG13245.1 transcript_id=mCT13005.1
FT                   protein_id=mCP23569.1"
FT                   /db_xref="GOA:Q6GTN8"
FT                   /db_xref="InterPro:IPR004826"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="MGI:MGI:99421"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GTN8"
FT                   /protein_id="EDL16048.1"
FT                   /translation="MLSLKKYLTEGLLQFTILLSLIGVRVDVDTYLTSQLPPLREIILG
FT                   PSSAYTQTQFHNLRNTLDGYGIHPKSIDLDNYFTARRLLSQVRALDRFQVPTTEVNAWL
FT                   VHRDPEGSVSGSQPNSGLALESSSGLQDVTGPDNGVRESETEQGFGEDLEDLGAVAPPV
FT                   SGDLTKEDIDLIDILWRQDIDLGAGREVFDYSHRQKEQDVDKELQDGREREDTWSGEGA
FT                   EALARDLLVDGETGESFPAQFPADVSSIPEAVPSESESPALQNSLLSPLLTGTESPFDL
FT                   EQQWQDLMSIMEMQAMEVNTSASEILYNAPPGDPLSTNYSLAPNTPINQNVSLHQASLG
FT                   GCSQDFSLFSPEVESLPVASSSTLLPLVPSNSTSLNSTFGSTNLAGLFFPSQLNGTAND
FT                   TSGPELPDPLGGLLDEAMLDEISLMDLAIEEGFNPVQASQLEEEFDSDSGLSLDSSHSP
FT                   SSLSSSEGSSSSSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEY
FT                   SKFCRMSYQDPSQLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSTLKKGSKEKQADFL
FT                   DKQMSRDEHRARAMKIPFTNDKIINLPVEEFNELLSKYQLSEAQLSLIRDIRRRGKNKM
FT                   AAQNCRKRKLDTILNLERDVEDLQRDKARLLREKVEFLRSLRQMKQKVQSLYQEVFGRL
FT                   RDEHGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKDRRK"
FT   gene            18543965..18551783
FT                   /locus_tag="mCG_1050346"
FT                   /note="gene_id=mCG1050346.0"
FT   mRNA            join(18543965..18544031,18551443..18551783)
FT                   /locus_tag="mCG_1050346"
FT                   /product="mCG1050346"
FT                   /note="gene_id=mCG1050346.0 transcript_id=mCT194352.0
FT                   created on 22-APR-2004"
FT   CDS             join(18543986..18544031,18551443..18551471)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050346"
FT                   /product="mCG1050346"
FT                   /note="gene_id=mCG1050346.0 transcript_id=mCT194352.0
FT                   protein_id=mCP115381.0"
FT                   /protein_id="EDL16049.1"
FT                   /translation="MQRPEAWPRSHPGEGGSSVSQGTD"
FT   gene            18560659..18561426
FT                   /pseudo
FT                   /locus_tag="mCG_49779"
FT                   /note="gene_id=mCG49779.2"
FT   mRNA            18560659..18561426
FT                   /pseudo
FT                   /locus_tag="mCG_49779"
FT                   /note="gene_id=mCG49779.2 transcript_id=mCT49962.2 created
FT                   on 29-OCT-2002"
FT   gene            complement(18598139..18608512)
FT                   /gene="Cdk5rap3"
FT                   /locus_tag="mCG_13228"
FT                   /note="gene_id=mCG13228.2"
FT   mRNA            complement(join(18598139..18598470,18598578..18598749,
FT                   18599062..18599246,18600288..18600376,18601004..18601085,
FT                   18601427..18601528,18601899..18602043,18602228..18602364,
FT                   18602572..18602750,18605693..18605741,18606070..18606170,
FT                   18606350..18606481,18608180..18608225,18608413..18608512))
FT                   /gene="Cdk5rap3"
FT                   /locus_tag="mCG_13228"
FT                   /product="CDK5 regulatory subunit associated protein 3,
FT                   transcript variant mCT172278"
FT                   /note="gene_id=mCG13228.2 transcript_id=mCT172278.0 created
FT                   on 19-AUG-2002"
FT   mRNA            complement(join(18598139..18598470,18598578..18598749,
FT                   18599062..18599267,18600288..18600376,18601004..18601085,
FT                   18601427..18601528,18601899..18602043,18602228..18602364,
FT                   18602572..18602750,18605693..18605741,18606070..18606170,
FT                   18606350..18606481,18608180..18608225,18608413..18608510))
FT                   /gene="Cdk5rap3"
FT                   /locus_tag="mCG_13228"
FT                   /product="CDK5 regulatory subunit associated protein 3,
FT                   transcript variant mCT12736"
FT                   /note="gene_id=mCG13228.2 transcript_id=mCT12736.1 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(18598405..18598470,18598578..18598749,
FT                   18599062..18599246,18600288..18600376,18601004..18601085,
FT                   18601427..18601528,18601899..18602043,18602228..18602364,
FT                   18602572..18602750,18605693..18605741,18606070..18606170,
FT                   18606350..18606481,18608180..18608225,18608413..18608418))
FT                   /codon_start=1
FT                   /gene="Cdk5rap3"
FT                   /locus_tag="mCG_13228"
FT                   /product="CDK5 regulatory subunit associated protein 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13228.2 transcript_id=mCT172278.0
FT                   protein_id=mCP95197.0 isoform=CRA_b"
FT                   /protein_id="EDL16051.1"
FT                   /translation="MQDHQHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAI
FT                   QDMPESQEIAQLLSGSYIHYFHCLRIVDLLKGTEASTKNIFGRYSSQRMKDWQEIVSLY
FT                   EKDNTYLVELCSLLVRNVSYEIPSLKKQIAKCQQLQQEYSRKEEEGQAGAAEMREQFYH
FT                   SCKQYGITGDNVRRELLALVKDLPSQLAEIGAGAQSLGEAIDLYQACVEFVCDSPTEQV
FT                   LPMLRYVQKKGNSTVYEWRTGTEPSVVERPQLEEPPEQVQEDEIDWGDFGVEAVSDSGI
FT                   VAETPGIDWGISLESEAKDAGADKIDWGDDAAAASEITVLETGTEAPEGVARGSDALTL
FT                   LEYPETRNQFIDELMERAVEMSEEADILSVSQFQLAPAILQGQTKEKMLSLVSTLQQLI
FT                   GRLTSLRMQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVEKQQEALQEQAAL
FT                   EPKLDLLLEKTRELQKLIEADISKRYSGRPVNLMGTSL"
FT   CDS             complement(join(18598405..18598470,18598578..18598749,
FT                   18599062..18599267,18600288..18600376,18601004..18601085,
FT                   18601427..18601528,18601899..18602043,18602228..18602364,
FT                   18602572..18602750,18605693..18605741,18606070..18606170,
FT                   18606350..18606481,18608180..18608225,18608413..18608418))
FT                   /codon_start=1
FT                   /gene="Cdk5rap3"
FT                   /locus_tag="mCG_13228"
FT                   /product="CDK5 regulatory subunit associated protein 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13228.2 transcript_id=mCT12736.1
FT                   protein_id=mCP23592.2 isoform=CRA_a"
FT                   /protein_id="EDL16050.1"
FT                   /translation="MQDHQHVPIDIQTSKLLDWLVDRRHCNLKWQSLVLTIREKINTAI
FT                   QDMPESQEIAQLLSGSYIHYFHCLRIVDLLKGTEASTKNIFGRYSSQRMKDWQEIVSLY
FT                   EKDNTYLVELCSLLVRNVSYEIPSLKKQIAKCQQLQQEYSRKEEEGQAGAAEMREQFYH
FT                   SCKQYGITGDNVRRELLALVKDLPSQLAEIGAGAQSLGEAIDLYQACVEFVCDSPTEQV
FT                   LPMLRYVQKKGNSTVYEWRTGTEPSVVERPQLEEPPEQVQEDEIDWGDFGVEAVSDSGI
FT                   VAETPGIDWGISLESEAKDAGADKIDWGDDAAAASEITVLETGTEAPEGVARGSDALTL
FT                   LEYPETRNQFIDELMELEIFLSQRAVEMSEEADILSVSQFQLAPAILQGQTKEKMLSLV
FT                   STLQQLIGRLTSLRMQHLFMILASPRYVDRVTEFLQQKLKQSQLLALKKELMVEKQQEA
FT                   LQEQAALEPKLDLLLEKTRELQKLIEADISKRYSGRPVNLMGTSL"
FT   gene            complement(18611018..18634430)
FT                   /locus_tag="mCG_1050991"
FT                   /note="gene_id=mCG1050991.0"
FT   mRNA            complement(join(18611018..18613145,18613892..18614003,
FT                   18614073..18614188,18634262..18634430))
FT                   /locus_tag="mCG_1050991"
FT                   /product="mCG1050991"
FT                   /note="gene_id=mCG1050991.0 transcript_id=mCT194780.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(18612147..18612653)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050991"
FT                   /product="mCG1050991"
FT                   /note="gene_id=mCG1050991.0 transcript_id=mCT194780.0
FT                   protein_id=mCP115809.0"
FT                   /protein_id="EDL16052.1"
FT                   /translation="MEILHTQHSKVLKLRAAEFPGLPRRFLSLSPSLSLSPLFFSLLLF
FT                   FLPLFPFFYLFPLSSFFSLSSSLCFPPLPLPPVIHTHTHTHTHTHIHTHQFADHKVINP
FT                   HRIRINVIWMSKVKPHFTDFFFMISHGHWSRTRCGKEEPCKSEGTSGATAPRNQGESES
FT                   HSEGW"
FT   gene            complement(18630240..18636414)
FT                   /gene="Pnpo"
FT                   /locus_tag="mCG_13238"
FT                   /note="gene_id=mCG13238.2"
FT   mRNA            complement(join(18630240..18631508,18631680..18631750,
FT                   18632073..18632201,18632441..18632494,18633281..18633380,
FT                   18634818..18634942,18636139..18636414))
FT                   /gene="Pnpo"
FT                   /locus_tag="mCG_13238"
FT                   /product="pyridoxine 5'-phosphate oxidase, transcript
FT                   variant mCT12975"
FT                   /note="gene_id=mCG13238.2 transcript_id=mCT12975.2 created
FT                   on 19-AUG-2002"
FT   mRNA            complement(join(18630250..18631508,18631680..18631750,
FT                   18632073..18632201,18632441..18633380,18634818..18634942,
FT                   18636139..>18636190))
FT                   /gene="Pnpo"
FT                   /locus_tag="mCG_13238"
FT                   /product="pyridoxine 5'-phosphate oxidase, transcript
FT                   variant mCT191004"
FT                   /note="gene_id=mCG13238.2 transcript_id=mCT191004.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(18631340..18631508,18631680..18631750,
FT                   18632073..18632201,18632441..18632494,18633281..18633380,
FT                   18634818..18634942,18636139..18636276))
FT                   /codon_start=1
FT                   /gene="Pnpo"
FT                   /locus_tag="mCG_13238"
FT                   /product="pyridoxine 5'-phosphate oxidase, isoform CRA_b"
FT                   /note="gene_id=mCG13238.2 transcript_id=mCT12975.2
FT                   protein_id=mCP23521.2 isoform=CRA_b"
FT                   /protein_id="EDL16054.1"
FT                   /translation="MTCGLLSVTVTFRRPAKWTGYLRHLCCRGAVMDLGPMRKSYRGDR
FT                   EAFEETHLTSLDPMKQFASWFDEAVQCPDIGEANAMCVATCTRDGKPSARMLLLKGFGK
FT                   DGFRFFTNYESRKGKELDSNPFASLVFYWEPLNRQVRVEGPVKKLPEKEAENYFHSRPK
FT                   SSQIGAVVSRQSSVIPDREYLRKKNEELGQLYQDQEVPKPEYWGGYILYPQVMEFWQGQ
FT                   TNRLHDRIVFRRGLATGDSPLGPMTHHGEEDWVYERLAP"
FT   CDS             complement(join(18631340..18631508,18631680..18631750,
FT                   18632073..18632201,18632441..>18632515))
FT                   /codon_start=1
FT                   /gene="Pnpo"
FT                   /locus_tag="mCG_13238"
FT                   /product="pyridoxine 5'-phosphate oxidase, isoform CRA_a"
FT                   /note="gene_id=mCG13238.2 transcript_id=mCT191004.0
FT                   protein_id=mCP111965.0 isoform=CRA_a"
FT                   /protein_id="EDL16053.1"
FT                   /translation="YLFSSFQDSNPFASLVFYWEPLNRQVRVEGPVKKLPEKEAENYFH
FT                   SRPKSSQIGAVVSRQSSVIPDREYLRKKNEELGQLYQDQEVPKPEYWGGYILYPQVMEF
FT                   WQGQTNRLHDRIVFRRGLATGDSPLGPMTHHGEEDWVYERLAP"
FT   mRNA            complement(join(18632009..18632201,18632441..18632494,
FT                   18634818..18634942,18636139..18636366))
FT                   /gene="Pnpo"
FT                   /locus_tag="mCG_13238"
FT                   /product="pyridoxine 5'-phosphate oxidase, transcript
FT                   variant mCT172280"
FT                   /note="gene_id=mCG13238.2 transcript_id=mCT172280.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(18632449..18632494,18634818..18634942,
FT                   18636139..18636276))
FT                   /codon_start=1
FT                   /gene="Pnpo"
FT                   /locus_tag="mCG_13238"
FT                   /product="pyridoxine 5'-phosphate oxidase, isoform CRA_c"
FT                   /note="gene_id=mCG13238.2 transcript_id=mCT172280.0
FT                   protein_id=mCP95199.0 isoform=CRA_c"
FT                   /db_xref="GOA:A2A6E7"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="MGI:MGI:2144151"
FT                   /db_xref="UniProtKB/TrEMBL:A2A6E7"
FT                   /protein_id="EDL16055.1"
FT                   /translation="MTCGLLSVTVTFRRPAKWTGYLRHLCCRGAVMDLGPMRKSYRGDR
FT                   EAFEETHLTSLDPMKQFASWFDEAVQCPDIGEANAMCVATCTRILIPLPLLSSTGSP"
FT   gene            <18636572..18658870
FT                   /locus_tag="mCG_60780"
FT                   /note="gene_id=mCG60780.3"
FT   mRNA            join(<18636572..18636622,18637253..18637501,
FT                   18645414..18645561,18653897..18654624,18655204..18655339,
FT                   18657918..18658870)
FT                   /locus_tag="mCG_60780"
FT                   /product="mCG60780, transcript variant mCT191037"
FT                   /note="gene_id=mCG60780.3 transcript_id=mCT191037.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(18636720..18636758,18637253..18637501,
FT                   18645414..18645561,18653897..18653958,18655204..18655339,
FT                   18657918..18658009)
FT                   /locus_tag="mCG_60780"
FT                   /product="mCG60780, transcript variant mCT60963"
FT                   /note="gene_id=mCG60780.3 transcript_id=mCT60963.2 created
FT                   on 29-OCT-2002"
FT   CDS             join(<18637361..18637501,18645414..18645561,
FT                   18653897..18654048)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60780"
FT                   /product="mCG60780, isoform CRA_a"
FT                   /note="gene_id=mCG60780.3 transcript_id=mCT191037.0
FT                   protein_id=mCP111991.0 isoform=CRA_a"
FT                   /protein_id="EDL16056.1"
FT                   /translation="EILTTLLPALICLGQPVVEDDSVALVSTSIRSGSPKSHVDRHPAL
FT                   CQLCGSWLALGTSCWQCRWLATRMECEASRQDGRQHRSLRTQQSCGPGCSEDGDYRRTR
FT                   NPLGVELQLVESHVSAGNQPWNLWKKRRVNHNPSLKPHCWAW"
FT   CDS             join(18645502..18645561,18653897..18653958,
FT                   18655204..18655273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_60780"
FT                   /product="mCG60780, isoform CRA_b"
FT                   /note="gene_id=mCG60780.3 transcript_id=mCT60963.2
FT                   protein_id=mCP42927.2 isoform=CRA_b"
FT                   /protein_id="EDL16057.1"
FT                   /translation="MAGSTEASALSRAAVLAALRMETTGGLGILWEWSYSWLRATSGLL
FT                   GLRPEETPGEKPFPAHPK"
FT   gene            complement(18648111..18677291)
FT                   /gene="Sp2"
FT                   /locus_tag="mCG_13240"
FT                   /note="gene_id=mCG13240.2"
FT   mRNA            complement(join(18648111..18648941,18650146..18650339,
FT                   18650476..18650650,18651795..18652107,18655381..18656352,
FT                   18657714..18657793,18675748..18675921,18677186..18677291))
FT                   /gene="Sp2"
FT                   /locus_tag="mCG_13240"
FT                   /product="Sp2 transcription factor, transcript variant
FT                   mCT12977"
FT                   /note="gene_id=mCG13240.2 transcript_id=mCT12977.3 created
FT                   on 18-JUN-2003"
FT   mRNA            complement(join(18648111..18648941,18650146..18650339,
FT                   18650476..18650650,18651795..18652107,18655381..18656352,
FT                   18657714..18657790,18671954..18671991))
FT                   /gene="Sp2"
FT                   /locus_tag="mCG_13240"
FT                   /product="Sp2 transcription factor, transcript variant
FT                   mCT178094"
FT                   /note="gene_id=mCG13240.2 transcript_id=mCT178094.0 created
FT                   on 18-JUN-2003"
FT   mRNA            complement(join(18648111..18648941,18650146..18650339,
FT                   18650476..18650650,18651795..18652107,18655381..18656352,
FT                   18657714..18657790,18662930..>18663008))
FT                   /gene="Sp2"
FT                   /locus_tag="mCG_13240"
FT                   /product="Sp2 transcription factor, transcript variant
FT                   mCT185865"
FT                   /note="gene_id=mCG13240.2 transcript_id=mCT185865.0 created
FT                   on 18-JUN-2003"
FT   CDS             complement(join(18648841..18648941,18650146..18650339,
FT                   18650476..18650650,18651795..18652107,18655381..18656352,
FT                   18657714..18657790,18671954..18671960))
FT                   /codon_start=1
FT                   /gene="Sp2"
FT                   /locus_tag="mCG_13240"
FT                   /product="Sp2 transcription factor, isoform CRA_b"
FT                   /note="gene_id=mCG13240.2 transcript_id=mCT178094.0
FT                   protein_id=mCP101016.0 isoform=CRA_b"
FT                   /protein_id="EDL16059.1"
FT                   /translation="MSDPQMSMAATAAVSPSDYLQPAAATTQDSQPSPLALLAATCSKI
FT                   GPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPCKNSFSILSSKGNILQIQGSQLSTS
FT                   YPGGQFVFAIQNPTLINKGSRSNASIQYQVPQIQGNSSQTIQVQPSLTNQIQVIPGTNQ
FT                   AIITPSTSGHKPVPIKPAPVQKSSTTTTPVQSGANVVKLTGGGSNMTLTLPLNNLVNTS
FT                   DIGGPAQLLTESPPTPLSKTNKKARKKSLPVSQPSVAVAEQVETVLIETTADNIIQAGN
FT                   NLLIVQSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQALRVVQAASATLPTVPQKPSQN
FT                   FQIQTTEPTPTQVYIRTPSGEVQTVLVQDSPPATAATTSTVTCNSPALRAPHLSGTSKK
FT                   HSAAILRKERPLPKIAPAGSIISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGGQ
FT                   QQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGEAQPGEKRRRMACTCPNCKDGEKRSG
FT                   EQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHAR
FT                   THTGDKRFECAQCQKRFMRSDHLTKHYKTHLGTKGL"
FT   CDS             complement(join(18648841..18648941,18650146..18650339,
FT                   18650476..18650650,18651795..18652107,18655381..18656352,
FT                   18657714..18657790,18662930..>18662972))
FT                   /codon_start=1
FT                   /gene="Sp2"
FT                   /locus_tag="mCG_13240"
FT                   /product="Sp2 transcription factor, isoform CRA_c"
FT                   /note="gene_id=mCG13240.2 transcript_id=mCT185865.0
FT                   protein_id=mCP107123.0 isoform=CRA_c"
FT                   /protein_id="EDL16060.1"
FT                   /translation="SHVNRHSPPRKEVLDPQMSMAATAAVSPSDYLQPAAATTQDSQPS
FT                   PLALLAATCSKIGPPAVEAAVTPPAPPQPTPRKLVPIKPAPLPLSPCKNSFSILSSKGN
FT                   ILQIQGSQLSTSYPGGQFVFAIQNPTLINKGSRSNASIQYQVPQIQGNSSQTIQVQPSL
FT                   TNQIQVIPGTNQAIITPSTSGHKPVPIKPAPVQKSSTTTTPVQSGANVVKLTGGGSNMT
FT                   LTLPLNNLVNTSDIGGPAQLLTESPPTPLSKTNKKARKKSLPVSQPSVAVAEQVETVLI
FT                   ETTADNIIQAGNNLLIVQSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQALRVVQAASA
FT                   TLPTVPQKPSQNFQIQTTEPTPTQVYIRTPSGEVQTVLVQDSPPATAATTSTVTCNSPA
FT                   LRAPHLSGTSKKHSAAILRKERPLPKIAPAGSIISLNAAQLAAAAQAMQTININGVQVQ
FT                   GVPVTITNTGGQQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGEAQPGEKRRRMACT
FT                   CPNCKDGEKRSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKR
FT                   FTRSDELQRHARTHTGDKRFECAQCQKRFMRSDHLTKHYKTHLGTKGL"
FT   CDS             complement(join(18648841..18648941,18650146..18650339,
FT                   18650476..18650650,18651795..18652107,18655381..18656352,
FT                   18657714..18657782))
FT                   /codon_start=1
FT                   /gene="Sp2"
FT                   /locus_tag="mCG_13240"
FT                   /product="Sp2 transcription factor, isoform CRA_a"
FT                   /note="gene_id=mCG13240.2 transcript_id=mCT12977.3
FT                   protein_id=mCP23448.3 isoform=CRA_a"
FT                   /protein_id="EDL16058.1"
FT                   /translation="MSMAATAAVSPSDYLQPAAATTQDSQPSPLALLAATCSKIGPPAV
FT                   EAAVTPPAPPQPTPRKLVPIKPAPLPLSPCKNSFSILSSKGNILQIQGSQLSTSYPGGQ
FT                   FVFAIQNPTLINKGSRSNASIQYQVPQIQGNSSQTIQVQPSLTNQIQVIPGTNQAIITP
FT                   STSGHKPVPIKPAPVQKSSTTTTPVQSGANVVKLTGGGSNMTLTLPLNNLVNTSDIGGP
FT                   AQLLTESPPTPLSKTNKKARKKSLPVSQPSVAVAEQVETVLIETTADNIIQAGNNLLIV
FT                   QSPGGGQPAVVQQVQVVPPKAEQQQVVQIPQQALRVVQAASATLPTVPQKPSQNFQIQT
FT                   TEPTPTQVYIRTPSGEVQTVLVQDSPPATAATTSTVTCNSPALRAPHLSGTSKKHSAAI
FT                   LRKERPLPKIAPAGSIISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGGQQQLTV
FT                   QNVSGNNLTISGLSPTQIQLQMEQALAGEAQPGEKRRRMACTCPNCKDGEKRSGEQGKK
FT                   KHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTGD
FT                   KRFECAQCQKRFMRSDHLTKHYKTHLGTKGL"
FT   gene            18715031..18719259
FT                   /locus_tag="mCG_13224"
FT                   /note="gene_id=mCG13224.2"
FT   mRNA            join(18715031..18715055,18717258..18719259)
FT                   /locus_tag="mCG_13224"
FT                   /product="mCG13224"
FT                   /note="gene_id=mCG13224.2 transcript_id=mCT12411.2 created
FT                   on 29-OCT-2002"
FT   CDS             18717315..18718445
FT                   /codon_start=1
FT                   /locus_tag="mCG_13224"
FT                   /product="mCG13224"
FT                   /note="gene_id=mCG13224.2 transcript_id=mCT12411.2
FT                   protein_id=mCP23501.1"
FT                   /db_xref="GOA:A2A708"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1932575"
FT                   /db_xref="UniProtKB/TrEMBL:A2A708"
FT                   /protein_id="EDL16061.1"
FT                   /translation="MLTAVCGSLGSQHTDAPHASPPRLDLQPLQTYQGHTSPEAGDYPS
FT                   PLQPGELQSLPLGPEVDFSQGYELPGASSRVTCEDLESDSPLAPGPFSKLLQPDMSHHY
FT                   ESWFRPTHPGTEDGSWWDLHPGTSWMDLPHTQGALTSPGHPGALQPALGGYVGDHQLCA
FT                   PPPHPHPHHLLPAAGGQHLLGPPDGAKALEAAAQESQGLDSSLDAASRPKGSRRSVPRS
FT                   SGQTVCRCPNCLEAERLGAPCGPDGGKKKHLHNCHIPGCGKAYAKTSHLKAHLRWHSGD
FT                   RPFVCNWLFCGKRFTRSDELQRHLQTHTGTKKFPCAVCSRVFMRSDHLAKHMKTHEGAK
FT                   EEAAAAAQGEGKAGGVVEPPGGKGKREAEGSSASSN"
FT   gene            18725724..18729774
FT                   /gene="Scrn2"
FT                   /locus_tag="mCG_13220"
FT                   /note="gene_id=mCG13220.1"
FT   mRNA            join(18725724..18725871,18726232..18726405,
FT                   18726696..18726877,18727905..18728104,18728571..18728786,
FT                   18728880..18729045,18729135..18729315,18729482..18729773)
FT                   /gene="Scrn2"
FT                   /locus_tag="mCG_13220"
FT                   /product="secernin 2, transcript variant mCT12995"
FT                   /note="gene_id=mCG13220.1 transcript_id=mCT12995.1 created
FT                   on 26-SEP-2002"
FT   mRNA            join(18725817..18725871,18726232..18726405,
FT                   18726696..18726877,18727905..18728104,18728571..18729045,
FT                   18729135..18729315,18729482..18729766)
FT                   /gene="Scrn2"
FT                   /locus_tag="mCG_13220"
FT                   /product="secernin 2, transcript variant mCT173645"
FT                   /note="gene_id=mCG13220.1 transcript_id=mCT173645.0 created
FT                   on 26-SEP-2002"
FT   mRNA            join(18725988..18726405,18726696..18726877,
FT                   18727905..18728104,18728571..18728786,18728880..18729045,
FT                   18729135..18729315,18729482..18729774)
FT                   /gene="Scrn2"
FT                   /locus_tag="mCG_13220"
FT                   /product="secernin 2, transcript variant mCT173646"
FT                   /note="gene_id=mCG13220.1 transcript_id=mCT173646.0 created
FT                   on 26-SEP-2002"
FT   CDS             join(18726208..18726405,18726696..18726877,
FT                   18727905..18728104,18728571..18728786,18728880..18729045,
FT                   18729135..18729315,18729482..18729640)
FT                   /codon_start=1
FT                   /gene="Scrn2"
FT                   /locus_tag="mCG_13220"
FT                   /product="secernin 2, isoform CRA_c"
FT                   /note="gene_id=mCG13220.1 transcript_id=mCT173646.0
FT                   protein_id=mCP96564.0 isoform=CRA_c"
FT                   /protein_id="EDL16064.1"
FT                   /translation="MNISTSSQMASSSPDAPCSCDCFVSVPPASAIPAVIFAKNSDRPR
FT                   DEVQEVVFIPAGTHVPGSRLQCTYIEVEQVGKTHAVILSRPSWLWGAEMGANELGVCIG
FT                   NEAVWTKEPVGQGEALLGMDLLRLALERSSTAQEAVHVIAGLLDRYGQGGSCREDPEPF
FT                   CYHNTFLLADRTEAWVLETAGSLWAAQRIQGGARNISNQLSIGTDISAEHPELRSHAKA
FT                   QGWWTGQGLFDFAEVFSLTQQPVRMEAAKARFRAGCEMLQRHQGNITAEVMMGILRDKE
FT                   SGICMDSGGFRTTASMVSVLPQDPTKPCVHFLTATPDPSRSVFKPFIFEVGVSQSPQVL
FT                   SPTFGAQDPVRILPRFQTRVDRRHSLYRGHQAALGLMEDEQEQAQQLRKKQQRLEQEGL
FT                   EALRGLLTGEQTPPAQGLGSLFQAFVEREEQAYA"
FT   CDS             join(18726232..18726405,18726696..18726877,
FT                   18727905..18728104,18728571..18728786,18728880..18729045,
FT                   18729135..18729315,18729482..18729640)
FT                   /codon_start=1
FT                   /gene="Scrn2"
FT                   /locus_tag="mCG_13220"
FT                   /product="secernin 2, isoform CRA_b"
FT                   /note="gene_id=mCG13220.1 transcript_id=mCT12995.1
FT                   protein_id=mCP23573.2 isoform=CRA_b"
FT                   /protein_id="EDL16063.1"
FT                   /translation="MASSSPDAPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVF
FT                   IPAGTHVPGSRLQCTYIEVEQVGKTHAVILSRPSWLWGAEMGANELGVCIGNEAVWTKE
FT                   PVGQGEALLGMDLLRLALERSSTAQEAVHVIAGLLDRYGQGGSCREDPEPFCYHNTFLL
FT                   ADRTEAWVLETAGSLWAAQRIQGGARNISNQLSIGTDISAEHPELRSHAKAQGWWTGQG
FT                   LFDFAEVFSLTQQPVRMEAAKARFRAGCEMLQRHQGNITAEVMMGILRDKESGICMDSG
FT                   GFRTTASMVSVLPQDPTKPCVHFLTATPDPSRSVFKPFIFEVGVSQSPQVLSPTFGAQD
FT                   PVRILPRFQTRVDRRHSLYRGHQAALGLMEDEQEQAQQLRKKQQRLEQEGLEALRGLLT
FT                   GEQTPPAQGLGSLFQAFVEREEQAYA"
FT   CDS             join(18726232..18726405,18726696..18726877,
FT                   18727905..18728104,18728571..18728794)
FT                   /codon_start=1
FT                   /gene="Scrn2"
FT                   /locus_tag="mCG_13220"
FT                   /product="secernin 2, isoform CRA_a"
FT                   /note="gene_id=mCG13220.1 transcript_id=mCT173645.0
FT                   protein_id=mCP96565.0 isoform=CRA_a"
FT                   /protein_id="EDL16062.1"
FT                   /translation="MASSSPDAPCSCDCFVSVPPASAIPAVIFAKNSDRPRDEVQEVVF
FT                   IPAGTHVPGSRLQCTYIEVEQVGKTHAVILSRPSWLWGAEMGANELGVCIGNEAVWTKE
FT                   PVGQGEALLGMDLLRLALERSSTAQEAVHVIAGLLDRYGQGGSCREDPEPFCYHNTFLL
FT                   ADRTEAWVLETAGSLWAAQRIQGGARNISNQLSIGTDISAEHPELRSHAKAQGWWTGQG
FT                   LFDFAEVFSLTQQPVRMEAAKARFRAGCEMLQRHQGL"
FT   gene            complement(18730571..18744304)
FT                   /gene="Lrrc46"
FT                   /locus_tag="mCG_13243"
FT                   /note="gene_id=mCG13243.1"
FT   mRNA            complement(join(18730571..18730998,18731433..18731578,
FT                   18731846..18731915,18732070..18732179,18732444..18732490,
FT                   18734769..18734877,18736869..18736974,18737077..18737198,
FT                   18744180..18744304))
FT                   /gene="Lrrc46"
FT                   /locus_tag="mCG_13243"
FT                   /product="leucine rich repeat containing 46, transcript
FT                   variant mCT12978"
FT                   /note="gene_id=mCG13243.1 transcript_id=mCT12978.1 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(18730572..18730998,18731433..18731578,
FT                   18731846..18731915,18732070..18732179,18732444..18732490,
FT                   18734769..18734877,18736869..18736974,18737077..18737339))
FT                   /gene="Lrrc46"
FT                   /locus_tag="mCG_13243"
FT                   /product="leucine rich repeat containing 46, transcript
FT                   variant mCT173647"
FT                   /note="gene_id=mCG13243.1 transcript_id=mCT173647.0 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(18730637..18730998,18731433..18731578,
FT                   18731846..18731915,18732070..18732179,18732444..18732490,
FT                   18734769..18734877,18736869..18736974,18737077..18737098))
FT                   /codon_start=1
FT                   /gene="Lrrc46"
FT                   /locus_tag="mCG_13243"
FT                   /product="leucine rich repeat containing 46, isoform CRA_a"
FT                   /note="gene_id=mCG13243.1 transcript_id=mCT12978.1
FT                   protein_id=mCP23457.2 isoform=CRA_a"
FT                   /protein_id="EDL16065.1"
FT                   /translation="MPGDEQEAKKAAQRTEEGVHITEALITKRNLTFPGDEDLSEKMFH
FT                   TLGELETVRLDGEGITCIGNLEKLRNIHSLYLQSNKIQRIENLACITSLRFLSLARNQI
FT                   RHVENLLDLQYLQFLDLSENLIETLKLDELPESLLILNLCGNPCTNQEGYRKMVIGALP
FT                   LLLDLDKQPILERWTSDEEDKSSDDDDEFPELNGPFCAERGFFKDLEQELHQHQERRQQ
FT                   AALTEHLSRMETQPVLTDLPLLPAVPMAGDCSSTATDQPGKESAPKATSSTQTASTTKK
FT                   QVSKNQKSSVQARKGALAATTSKTSQAATPSMTKMTNKKSTK"
FT   CDS             complement(join(18730637..18730998,18731433..18731578,
FT                   18731846..18731915,18732070..18732179,18732444..18732490,
FT                   18734769..18734877,18736869..18736974,18737077..18737098))
FT                   /codon_start=1
FT                   /gene="Lrrc46"
FT                   /locus_tag="mCG_13243"
FT                   /product="leucine rich repeat containing 46, isoform CRA_a"
FT                   /note="gene_id=mCG13243.1 transcript_id=mCT173647.0
FT                   protein_id=mCP96566.0 isoform=CRA_a"
FT                   /protein_id="EDL16066.1"
FT                   /translation="MPGDEQEAKKAAQRTEEGVHITEALITKRNLTFPGDEDLSEKMFH
FT                   TLGELETVRLDGEGITCIGNLEKLRNIHSLYLQSNKIQRIENLACITSLRFLSLARNQI
FT                   RHVENLLDLQYLQFLDLSENLIETLKLDELPESLLILNLCGNPCTNQEGYRKMVIGALP
FT                   LLLDLDKQPILERWTSDEEDKSSDDDDEFPELNGPFCAERGFFKDLEQELHQHQERRQQ
FT                   AALTEHLSRMETQPVLTDLPLLPAVPMAGDCSSTATDQPGKESAPKATSSTQTASTTKK
FT                   QVSKNQKSSVQARKGALAATTSKTSQAATPSMTKMTNKKSTK"
FT   gene            18732961..18733579
FT                   /locus_tag="mCG_13229"
FT                   /note="gene_id=mCG13229.0"
FT   mRNA            18732961..18733579
FT                   /locus_tag="mCG_13229"
FT                   /product="mCG13229"
FT                   /note="gene_id=mCG13229.0 transcript_id=mCT12415.1 created
FT                   on 30-OCT-2002"
FT   CDS             18733230..18733481
FT                   /codon_start=1
FT                   /locus_tag="mCG_13229"
FT                   /product="mCG13229"
FT                   /note="gene_id=mCG13229.0 transcript_id=mCT12415.1
FT                   protein_id=mCP23607.2"
FT                   /protein_id="EDL16067.1"
FT                   /translation="MPKGPKLKRLAFIAHPKLGKRIRSYMAKGQRLCQPKPKVQIEAGA
FT                   KAPAKAQASAAALAPKGAQAPKGTQALLKAPWKRLLPV"
FT   gene            18737580..18745207
FT                   /gene="Mrpl10"
FT                   /locus_tag="mCG_13232"
FT                   /note="gene_id=mCG13232.1"
FT   mRNA            join(18737580..18737646,18740522..18740691,
FT                   18743024..18743188,18743407..18743551,18744073..18745207)
FT                   /gene="Mrpl10"
FT                   /locus_tag="mCG_13232"
FT                   /product="mitochondrial ribosomal protein L10, transcript
FT                   variant mCT12737"
FT                   /note="gene_id=mCG13232.1 transcript_id=mCT12737.1 created
FT                   on 04-MAR-2003"
FT   CDS             join(18737595..18737646,18740522..18740691,
FT                   18743024..18743188,18743407..18743551,18744073..18744329)
FT                   /codon_start=1
FT                   /gene="Mrpl10"
FT                   /locus_tag="mCG_13232"
FT                   /product="mitochondrial ribosomal protein L10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13232.1 transcript_id=mCT12737.1
FT                   protein_id=mCP23387.1 isoform=CRA_b"
FT                   /protein_id="EDL16069.1"
FT                   /translation="MAAAVAGILRGGLPPRAAWLPTLQTVRHGSKAVTRHWRVMHFQRQ
FT                   KLMAITEYIPPKPAINPRCLPPPPKPPKEESGLVRLLRQDIVAVFRDNRMIAVCQNVAL
FT                   SAEDKLLLRHQLRKHKIFIKVFPSQVLKPFLENSKYRNLLPLFVGHNLLLVSEEPKVKE
FT                   MVRVLKSVPFLPLLGGCVDDTILSRQGLVDYAKLPSLDQLQGQLVGGLTHLMAQTRYLL
FT                   QHQPVQLTSLLDQYVKEQNEGDCATSANEKLHPPDPAPDA"
FT   mRNA            join(18737610..18737646,18743024..18743188,
FT                   18743407..18743551,18744073..18744511)
FT                   /gene="Mrpl10"
FT                   /locus_tag="mCG_13232"
FT                   /product="mitochondrial ribosomal protein L10, transcript
FT                   variant mCT180859"
FT                   /note="gene_id=mCG13232.1 transcript_id=mCT180859.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(18743084..18743188,18743407..18743551,
FT                   18744073..18744329)
FT                   /codon_start=1
FT                   /gene="Mrpl10"
FT                   /locus_tag="mCG_13232"
FT                   /product="mitochondrial ribosomal protein L10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13232.1 transcript_id=mCT180859.0
FT                   protein_id=mCP103781.0 isoform=CRA_a"
FT                   /protein_id="EDL16068.1"
FT                   /translation="MIAVCQNVALSAEDKLLLRHQLRKHKIFIKVFPSQVLKPFLENSK
FT                   YRNLLPLFVGHNLLLVSEEPKVKEMVRVLKSVPFLPLLGGCVDDTILSRQGLVDYAKLP
FT                   SLDQLQGQLVGGLTHLMAQTRYLLQHQPVQLTSLLDQYVKEQNEGDCATSANEKLHPPD
FT                   PAPDA"
FT   gene            18746840..18764895
FT                   /locus_tag="mCG_13237"
FT                   /note="gene_id=mCG13237.2"
FT   mRNA            join(18746840..18746947,18748221..18748372,
FT                   18748482..18748607,18750111..18750224,18750546..18750641,
FT                   18750755..18750872,18751523..18751626,18751851..18751943,
FT                   18752027..18752159,18752249..18752343,18752524..18752619,
FT                   18754456..18754593,18755095..18755188,18756037..18756284,
FT                   18756445..18756582,18761582..18761645,18761774..18761852,
FT                   18762932..18763076,18763205..18763350,18763435..18763560,
FT                   18763665..18763787,18763942..18764895)
FT                   /locus_tag="mCG_13237"
FT                   /product="mCG13237"
FT                   /note="gene_id=mCG13237.2 transcript_id=mCT11079.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(18748298..18748372,18748482..18748607,
FT                   18750111..18750224,18750546..18750641,18750755..18750872,
FT                   18751523..18751626,18751851..18751943,18752027..18752159,
FT                   18752249..18752343,18752524..18752619,18754456..18754593,
FT                   18755095..18755188,18756037..18756284,18756445..18756582,
FT                   18761582..18761645,18761774..18761852,18762932..18763076,
FT                   18763205..18763350,18763435..18763456)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13237"
FT                   /product="mCG13237"
FT                   /note="gene_id=mCG13237.2 transcript_id=mCT11079.2
FT                   protein_id=mCP23434.2"
FT                   /protein_id="EDL16070.1"
FT                   /translation="MDFQERDTPSLAESTQSSKPSSTQQASELWEVMEEPRGRLGADDI
FT                   MPERQEGHLLKKRKWPLKGWHKITKGKVHGSIDVRLSVMSINKKAQRIDLDTEDNIYHL
FT                   KIKSQDLFHSWVAQLRAHRLAQRLDMPSATHRKAPGTQMLTAGSASALPGVGPREKVSS
FT                   WLRDSDGLDRCSHALSECQGKLQELHRLLQSLESLHRIPSAPVIPTHQTSVTTERPKKG
FT                   KRTSRMWCTQGFAKDDTIGRVGRLHGSVPNLSRYLESRDTSGPRGLPPPDYAHLQRSFW
FT                   ALAQKVHNSLSSVLVALTTERDRLRDLHQGSELSRMVVSEAPDGQRRLHSLSISSDTTA
FT                   DSFSSLNPEEQEALYMKGRELTPQLSQSSVLSLADSHTEFFDACEVLLSASSSENEGSE
FT                   EEESCASEITTSLSEEVLDIRGADRYQKGPCVPGIAVGPPRRRCLPAASGPGTDVSLWN
FT                   ILRNNIGKDLSKVSMPVQLNEPLNTLQRLCEELEYSSLLDQASRMADPCERMVYIAAFA
FT                   VSAYSSTYHRAGCKPFNPVLGETYECERPDRGFRFISEQVSHHPPISACHAESENFIFW
FT                   QDMKWKNKFWGKSLEIVPVGTVNVSLPRFGDHFEWNKVTSCIHNILSGQRWIEHYGEVL
FT                   IRNTQDSSCHCKITFCKAKYWSSNIHEVQGAVLSRSGRVLHRLFGKWHEGLYRGPPTGW
FT                   AVHLETQFDASRP"
FT   gene            18794181..18794572
FT                   /pseudo
FT                   /locus_tag="mCG_146376"
FT                   /note="gene_id=mCG146376.0"
FT   mRNA            18794181..18794572
FT                   /pseudo
FT                   /locus_tag="mCG_146376"
FT                   /note="gene_id=mCG146376.0 transcript_id=mCT186577.0
FT                   created on 18-JUL-2003"
FT   gene            complement(18795352..18812566)
FT                   /gene="Tbx21"
FT                   /locus_tag="mCG_13239"
FT                   /note="gene_id=mCG13239.1"
FT   mRNA            complement(join(18795352..18796656,18797048..18797109,
FT                   18797205..18797363,18798761..18798882,18799226..18799380,
FT                   18811936..18812566))
FT                   /gene="Tbx21"
FT                   /locus_tag="mCG_13239"
FT                   /product="T-box 21"
FT                   /note="gene_id=mCG13239.1 transcript_id=mCT12976.1 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(18796050..18796656,18797048..18797109,
FT                   18797205..18797363,18798761..18798882,18799226..18799380,
FT                   18811936..18812423))
FT                   /codon_start=1
FT                   /gene="Tbx21"
FT                   /locus_tag="mCG_13239"
FT                   /product="T-box 21"
FT                   /note="gene_id=mCG13239.1 transcript_id=mCT12976.1
FT                   protein_id=mCP23405.1"
FT                   /db_xref="GOA:Q3U150"
FT                   /db_xref="InterPro:IPR001699"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR018186"
FT                   /db_xref="MGI:MGI:1888984"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U150"
FT                   /protein_id="EDL16071.1"
FT                   /translation="MGIVEPGCGDMLTGTEPMPSDEGRGPGADQQHRFFYPEPGAQDPT
FT                   DRRAGSSLGTPYSGGALVPAAPGRFLGSFAYPPRAQVAGFPGPGEFFPPPAGAEGYPPV
FT                   DGYPAPDPRAGLYPGPREDYALPAGLEVSGKLRVALSNHLLWSKFNQHQTEMIITKQGR
FT                   RMFPFLSFTVAGLEPTSHYRMFVDVVLVDQHHWRYQSGKWVQCGKAEGSMPGNRLYVHP
FT                   DSPNTGAHWMRQEVSFGKLKLTNNKGASNNVTQMIVLQSLHKYQPRLHIVEVNDGEPEA
FT                   ACSASNTHVFTFQETQFIAVTAYQNAEITQLKIDNNPFAKGFRENFESMYASVDTSVPS
FT                   PPGPNCQLLGGDPFSPLLSNQYPVPSRFYPDLPGQPKDMISQPYWLGTPREHSYEAEFR
FT                   AVSMKPTLLPSAPGPTVPYYRGQDVLAPGAGWPVAPQYPPKMSPAGWFRPMRTLPMDPG
FT                   LGSSEEQGSSPSLWPEVTSLQPEPSDSGLGEGDTKRRRISPYPSSGDSSSPAGAPSPFD
FT                   KETEGQFYNYFPN"
FT   gene            complement(18833650..18847562)
FT                   /gene="Tbkbp1"
FT                   /locus_tag="mCG_13217"
FT                   /note="gene_id=mCG13217.2"
FT   mRNA            complement(join(18833650..18835155,18836102..18836374,
FT                   18836869..18837070,18843781..18843842,18843936..18844114,
FT                   18844854..18845034,18846110..18846214,18846426..18846548,
FT                   18846843..18847096,18847472..18847562))
FT                   /gene="Tbkbp1"
FT                   /locus_tag="mCG_13217"
FT                   /product="TBK1 binding protein 1, transcript variant
FT                   mCT12712"
FT                   /note="gene_id=mCG13217.2 transcript_id=mCT12712.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(18835027..18835155,18836102..18836374,
FT                   18836869..18837070,18843781..18843842,18843936..18844114,
FT                   18844854..18845034,18846110..18846214,18846426..18846548,
FT                   18846843..18847067))
FT                   /codon_start=1
FT                   /gene="Tbkbp1"
FT                   /locus_tag="mCG_13217"
FT                   /product="TBK1 binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG13217.2 transcript_id=mCT12712.2
FT                   protein_id=mCP23480.1 isoform=CRA_a"
FT                   /protein_id="EDL16072.1"
FT                   /translation="MESMFEDDISILTQEALGPSEVWLDGPGDPSLGGDMCSASHFALI
FT                   TAYGDIKERLGGLERENATLRRRLKVYEIKYPLITDFGEEHGFPLYELKDGSLLEVEKV
FT                   SLQQRLNQFQHELQKSKEQEEQLGEMIQAYEKLCVEKSDLETELGEMRALVETHLRQIC
FT                   GLEKQLQQQQGLRDAAFSSLSPPAVPASACPDLDLHYLALRGGPALGHAGWPGPTSVSV
FT                   SELERRRLEEALEAAQGEARGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSECD
FT                   MAWVKRVGDDQVNLALAYTELTEELGRLRELSSLQGRILRTLLQEQARNAGELGRSLVW
FT                   EQECWALESSSTPWVGIAIAEAATLPKPRAYGGELYGRPLSPRRAFEGIRLRFEKQPSE
FT                   EEEWAMPASPPSPEAGTIRCASFCAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGS
FT                   DIRSCPLCQLGFPVGYPDDALIKHIDSHLENSKI"
FT   mRNA            complement(join(18835886..18836814,18836952..18837070,
FT                   18840217..18840338,18843781..18843842,18843936..18844114,
FT                   18844854..18845034,18845172..18845212,18846110..18846214,
FT                   18846426..18846548,18846843..18847096,18847472..18847562))
FT                   /gene="Tbkbp1"
FT                   /locus_tag="mCG_13217"
FT                   /product="TBK1 binding protein 1, transcript variant
FT                   mCT173644"
FT                   /note="gene_id=mCG13217.2 transcript_id=mCT173644.0 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(18845204..18845212,18846110..18846214,
FT                   18846426..18846548,18846843..18847067))
FT                   /codon_start=1
FT                   /gene="Tbkbp1"
FT                   /locus_tag="mCG_13217"
FT                   /product="TBK1 binding protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG13217.2 transcript_id=mCT173644.0
FT                   protein_id=mCP96563.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3X9S9"
FT                   /db_xref="MGI:MGI:1920424"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9S9"
FT                   /protein_id="EDL16073.1"
FT                   /translation="MESMFEDDISILTQEALGPSEVWLDGPGDPSLGGDMCSASHFALI
FT                   TAYGDIKERLGGLERENATLRRRLKVYEIKYPLITDFGEEHGFPLYELKDGSLLEVEKV
FT                   SLQQRLNQFQHELQKSKEQEEQLGEMIQAYEKLCVEKSDLETELGEMEL"
FT   gene            complement(18857170..18885407)
FT                   /locus_tag="mCG_119984"
FT                   /note="gene_id=mCG119984.1"
FT   mRNA            complement(join(18857170..18860137,18860809..18860970,
FT                   18861370..18861484,18862181..18862286,18862409..18862552,
FT                   18862832..18862939,18863503..18863585,18865009..18865153,
FT                   18866324..18866395,18866607..18866754,18867361..18867491,
FT                   18868981..18869172,18870516..18870740,18873212..18873313,
FT                   18874709..18874819,18875733..18875822,18876331..18876390,
FT                   18877907..18878059,18879088..18879288,18882390..18882572,
FT                   18884852..18884910,18885010..18885407))
FT                   /locus_tag="mCG_119984"
FT                   /product="mCG119984"
FT                   /note="gene_id=mCG119984.1 transcript_id=mCT121162.1
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(18860137,18860809..18860970,
FT                   18861370..18861484,18862181..18862286,18862409..18862552,
FT                   18862832..18862939,18863503..18863585,18865009..18865153,
FT                   18866324..18866395,18866607..18866754,18867361..18867491,
FT                   18868981..18869172,18870516..18870740,18873212..18873313,
FT                   18874709..18874819,18875733..18875822,18876331..18876390,
FT                   18877907..18878059,18879088..18879288,18882390..18882572,
FT                   18884852..18884910,18885010..18885049))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119984"
FT                   /product="mCG119984"
FT                   /note="gene_id=mCG119984.1 transcript_id=mCT121162.1
FT                   protein_id=mCP85064.1"
FT                   /db_xref="GOA:P70168"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR027140"
FT                   /db_xref="MGI:MGI:107532"
FT                   /db_xref="PDB:1GCJ"
FT                   /db_xref="PDB:1UKL"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70168"
FT                   /protein_id="EDL16074.1"
FT                   /translation="MELITILEKTVSPDRLELEAAQKFLERAAVENLPTFLVELSRVLA
FT                   NPGNSQVARVAAGLQIKNSLTSKDPDIKAQYQQRWLAIDANARREVKNYVLQTLGTETY
FT                   RPSSASQCVAGIACAEIPVSQWPELIPQLVANVTNPNSTEHMKESTLEAIGYICQDIDP
FT                   EQLQDKSNEILTAIIQGMRKEEPSNNVKLAATNALLNSLEFTKANFDKESERHFIMQVV
FT                   CEATQCPDTRVRVAALQNLVKIMSLYYQYMETYMGPALFAITIEAMKSDIDEVALQGIE
FT                   FWSNVCDEEMDLAIEASEAAEQGRPPEHTSKFYAKGALQYLVPILTQTLTKQDENDDDD
FT                   DWNPCKAAGVCLMLLSTCCEDDIVPHVLPFIKEHIKNPDWRYRDAAVMAFGSILEGPEP
FT                   NQLKPLVIQAMPTLIELMKDPSVVVRDTTAWTVGRICELLPEAAINDVYLAPLLQCLIE
FT                   GLSAEPRVASNVCWAFSSLAEAAYEAADVADDQEEPATYCLSSSFELIVQKLLETTDRP
FT                   DGHQNNLRSSAYESLMEIVKNSAKDCYPAVQKTTLVIMERLQQVLQMESHIQSTSDRIQ
FT                   FNDLQSLLCATLQNVLRKVQHQDALQISDVVMASLLRMFQSTAGSGGVQEDALMAVSTL
FT                   VEVLGGEFLKYMEAFKPFLGIGLKNYAEYQVCLAAVGLVGDLCRALQSNILPFCDEVMQ
FT                   LLLENLGNENVHRSVKPQILSVFGDIALAIGGEFKKYLEVVLNTLQQASQAQVDKSDFD
FT                   MVDYLNELRESCLEAYTGIVQGLKGDQENVHPDVMLVQPRVEFILSFIDHIAGDEDHTD
FT                   GVVACAAGLIGDLCTAFGKDVLKLVEARPMIHELLTEGRRSKTNKAKTLATWATKELRK
FT                   LKNQA"
FT   gene            complement(18904404..18978082)
FT                   /gene="Npepps"
FT                   /locus_tag="mCG_13222"
FT                   /note="gene_id=mCG13222.1"
FT   mRNA            complement(join(18904404..18904739,18909755..18909802,
FT                   18910507..18910662,18911246..18911353,18915278..18915334,
FT                   18915999..18916141,18920442..18920661,18922150..18922284,
FT                   18924220..18924359,18927321..18927384,18929381..18929490,
FT                   18932536..18932596,18933546..18933650,18935575..18935739,
FT                   18938410..18938524,18939285..18939318,18939432..18939528,
FT                   18940084..18940284,18941909..18942016,18945657..18945778,
FT                   18955729..18955806,18965087..18965171,18977720..18978082))
FT                   /gene="Npepps"
FT                   /locus_tag="mCG_13222"
FT                   /product="aminopeptidase puromycin sensitive"
FT                   /note="gene_id=mCG13222.1 transcript_id=mCT12410.1 created
FT                   on 19-AUG-2002"
FT   CDS             complement(join(18904587..18904739,18909755..18909802,
FT                   18910507..18910662,18911246..18911353,18915278..18915334,
FT                   18915999..18916141,18920442..18920661,18922150..18922284,
FT                   18924220..18924359,18927321..18927384,18929381..18929490,
FT                   18932536..18932596,18933546..18933650,18935575..18935739,
FT                   18938410..18938524,18939285..18939318,18939432..18939528,
FT                   18940084..18940284,18941909..18942016,18945657..18945778,
FT                   18955729..18955806,18965087..18965171,18977720..18977977))
FT                   /codon_start=1
FT                   /gene="Npepps"
FT                   /locus_tag="mCG_13222"
FT                   /product="aminopeptidase puromycin sensitive"
FT                   /note="gene_id=mCG13222.1 transcript_id=mCT12410.1
FT                   protein_id=mCP23449.1"
FT                   /db_xref="GOA:Q11011"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="MGI:MGI:1101358"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q11011"
FT                   /protein_id="EDL16075.1"
FT                   /translation="MWLAAAVPSLARRLLLLGPPPPPLLLLLSRSSRRRRRLHSLGLAA
FT                   MPEKRPFERLPAEVSPINYSLCLKPDLLDFTFEGKLEAAAQVRQATNQIVMNCADIDII
FT                   TASYAPEGDEEIHATGFNYQNEDEKVTLSFPSTLQTGTGTLKIDFVGELNDKMKGFYRS
FT                   RYTTPAGEVRYAAVTQFEATDARRAFPCWDEPAIKATFDISLVVPKDRVALSNMNVIDR
FT                   KPYPDDENLVEVKFARTPVMSTYLVAFVVGEYDFVETRSKDGVCVRVYTPVGKAEQGKF
FT                   ALEVAAKTLPFYKDYFNVPYPLPKIDLIAIADFAAGAMENWGLVTYRETALLIDPKNSC
FT                   SSSRQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEYDIWTQ
FT                   FVSADYTRAQELDALDNSHPIEVSVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDKDF
FT                   KKGMNMYLTKFQQKNAATEDLWESLESASGKPIAAVMNTWTKQMGFPLIYVEAEQVEDD
FT                   RVLKLSQKKFCASGPYGGEDCPQWMVPITISTSEDPNQAKLKILMDKPEMSVVLKNVKP
FT                   DQWVKLNLGTVGFYRTQYSSAMLESLLPGIRDLSLPPVDRLGLQNDLFSLARAGIISTV
FT                   EVLKVMEAFVNEPNYTVWSDLSCNLGILSTLLSHTDFYEEIQEFVKDVFSPIGERLGWD
FT                   PKPGEGHLDALLRGLVLGKLGKAGHKATLEEARRRFKEHVEGKQILSADLRSPVYLTVL
FT                   KHGDGATLDIMLKLHKQADMQEEKNRIERVLGATLSPELIQKVLTFALSEEVRPQDTVS
FT                   VIGGVAGGSKHGRKAAWKFIKDNWEELHNRYQGGFLISRLIKLSVEGFAVDKMAGEVKA
FT                   FFESHPAPSAERTIQQCCENILLNAAWLKRDADSIHQYLLQRKTSPPSV"
FT   gene            19012980..19026031
FT                   /gene="Mrpl45"
FT                   /locus_tag="mCG_13230"
FT                   /note="gene_id=mCG13230.1"
FT   mRNA            join(19012980..19013073,19013881..19014058,
FT                   19018557..19018674,19020965..19021063,19022640..19022688,
FT                   19023707..19023856,19025011..19025184,19025407..19026031)
FT                   /gene="Mrpl45"
FT                   /locus_tag="mCG_13230"
FT                   /product="mitochondrial ribosomal protein L45"
FT                   /note="gene_id=mCG13230.1 transcript_id=mCT12734.1 created
FT                   on 19-AUG-2002"
FT   CDS             join(19013008..19013073,19013881..19014058,
FT                   19018557..19018674,19020965..19021063,19022640..19022688,
FT                   19023707..19023856,19025011..19025184,19025407..19025493)
FT                   /codon_start=1
FT                   /gene="Mrpl45"
FT                   /locus_tag="mCG_13230"
FT                   /product="mitochondrial ribosomal protein L45"
FT                   /note="gene_id=mCG13230.1 transcript_id=mCT12734.1
FT                   protein_id=mCP23608.2"
FT                   /protein_id="EDL16076.1"
FT                   /translation="MAAPVPRGLSSLYRTLGWWSRQPILVTQSTTVVQVKTKSRFRPPT
FT                   PEPKYKTEKEFLEYARKAGLVIPQERLERPIHLACTAGIFDPYVPPEGDARMSSLSKEG
FT                   LTQRTERLRKNAASQLAIRKIREFDANFKTKDFPEKAKDIFIEAHLCLNNSDHDRLHTL
FT                   VTEHCFPDMVWDLKYKTVRWGFVESLEPAQVVHVRCSGLVNQSNMYGQVTVRLHTRQTL
FT                   AIYDRFGRLMYGQEDVPKDVLEYVVFERHLMNPYGSWRMHAKIVPAWAPPKQPILKTLM
FT                   IPGPQLKPWEEYEETQGEAQKPQLA"
FT   gene            complement(19046385..19049028)
FT                   /locus_tag="mCG_122609"
FT                   /note="gene_id=mCG122609.1"
FT   mRNA            complement(join(19046385..19046756,19048178..19049028))
FT                   /locus_tag="mCG_122609"
FT                   /product="mCG122609"
FT                   /note="gene_id=mCG122609.1 transcript_id=mCT123831.1
FT                   created on 30-OCT-2002"
FT   CDS             complement(join(19046549..19046756,19048178..19048971))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122609"
FT                   /product="mCG122609"
FT                   /note="gene_id=mCG122609.1 transcript_id=mCT123831.1
FT                   protein_id=mCP85153.1"
FT                   /db_xref="GOA:Q8BFV4"
FT                   /db_xref="MGI:MGI:2443409"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BFV4"
FT                   /protein_id="EDL16077.1"
FT                   /translation="MGARAVVISSLAWGLLSCCFLCSGALGSQRPLRSLPPLPSQAKPR
FT                   SEPMWMPPKGAEAALAFLYSGDVQRLSGANCSEKYEVRGAEGKAGVPPVLQRAAGTLAQ
FT                   AANFLNMLLQANDIRESSVEEDVEWYQALVRSVAEGDPKAYRALLTFNPAPGASHLQLA
FT                   LQATRMGDETVLQDLSGNKVQEETPGEDLDRPVLQKRVLTNDLRSLDSPKWPRGDGYVG
FT                   DIQQVKLSPPFLECHEGQLRPGWLVTVSATFYGLKPDLTPEVRGQVQMDIDLQSVDINQ
FT                   CASGPGWYSNTHLCDLNSTQARRMAPPSPAFIPLSYHCQSHPDLSGLQGSTK"
FT   gene            19059567..19090811
FT                   /gene="Socs7"
FT                   /locus_tag="mCG_13221"
FT                   /note="gene_id=mCG13221.2"
FT   mRNA            join(19059567..19060077,19069721..19069785,
FT                   19073092..19073196,19073652..19073753,19074591..19074721,
FT                   19075198..19075366,19079525..19079653,19085737..19085872,
FT                   19086191..19086341,19090014..19090811)
FT                   /gene="Socs7"
FT                   /locus_tag="mCG_13221"
FT                   /product="suppressor of cytokine signaling 7"
FT                   /note="gene_id=mCG13221.2 transcript_id=mCT12997.2 created
FT                   on 31-DEC-2002"
FT   CDS             join(19073696..19073753,19074591..19074721,
FT                   19075198..19075366,19079525..19079653,19085737..19085872,
FT                   19086191..19086311)
FT                   /codon_start=1
FT                   /gene="Socs7"
FT                   /locus_tag="mCG_13221"
FT                   /product="suppressor of cytokine signaling 7"
FT                   /note="gene_id=mCG13221.2 transcript_id=mCT12997.2
FT                   protein_id=mCP23477.2"
FT                   /protein_id="EDL16078.1"
FT                   /translation="MGSSLQSFPLPPPPPPHAPDAFPRIAPIRASESLHSQPPQHLQCP
FT                   LYRPDSSSFAASLRELEKCGWYWGPMNWEDAEMKLKGKPDGSFLVRDSSDPRYILSLSF
FT                   RSQGITHHTRMEHYRGTFSLWCHPKFEDRCQSVVEFIKRAIMHSKNGKFLYFLRSRVPG
FT                   LPPTPVQLLYPVSRFSNVKSLQHLCRFRIRQLVRIDHIPDLPLPKPLISYIRKFYYYDP
FT                   QEEVYLSLKEAQLISKQKQEVEPST"
FT   gene            19186802..19199057
FT                   /gene="Arhgap23"
FT                   /locus_tag="mCG_13236"
FT                   /note="gene_id=mCG13236.1"
FT   mRNA            join(19186802..19186842,19187808..19187904,
FT                   19188318..19188340,19189725..19189756,19196766..19199057)
FT                   /gene="Arhgap23"
FT                   /locus_tag="mCG_13236"
FT                   /product="Rho GTPase activating protein 23, transcript
FT                   variant mCT11078"
FT                   /note="gene_id=mCG13236.1 transcript_id=mCT11078.1 created
FT                   on 19-AUG-2002"
FT   gene            complement(19187457..>19196998)
FT                   /locus_tag="mCG_146189"
FT                   /note="gene_id=mCG146189.0"
FT   mRNA            complement(join(19187457..19187811,19189272..19190088,
FT                   19196745..>19196998))
FT                   /locus_tag="mCG_146189"
FT                   /product="mCG146189"
FT                   /note="gene_id=mCG146189.0 transcript_id=mCT186292.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(19187683..19187811,19189272..>19189562))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146189"
FT                   /product="mCG146189"
FT                   /note="gene_id=mCG146189.0 transcript_id=mCT186292.0
FT                   protein_id=mCP107520.0"
FT                   /protein_id="EDL16081.1"
FT                   /translation="RQEVTSGCGPLSLHLPRVKDKGGFFSTSGSSSPNPPAPMTLKHWR
FT                   ENASFGCSPQKPQWGDTAHHRYSEEMETTQCRRRCVPHSHPTRRKRAPLSYQGSASRGR
FT                   RQSPRSLAPPGLSRSGSLMTGLMSSMSGALSVGMP"
FT   mRNA            join(<19187817..19187904,19189725..19189756,
FT                   19196766..19199057)
FT                   /gene="Arhgap23"
FT                   /locus_tag="mCG_13236"
FT                   /product="Rho GTPase activating protein 23, transcript
FT                   variant mCT191000"
FT                   /note="gene_id=mCG13236.1 transcript_id=mCT191000.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<19187817..19187904,19189725..19189756,
FT                   19196766..19197782)
FT                   /codon_start=1
FT                   /gene="Arhgap23"
FT                   /locus_tag="mCG_13236"
FT                   /product="Rho GTPase activating protein 23, isoform CRA_b"
FT                   /note="gene_id=mCG13236.1 transcript_id=mCT191000.0
FT                   protein_id=mCP111964.0 isoform=CRA_b"
FT                   /protein_id="EDL16080.1"
FT                   /translation="DDKEPQSVPNIEYLLPNIGRTVPPSDPGSDSTTCSSAKSKGSWVP
FT                   KKEPYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKAAVGTQEPPEGQLP
FT                   GPAAEEAPGRLSPPTAPDERPAADTRSIVSGYSTLSTMDRSVCSGTGGRRAGAGDEADD
FT                   ERSELSHVETDTEGGAGPGGRLSRRPSFSSHHLMPCDTLARRRLSRSRAEAEGPGAGTA
FT                   RACPRGPEPPGSASSSSQESLRPPAAAPALGSRPSRVEALRLRLRGTADDMLAVRLRRP
FT                   LSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPQESVGVRPHSDNKDSGLSSL
FT                   ESTKARASSAASLPSGDLGALQGLPQRRSAAARLHQCL"
FT   CDS             19196805..19197782
FT                   /codon_start=1
FT                   /gene="Arhgap23"
FT                   /locus_tag="mCG_13236"
FT                   /product="Rho GTPase activating protein 23, isoform CRA_a"
FT                   /note="gene_id=mCG13236.1 transcript_id=mCT11078.1
FT                   protein_id=mCP23393.2 isoform=CRA_a"
FT                   /protein_id="EDL16079.1"
FT                   /translation="MLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKAAVGTQEP
FT                   PEGQLPGPAAEEAPGRLSPPTAPDERPAADTRSIVSGYSTLSTMDRSVCSGTGGRRAGA
FT                   GDEADDERSELSHVETDTEGGAGPGGRLSRRPSFSSHHLMPCDTLARRRLSRSRAEAEG
FT                   PGAGTARACPRGPEPPGSASSSSQESLRPPAAAPALGSRPSRVEALRLRLRGTADDMLA
FT                   VRLRRPLSPETRRRRSSWRRHTVVVQSPLTDLNFNEWKELGGGGPQESVGVRPHSDNKD
FT                   SGLSSLESTKARASSAASLPSGDLGALQGLPQRRSAAARLHQCL"
FT   gene            complement(19206364..19208504)
FT                   /locus_tag="mCG_1031965"
FT                   /note="gene_id=mCG1031965.1"
FT   mRNA            complement(join(19206364..19207528,19207549..19208504))
FT                   /locus_tag="mCG_1031965"
FT                   /product="mCG1031965"
FT                   /note="gene_id=mCG1031965.1 transcript_id=mCT149669.1
FT                   created on 13-JUN-2003"
FT   CDS             complement(19206640..19206999)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1031965"
FT                   /product="mCG1031965"
FT                   /note="gene_id=mCG1031965.1 transcript_id=mCT149669.1
FT                   protein_id=mCP85168.1"
FT                   /protein_id="EDL16082.1"
FT                   /translation="MVVCRCRQACERVSVCESTRVHVCVPSSLHHSPGTPPKLPTPPVF
FT                   SKPTARQSPPPPPAACASPLSISVCLTRETATSGDPVPGPLTPARCAVILAWGVLSGPF
FT                   HNILFSPGASGKGSE"
FT   gene            complement(19208707..>19272742)
FT                   /gene="P140"
FT                   /locus_tag="mCG_122593"
FT                   /note="gene_id=mCG122593.0"
FT   mRNA            complement(join(19208707..19209686,19215714..19215860,
FT                   19220195..19220347,19220562..19220716,19222446..19222680,
FT                   19223113..19223359,19223634..19223781,19223887..19224007,
FT                   19228909..19229084,19230703..19230746,19230990..19231082,
FT                   19231752..19232614,19233055..19233148,19233630..19233828,
FT                   19234366..19234561,19239856..19239879,19246381..19246479,
FT                   19249178..19249481,19272718..>19272742))
FT                   /gene="P140"
FT                   /locus_tag="mCG_122593"
FT                   /product="P140 gene"
FT                   /note="gene_id=mCG122593.0 transcript_id=mCT123815.1
FT                   created on 19-AUG-2002"
FT   CDS             complement(join(19209552..19209686,19215714..19215860,
FT                   19220195..19220347,19220562..19220716,19222446..19222680,
FT                   19223113..19223359,19223634..19223781,19223887..19224007,
FT                   19228909..19229084,19230703..19230746,19230990..19231082,
FT                   19231752..19232614,19233055..19233148,19233630..19233828,
FT                   19234366..19234561,19239856..19239879,19246381..19246479,
FT                   19249178..>19249480))
FT                   /codon_start=1
FT                   /gene="P140"
FT                   /locus_tag="mCG_122593"
FT                   /product="P140 gene"
FT                   /note="gene_id=mCG122593.0 transcript_id=mCT123815.1
FT                   protein_id=mCP85342.1"
FT                   /protein_id="EDL16083.1"
FT                   /translation="DPERSSPPMLSADDAEYPREYRTLGGGGGGGSGGRRFSNVGLVHT
FT                   SERRHTVIAAQSLEALSGLQKADADRKRDAFMDHLKSKYPQHALALRGQQDRMREQVGG
FT                   WTVDPVCLLSSLCSHLHGDSTPSGAGQPAQQPNYWSFKTRSSRHTQGAQPGLADQAAKL
FT                   SYASAESLETMSEAELPLGFSRMN