
ID   CH466556; SV 1; linear; genomic DNA; CON; MUS; 21022780 BP.
AC   CH466556;
PR   Project:PRJNA11785;
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
DE   Mus musculus 232000009775581 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-21022780
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-21022780
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; b0ff4a4550f5820a1975638d952a6e33.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000219.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000093; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000094; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000204; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000982; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001123; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001440; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001441; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001444; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001510; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002058; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002580; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007877; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009185; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013418; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014351; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017221; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017344; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017404; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017421; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017428; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017499; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017607; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018160; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018167; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018168; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018381; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018547; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018659; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018666; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018841; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018844; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018930; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018986; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019122; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020485; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020492; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020495; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020516; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020677; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020696; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020702; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020704; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020707; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020709; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020829; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020857; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020875; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020882; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023723; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035042; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035373; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035385; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038067; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038366; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038517; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038615; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038811; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038909; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038967; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038994; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039084; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041958; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045140; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046719; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046755; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048616; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048895; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049612; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051232; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051748; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056008; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056158; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056648; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058756; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069744; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000072620; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078134; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078763; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078771; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000081906; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018776; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018777; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018778; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018780; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018784; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018792; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018794; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018797; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018800; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018807; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018808; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018812; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018814; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018818; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018821; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018822; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018825; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018828; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018830; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018831; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018832; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018833; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018839; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018840; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018852; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018853; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018855; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018856; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018857; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018860; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018863; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018870; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018874; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018883; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018885; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018890; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018896; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018898; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018900; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018903; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018906; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018910; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018922; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018932; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018942; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018946; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018962; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018967; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018972; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018975; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018977; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018980; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018984; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018990; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018991; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018992; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018994; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018997; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019001; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019002; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019012; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019013; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019019; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019024; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019025; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019027; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019037; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019038; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019042; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019045; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019047; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019051; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019053; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019055; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019056; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019057; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019060; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019061; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019062; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019064; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019068; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019069; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019074; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019077; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019082; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0019083; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018742; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018743; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018744; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018746; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018750; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018759; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018761; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018764; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018767; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018774; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018775; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018779; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018781; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018785; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018788; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018789; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018792; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018795; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018797; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018798; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018799; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018800; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018806; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018807; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018809; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018819; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018820; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018822; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018823; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018824; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018827; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018830; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018837; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018841; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018850; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018852; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018857; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018863; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018865; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018867; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018870; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018873; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018877; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018890; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018900; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018910; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018914; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018930; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018935; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018940; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018943; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018945; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018948; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018952; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018958; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018959; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018960; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018962; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018965; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018969; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018970; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018981; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018987; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018992; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018993; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018995; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019005; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019006; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019010; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019013; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019015; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019019; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019021; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019023; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019024; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019025; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019028; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019029; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019030; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019032; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019036; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019037; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019042; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019043; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019045; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019050; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019051; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0024099; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018712; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018713; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018714; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018716; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018720; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018729; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018731; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018734; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018737; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018744; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018745; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018749; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018751; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018755; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018758; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018759; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018762; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018765; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018767; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018768; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018769; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018770; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018776; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018777; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018779; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018789; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018790; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018792; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018793; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018794; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018797; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018800; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018807; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018811; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018820; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018822; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018827; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018833; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018835; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018840; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018843; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018847; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018860; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018870; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018880; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018884; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018900; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018905; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018910; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018913; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018915; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018918; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018922; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018928; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018929; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018930; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018932; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018935; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018939; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018940; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018950; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018951; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018957; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018962; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018963; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018964; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018965; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018975; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018976; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018980; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018983; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018985; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018986; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018989; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018991; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018993; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018994; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018995; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0018998; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019000; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019002; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019006; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019007; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019012; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019013; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019015; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019021; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018716; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018717; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018718; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018720; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018724; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018732; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018734; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018737; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018740; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018747; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018748; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018752; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018754; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018758; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018761; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018762; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018765; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018768; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018770; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018771; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018772; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018773; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018779; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018780; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018782; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018792; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018793; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018795; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018796; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018797; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018800; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018803; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018810; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018814; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018823; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018825; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018830; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018836; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018838; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018840; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018843; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018846; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018850; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018863; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018873; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018883; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018887; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018903; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018908; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018913; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018916; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018918; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018921; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018925; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018931; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018932; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018933; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018935; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018938; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018942; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018943; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018953; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018954; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018960; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018965; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018966; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018968; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018978; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018979; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018983; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018986; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018988; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018992; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018994; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018996; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018997; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018998; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019001; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019003; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019005; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019006; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019010; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019011; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019016; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019017; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019019; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019024; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019025; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018529; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018530; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018531; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018533; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018537; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018546; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018548; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018551; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018554; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018561; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018562; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018566; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018568; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018572; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018575; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018576; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018579; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018582; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018584; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018585; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018586; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018587; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018593; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018594; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018596; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018606; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018607; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018609; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018610; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018611; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018614; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018617; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018624; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018628; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018637; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018639; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018644; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018650; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018652; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018654; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018657; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018660; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018664; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018677; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018687; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018697; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018701; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018717; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018722; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018727; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018730; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018732; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018735; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018739; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018745; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018746; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018747; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018749; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018752; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018756; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018757; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018767; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018768; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018774; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018779; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018780; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018781; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018782; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018792; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018793; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018797; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018800; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018802; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018806; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018808; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018810; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018811; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018812; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018815; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018816; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018817; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018819; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018823; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018824; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018829; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018830; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018832; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018837; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018838; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019167; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019168; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019169; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019171; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019175; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019184; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019186; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019189; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019192; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019199; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019200; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019204; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019206; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019210; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019213; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019214; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019217; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019220; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019222; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019223; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019224; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019225; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019231; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019232; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019234; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019244; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019245; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019247; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019248; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019249; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019252; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019255; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019262; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019266; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019275; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019277; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019282; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019288; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019290; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019292; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019295; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019298; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019302; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019315; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019325; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019335; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019339; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019355; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019360; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019365; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019368; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019370; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019373; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019377; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019384; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019385; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019390; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019394; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019395; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019405; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019406; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019412; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019417; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019418; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019419; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019420; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019431; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019432; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019436; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019439; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019441; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019442; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019445; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019447; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019449; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019450; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019451; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019454; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019455; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019456; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019458; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019461; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019462; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019467; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019468; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019470; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019475; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019476; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018083; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018084; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018085; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018087; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018089; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018091; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018101; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018106; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018109; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018116; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018117; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018121; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018123; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018127; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018130; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018131; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018134; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018135; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018137; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018139; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018140; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018141; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018142; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018148; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018149; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018161; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018162; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018164; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018165; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018166; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018169; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018172; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018179; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018183; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018192; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018194; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018199; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018207; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018209; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018212; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018215; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018219; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018232; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018242; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018252; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018256; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018272; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018277; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018281; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018284; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018286; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018289; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018293; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018300; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018301; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018303; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018306; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018309; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018310; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018320; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018321; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018327; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018332; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018333; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018334; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018346; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018347; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018351; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018354; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018356; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018360; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018362; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018364; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018365; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018366; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018369; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018370; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018371; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018373; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018377; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018378; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018383; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018384; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018386; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018391; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0018392; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021144; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018499; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018500; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018501; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018504; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018508; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018517; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018519; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018522; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018525; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018532; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018533; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018537; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018539; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018543; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018546; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018547; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018550; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018553; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018555; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018556; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018557; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018558; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018564; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018565; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018567; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018577; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018578; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018580; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018581; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018582; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018585; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018588; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018595; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018599; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018608; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018610; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018615; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018621; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018623; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018625; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018628; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018631; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018635; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018648; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018658; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018668; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018672; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018688; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018693; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018698; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018701; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018703; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018706; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018710; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018716; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018717; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018718; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018720; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018723; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018727; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018728; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018738; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018739; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018745; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018750; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018751; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018752; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018753; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018763; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018764; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018768; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018771; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018773; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018777; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018779; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018781; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018782; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018783; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018786; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018787; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018788; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018790; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018794; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018795; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018800; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018801; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018803; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018808; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0018809; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018608; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018609; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018610; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018612; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018616; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018625; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018627; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018630; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018633; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018640; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018641; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018645; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018647; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018651; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018654; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018655; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018658; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018661; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018663; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018664; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018666; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018672; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018673; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018675; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018685; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018686; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018688; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018689; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018690; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018693; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018696; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018703; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018707; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018716; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018718; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018723; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018729; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018731; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018733; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018736; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018739; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018743; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018756; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018766; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018776; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018780; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018796; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018801; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018806; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018809; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018811; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018814; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018818; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018824; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018825; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018826; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018828; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018831; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018835; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018836; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018846; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018847; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018853; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018858; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018859; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018861; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018871; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018872; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018876; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018879; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018881; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018885; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018887; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018889; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018890; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018891; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018894; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018895; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018896; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018898; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018902; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018903; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018908; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018911; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018916; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0018917; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018598; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018599; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018600; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018602; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018606; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018614; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018616; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018619; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018622; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018629; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018630; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018634; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018636; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018640; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018643; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018644; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018647; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018650; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018652; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018653; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018654; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018655; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018661; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018662; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018664; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018674; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018675; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018677; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018678; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018679; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018682; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018685; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018692; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018696; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018705; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018707; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018712; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018718; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018720; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018722; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018725; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018728; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018732; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018745; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018755; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018765; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018769; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018785; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018790; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018795; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018798; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018800; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018803; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018807; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018813; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018814; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018815; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018817; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018820; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018824; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018825; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018835; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018836; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018842; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018847; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018848; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018849; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018850; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018860; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018861; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018865; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018868; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018870; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018871; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018874; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018876; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018878; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018879; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018880; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018883; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018884; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018885; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018887; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018891; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018892; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018897; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018898; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018900; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018905; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0018906; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018679; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018680; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018681; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018683; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018687; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018695; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018697; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018700; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018703; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018710; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018711; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018715; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018717; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018721; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018724; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018725; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018728; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018731; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018733; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018734; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018735; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018736; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018742; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018743; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018745; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018755; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018756; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018758; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018759; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018760; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018763; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018766; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018773; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018777; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018786; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018788; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018793; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018799; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018801; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018803; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018806; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018809; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018813; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018826; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018836; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018846; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018850; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018866; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018871; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018876; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018879; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018881; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018884; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018888; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018894; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018895; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018896; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018898; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018901; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018905; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018906; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018916; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018917; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018923; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018928; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018929; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018930; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018931; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018941; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018942; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018946; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018949; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018951; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018952; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018955; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018957; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018959; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018960; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018961; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018964; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018965; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018966; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018972; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018973; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018978; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018979; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018981; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018986; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0018987; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021790; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018624; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018625; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018626; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018628; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018632; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018641; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018643; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018646; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018649; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018656; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018657; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018661; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018663; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018667; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018670; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018671; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018674; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018677; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018679; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018680; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018681; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018682; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018688; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018689; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018701; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018702; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018704; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018705; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018706; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018709; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018712; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018719; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018723; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018732; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018734; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018739; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018745; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018747; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018749; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018752; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018755; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018759; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018772; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018782; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018792; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018796; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018812; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018817; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018822; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018825; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018827; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018830; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018834; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018840; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018841; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018842; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018844; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018847; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018851; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018852; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018863; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018869; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018874; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018875; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018877; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018887; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018888; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018892; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018895; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018897; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018898; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018901; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018903; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018905; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018906; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018907; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018910; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018911; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018912; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018914; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018918; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018919; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018924; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018925; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018927; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018932; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018933; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019207; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019208; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019209; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019211; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019215; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019224; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019226; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019229; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019232; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019239; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019240; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019244; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019246; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019250; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019253; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019254; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019257; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019260; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019262; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019263; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019264; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019265; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019271; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019272; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019274; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019284; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019285; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019287; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019288; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019289; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019292; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019295; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019302; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019306; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019315; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019317; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019322; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019328; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019330; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019332; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019335; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019338; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019342; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019355; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019365; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019375; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019379; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019395; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019400; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019405; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019408; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019410; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019413; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019417; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019423; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019424; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019425; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019427; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019430; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019435; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019445; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019446; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019452; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019457; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019458; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019459; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019460; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019471; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019472; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019476; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019479; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019481; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019482; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019485; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019487; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019489; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019490; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019491; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019494; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019495; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019496; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019498; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019501; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019502; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019507; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019508; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019510; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019515; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017854; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017855; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017856; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017858; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017862; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017871; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017876; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017879; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017886; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017887; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017891; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017893; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017897; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017900; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017901; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017904; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017907; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017909; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017910; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017911; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017912; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017918; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017919; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017930; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017931; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017933; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017934; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017935; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017938; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017941; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017948; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017952; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017961; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017963; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017968; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017975; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017977; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017979; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017982; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017985; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017989; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018002; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018012; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018022; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018026; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018042; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018047; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018052; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018055; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018057; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018060; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018064; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018070; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018071; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018072; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018074; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018077; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018081; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018082; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018092; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018093; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018099; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018104; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018105; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018107; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018118; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018119; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018123; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018126; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018128; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018129; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018132; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018134; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018136; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018137; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018138; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018141; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018142; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018143; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018145; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018148; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018149; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018154; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018155; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018157; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018162; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0018163; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018136; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018137; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018138; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018140; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018144; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018153; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018155; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018158; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018161; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018168; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018169; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018173; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018175; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018179; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018182; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018183; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018186; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018189; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018191; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018192; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018193; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018194; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018199; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018200; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018212; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018213; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018215; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018216; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018217; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018220; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018223; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018230; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018234; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018243; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018245; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018250; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018256; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018258; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018260; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018263; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018266; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018270; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018281; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018291; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018301; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018305; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018321; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018326; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018330; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018333; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018335; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018338; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018342; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018348; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018349; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018350; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018352; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018355; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018359; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018360; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018370; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018371; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018377; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018382; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018383; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018385; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018396; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018397; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018401; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018404; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018406; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018407; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018410; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018412; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018414; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018415; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018416; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018419; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018420; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018421; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018423; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018426; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018427; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018432; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018435; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018440; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018441; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000010; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000095; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000193; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001008; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001479; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001480; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001484; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002655; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008021; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009329; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017365; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017384; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017548; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017561; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017572; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017821; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017839; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018544; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018842; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018988; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019130; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020794; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021011; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021033; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021040; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021045; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021050; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035938; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036088; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037994; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038886; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040418; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041301; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041685; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048073; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052566; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052919; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053740; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059026; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061019; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064187; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069852; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070832; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072566; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079702; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080461; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090541; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092735; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092768; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093937; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000093955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100532; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103134; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103139; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103141; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103157; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000104933; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107479; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107565; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107613; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107622; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107629; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107657; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107658; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107708; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107709; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107712; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107714; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107859; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107861; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107962; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108080; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108189; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108269; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108294; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118784; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122067; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141169; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143280; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165565; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169695; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170799; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173938; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178611; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182502; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188489; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215472; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031032; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031033; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031040; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031042; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031056; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031081; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031091; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031104; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031108; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031141; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031143; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031160; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031182; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031190; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031195; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031201; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031209; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031212; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031224; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031228; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031234; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031254; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031255; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031258; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031293; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031295; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031300; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031301; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031302; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031307; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031316; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031349; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031371; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031421; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031423; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031447; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031479; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031481; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031484; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031493; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031503; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031533; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031585; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031617; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031652; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031675; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031755; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031775; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031789; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031797; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031808; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031812; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031839; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031854; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031859; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031866; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031872; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031880; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031890; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031892; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031926; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031931; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031966; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031981; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031982; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0031990; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032042; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032045; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032057; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032078; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032084; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032102; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032114; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032120; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032127; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032128; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032138; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032139; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032145; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032155; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032166; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032171; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032201; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032212; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032238; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0032242; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030969; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0030970; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0030977; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0030979; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0030993; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031020; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031029; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031043; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031047; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031080; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031082; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031100; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031122; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031131; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031136; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031138; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031142; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031150; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031153; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031165; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031169; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031175; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031195; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031196; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031199; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031234; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031236; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031241; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031242; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031243; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031248; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031257; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031291; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031313; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031363; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031365; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031389; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031421; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031423; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031426; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031435; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031445; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031475; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031528; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031561; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031595; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031620; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031701; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031720; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031734; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031742; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031753; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031757; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031784; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031798; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031803; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031810; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031816; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031824; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031830; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031832; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031866; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031871; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031904; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031920; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031921; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031930; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031982; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031985; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0031997; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032019; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032025; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032043; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032055; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032061; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032068; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032069; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032079; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032080; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032086; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032096; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032107; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032112; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032142; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032146; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032153; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032179; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0032183; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0048942; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030950; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0030951; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0030958; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0030960; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0030974; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031002; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031011; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031027; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031031; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031064; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031084; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031107; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031115; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031120; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031122; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031126; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031134; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031137; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031149; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031153; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031159; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031178; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031179; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031182; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031217; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031219; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031224; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031225; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031226; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031231; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031240; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031274; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031296; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031347; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031349; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031373; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031405; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031407; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031419; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031429; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031462; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031515; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031548; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031582; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031607; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031688; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031705; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031719; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031727; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031738; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031742; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031769; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031783; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031788; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031795; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031801; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031809; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031818; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031820; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031853; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031858; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031891; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031906; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031907; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031913; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031916; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031963; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031966; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0031978; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032000; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032006; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032013; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032025; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032038; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032044; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032051; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032052; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032062; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032069; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032079; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032089; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032094; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032124; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032128; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032135; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032161; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0032165; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030963; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030964; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030971; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030973; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030987; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031012; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031021; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031035; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031039; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031071; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031073; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031113; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031121; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031126; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031128; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031132; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031140; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031143; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031155; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031159; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031165; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031185; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031186; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031189; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031224; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031226; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031231; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031232; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031233; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031238; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031247; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031281; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031303; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031352; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031354; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031378; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031410; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031412; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031415; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031424; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031435; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031465; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031518; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031551; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031585; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031609; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031690; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031709; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031723; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031731; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031742; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031746; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031773; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031787; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031792; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031799; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031805; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031813; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031822; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031824; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031858; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031863; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031898; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031913; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031914; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031922; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031974; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031977; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0031989; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032011; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032017; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032035; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032047; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032053; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032060; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032061; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032071; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032078; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032088; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032089; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032098; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032103; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032133; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032137; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032144; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032170; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0032174; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030757; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030758; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030765; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030767; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030781; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030809; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030819; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030835; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030839; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030871; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030873; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030891; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030912; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030920; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030925; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030927; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030931; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030939; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030942; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030954; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030958; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030964; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030983; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030984; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030987; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031022; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031024; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031029; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031030; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031031; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031036; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031045; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031079; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031101; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031150; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031152; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031176; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031208; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031210; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031213; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031222; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031233; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031266; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031319; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031351; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031386; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031411; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031508; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031520; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031528; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031539; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031543; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031570; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031584; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031589; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031596; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031602; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031610; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031619; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031621; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031655; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031660; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031693; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031708; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031709; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031715; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031718; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031770; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031773; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031785; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031807; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031812; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031830; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031842; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031848; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031855; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031856; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031866; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031867; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031873; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031883; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031894; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031899; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031930; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031934; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031941; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031967; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0031971; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031472; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031473; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031480; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031482; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031496; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031522; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031531; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031547; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031551; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031583; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031585; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031603; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031626; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031634; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031639; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031641; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031645; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031653; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031656; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031668; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031672; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031678; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031703; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031704; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031707; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031742; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031744; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031749; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031750; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031751; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031756; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031765; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031801; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031824; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031874; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031876; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031900; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031932; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031934; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031937; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031946; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031956; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031986; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032040; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032073; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032106; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032129; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032209; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032229; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032243; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032251; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032262; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032266; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032293; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032311; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032318; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032332; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032340; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032342; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032376; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032381; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032416; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032431; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032432; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032437; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032440; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032490; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032493; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032505; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032526; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032531; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032538; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032562; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032568; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032575; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032576; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032586; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032587; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032593; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032603; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032612; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032617; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032647; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032651; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032658; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032684; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0032688; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030490; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030491; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030498; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030501; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030509; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030516; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030546; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030573; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030577; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030613; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030615; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030633; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030655; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030664; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030669; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030671; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030675; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030676; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030685; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030689; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030704; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030708; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030714; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030736; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030737; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030775; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030777; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030782; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030783; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030784; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030789; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030798; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030835; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030856; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030906; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030908; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030931; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030966; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030969; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030981; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030991; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031027; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031078; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031121; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031157; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031182; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031269; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031288; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031300; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031308; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031321; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031326; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031354; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031373; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031380; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031386; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031394; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031402; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031404; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031438; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031443; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031478; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031494; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031495; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031500; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031561; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031565; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031578; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031599; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031606; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031627; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031639; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031645; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031652; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031653; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031663; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031664; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031670; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031679; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031690; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031696; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031728; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031732; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031740; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031765; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0031769; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040797; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0030667; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030668; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030675; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030678; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030692; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030720; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030729; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030745; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030749; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030783; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030785; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030803; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030825; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030833; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030838; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030840; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030844; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030852; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030855; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030867; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030871; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030877; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030896; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030897; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030900; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030935; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030937; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030942; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030943; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030944; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030949; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030958; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0030993; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031015; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031064; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031066; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031090; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031122; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031124; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031127; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031136; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031146; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031179; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031232; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031264; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031323; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031404; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031423; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031443; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031454; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031458; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031485; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031499; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031504; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031511; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031517; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031525; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031534; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031536; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031575; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031608; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031623; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031624; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031629; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031632; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031683; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031686; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031698; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031720; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031726; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031744; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031756; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031762; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031769; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031770; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031780; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031781; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031787; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031797; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031808; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031813; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031843; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031847; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031854; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031880; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0031884; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0030806; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030807; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030814; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030816; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030830; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030858; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030868; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030884; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030888; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030921; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030923; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030940; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030962; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030970; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030975; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030977; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030981; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0030992; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031004; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031008; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031014; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031033; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031034; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031037; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031072; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031074; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031079; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031080; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031081; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031086; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031095; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031129; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031151; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031201; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031203; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031227; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031259; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031261; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031264; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031273; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031283; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031316; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031369; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031401; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031436; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031461; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031541; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031560; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031574; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031582; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031593; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031597; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031624; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031638; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031643; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031650; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031656; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031664; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031673; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031675; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031709; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031713; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031748; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031763; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031764; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031772; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031824; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031827; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031840; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031862; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031867; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031885; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031897; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031903; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031910; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031911; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031921; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031922; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031928; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031938; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031949; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031954; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031984; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0031995; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032021; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0032025; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0030806; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030807; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030814; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030816; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030830; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030856; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030865; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030879; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030883; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030915; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030917; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030935; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030957; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030965; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030970; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030972; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030976; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030984; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030987; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0030999; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031003; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031009; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031029; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031030; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031033; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031068; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031070; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031075; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031076; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031077; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031082; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031126; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031148; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031197; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031199; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031223; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031256; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031258; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031261; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031270; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031280; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031311; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031365; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031397; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031432; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031456; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031536; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031552; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031566; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031574; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031585; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031589; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031616; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031630; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031635; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031642; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031648; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031656; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031665; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031667; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031701; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031706; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031741; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031757; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031758; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031764; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031766; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031814; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031817; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031829; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031851; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031857; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031864; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031875; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031889; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031895; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031902; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031903; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031913; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031914; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031920; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031930; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031940; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031945; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031975; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031979; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0031986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032012; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0032016; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030931; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0030932; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0030939; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0030941; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0030955; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0030982; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0030991; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031006; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031010; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031043; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031045; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031063; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031085; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031094; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031099; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031101; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031105; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031113; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031116; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031128; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031132; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031138; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031157; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031158; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031161; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031196; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031198; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031203; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031204; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031205; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031210; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031220; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031255; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031277; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031326; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031328; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031352; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031384; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031386; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031389; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031398; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031408; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031438; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031491; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031523; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031557; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031580; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031660; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031680; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031694; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031702; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031713; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031717; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031744; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031763; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031770; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031776; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031784; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031793; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031795; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031829; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031834; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031867; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031882; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031883; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031888; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031890; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031941; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031944; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031956; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031977; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031983; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0031990; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032002; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032014; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032020; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032027; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032028; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032038; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032039; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032045; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032055; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032066; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032071; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032101; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032105; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032112; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032138; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0032142; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0040873; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030788; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030789; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030796; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030798; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030812; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030839; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030848; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030862; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030866; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030899; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030918; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030941; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030949; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030954; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030956; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030960; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030968; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030971; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030983; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030987; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030993; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031013; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031014; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031051; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031053; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031058; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031059; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031060; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031065; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031074; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031110; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031132; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031181; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031183; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031207; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031239; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031241; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031244; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031253; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031264; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031295; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031348; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031378; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031413; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031435; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031516; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031535; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031549; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031557; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031568; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031572; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031599; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031613; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031618; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031625; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031631; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031639; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031648; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031650; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031685; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031690; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031725; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031740; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031741; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031749; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031801; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031804; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031816; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031838; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031844; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031851; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031863; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031875; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031881; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031888; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031889; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031900; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031901; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031907; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031917; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031927; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031932; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031962; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031966; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031973; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0031999; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0032003; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031495; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031496; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031503; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031505; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031519; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031547; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031556; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031570; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031606; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031608; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031625; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031648; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031656; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031661; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031663; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031667; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031675; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031678; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031690; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031694; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031700; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031720; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031721; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031724; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031759; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031761; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031766; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031767; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031768; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031773; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031782; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031817; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031839; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031890; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031892; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031916; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031948; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031950; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031953; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031962; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031973; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032003; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032054; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032084; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032119; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032145; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032228; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032248; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032262; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032270; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032281; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032312; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032327; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032332; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032339; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032345; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032354; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032362; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032364; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032398; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032403; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032438; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032453; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032454; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032459; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032462; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032513; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032516; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032528; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032549; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032555; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032562; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032574; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032586; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032592; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032599; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032600; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032610; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032611; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032617; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032627; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032636; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032641; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032672; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032676; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032683; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032709; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0032713; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030203; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030204; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030211; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030214; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030229; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030260; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030286; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030290; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030328; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030330; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030350; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030373; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030381; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030386; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030388; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030392; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030402; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030405; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030419; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030423; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030429; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030449; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030450; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030486; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030488; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030493; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030494; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030495; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030500; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030510; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030553; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030575; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030628; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030630; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030654; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030687; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030689; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030692; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030703; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030714; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030749; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030801; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030834; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030871; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030895; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0030982; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031002; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031016; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031024; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031037; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031042; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031070; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031085; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031091; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031098; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031104; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031112; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031120; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031122; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031155; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031160; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031198; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031213; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031214; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031222; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031280; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031284; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031297; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031318; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031325; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031332; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031344; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031356; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031365; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031372; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031373; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031383; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031384; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031390; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031400; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031405; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031410; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031441; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031445; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031452; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031478; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0031482; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030245; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030246; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030253; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030255; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030269; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030296; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030305; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030321; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030325; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030358; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030360; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030378; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030400; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030408; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030413; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030415; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030419; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030427; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030430; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030442; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030446; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030452; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030470; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030471; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030510; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030512; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030517; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030518; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030519; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030524; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030533; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030568; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030590; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030637; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030639; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030663; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030695; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030697; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030700; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030709; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030719; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030751; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030801; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030831; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030866; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030891; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030971; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030990; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0030999; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031007; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031018; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031022; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031049; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031063; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031068; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031075; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031081; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031089; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031098; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031100; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031134; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031139; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031174; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031189; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031190; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031199; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031251; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031254; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031266; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031287; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031293; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031300; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031311; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031324; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031330; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031337; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031338; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031348; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031349; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031355; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031365; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031370; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031375; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031403; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031414; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031440; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0031444; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..21022780
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            675..4671
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /note="gene_id=mCG10805.1"
FT   mRNA            join(675..1130,1221..1432,1526..1580,1666..1826,1946..2029,
FT                   2259..2433,2552..2751,2879..4671)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT11955"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT11955.1 created
FT                   on 27-AUG-2002"
FT   mRNA            join(677..1130,1221..1370,2994..3077)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT172617"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172617.0 created
FT                   on 27-AUG-2002"
FT   mRNA            join(943..1130,1221..1432,1526..1580,1666..1749,2369..2433,
FT                   2552..2734)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT172619"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172619.0 created
FT                   on 27-AUG-2002"
FT   CDS             join(1019..1130,1221..1370,2994..3031)
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_b"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172617.0
FT                   protein_id=mCP95537.0 isoform=CRA_b"
FT                   /protein_id="EDL15561.1"
FT   CDS             join(1019..1130,1221..1432,1526..1580,1666..1826,
FT                   1946..2029,2259..2433,2552..2751,2879..2971)
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_d"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT11955.1
FT                   protein_id=mCP13465.1 isoform=CRA_d"
FT                   /protein_id="EDL15563.1"
FT   CDS             join(1019..1130,1221..1432,1526..1580,1666..1749,
FT                   2369..2433,2552..2557)
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_e"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172619.0
FT                   protein_id=mCP95536.0 isoform=CRA_e"
FT                   /protein_id="EDL15564.1"
FT                   SLPCVVLCPQLSQG"
FT   mRNA            join(1400..1432,1526..1580,1666..1721,3081..3375)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT172616"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172616.0 created
FT                   on 27-AUG-2002"
FT   mRNA            join(1666..1826,1946..2029,2259..2433,2552..2751,
FT                   4415..4568)
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, transcript variant
FT                   mCT172618"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172618.0 created
FT                   on 27-AUG-2002"
FT   CDS             join(2331..2433,2552..2751,4415..4426)
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_c"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172618.0
FT                   protein_id=mCP95535.0 isoform=CRA_c"
FT                   /protein_id="EDL15562.1"
FT                   "
FT   CDS             3202..3363
FT                   /codon_start=1
FT                   /gene="Aldoc"
FT                   /locus_tag="mCG_10805"
FT                   /product="aldolase 3, C isoform, isoform CRA_a"
FT                   /note="gene_id=mCG10805.1 transcript_id=mCT172616.0
FT                   protein_id=mCP95538.0 isoform=CRA_a"
FT                   /protein_id="EDL15560.1"
FT                   CSEYIANK"
FT   gene            5064..19627
FT                   /gene="Pigs"
FT                   /locus_tag="mCG_10822"
FT                   /note="gene_id=mCG10822.1"
FT   mRNA            join(5064..5125,5349..5488,5592..5703,9568..9657,
FT                   10285..10376,12045..12252,13306..13448,14407..14521,
FT                   15961..16106,16627..16727,17843..18053,18352..19627)
FT                   /gene="Pigs"
FT                   /locus_tag="mCG_10822"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class S"
FT                   /note="gene_id=mCG10822.1 transcript_id=mCT11972.1 created
FT                   on 01-OCT-2002"
FT   CDS             join(5092..5125,5349..5488,5592..5703,9568..9657,
FT                   10285..10376,12045..12252,13306..13448,14407..14521,
FT                   15961..16106,16627..16727,17843..18053,18352..18627)
FT                   /codon_start=1
FT                   /gene="Pigs"
FT                   /locus_tag="mCG_10822"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class S"
FT                   /note="gene_id=mCG10822.1 transcript_id=mCT11972.1
FT                   protein_id=mCP13486.2"
FT                   /db_xref="GOA:Q3V307"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="MGI:MGI:2687325"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V307"
FT                   /protein_id="EDL15565.1"
FT   gene            20131..25776
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /note="gene_id=mCG10814.1"
FT   mRNA            join(20131..20404,23836..23949,24415..24517,24705..24877,
FT                   25149..25776)
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /product="unc-119 homolog (C. elegans), transcript variant
FT                   mCT11964"
FT                   /note="gene_id=mCG10814.1 transcript_id=mCT11964.1 created
FT                   on 22-JUL-2002"
FT   mRNA            join(20150..20404,23836..23949,24415..24517,24705..24835,
FT                   25149..25776)
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /product="unc-119 homolog (C. elegans), transcript variant
FT                   mCT170947"
FT                   /note="gene_id=mCG10814.1 transcript_id=mCT170947.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(20185..20404,23836..23949,24415..24517,24705..24877,
FT                   25149..25261)
FT                   /codon_start=1
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /product="unc-119 homolog (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG10814.1 transcript_id=mCT11964.1
FT                   protein_id=mCP13419.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V299"
FT                   /db_xref="InterPro:IPR008015"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032977"
FT                   /db_xref="InterPro:IPR037036"
FT                   /db_xref="MGI:MGI:1328357"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V299"
FT                   /protein_id="EDL15566.1"
FT                   DDRLVMHNKADYSYSGTP"
FT   CDS             join(20185..20404,23836..23949,24415..24517,24705..24835,
FT                   25149..25261)
FT                   /codon_start=1
FT                   /gene="Unc119"
FT                   /locus_tag="mCG_10814"
FT                   /product="unc-119 homolog (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG10814.1 transcript_id=mCT170947.0
FT                   protein_id=mCP93865.0 isoform=CRA_b"
FT                   /protein_id="EDL15567.1"
FT                   SGTP"
FT   gene            complement(34906..63176)
FT                   /gene="Foxn1"
FT                   /locus_tag="mCG_10812"
FT                   /note="gene_id=mCG10812.1"
FT   mRNA            complement(join(34906..35688,37395..37886,38044..38251,
FT                   42559..42655,43485..43615,45325..45438,47575..48036,
FT                   48434..48585,63113..63176))
FT                   /gene="Foxn1"
FT                   /locus_tag="mCG_10812"
FT                   /product="forkhead box N1"
FT                   /note="gene_id=mCG10812.1 transcript_id=mCT11962.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(35369..35688,37395..37886,38044..38251,
FT                   42559..42655,43485..43615,45325..45438,47575..48036,
FT                   48434..48556))
FT                   /codon_start=1
FT                   /gene="Foxn1"
FT                   /locus_tag="mCG_10812"
FT                   /product="forkhead box N1"
FT                   /note="gene_id=mCG10812.1 transcript_id=mCT11962.0
FT                   protein_id=mCP13399.1"
FT                   /db_xref="GOA:Q5SYK1"
FT                   /db_xref="InterPro:IPR001766"
FT                   /db_xref="InterPro:IPR030456"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="MGI:MGI:102949"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SYK1"
FT                   /protein_id="EDL15568.1"
FT                   VYLSPGSKPLALA"
FT   gene            <71102..82275
FT                   /locus_tag="mCG_146185"
FT                   /note="gene_id=mCG146185.0"
FT   mRNA            join(<71102..71123,71235..71414,71795..71856,73297..73394,
FT                   79010..82275)
FT                   /locus_tag="mCG_146185"
FT                   /product="mCG146185"
FT                   /note="gene_id=mCG146185.0 transcript_id=mCT186288.0
FT                   created on 14-JUL-2003"
FT   gene            complement(73893..98817)
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /note="gene_id=mCG10810.2"
FT   mRNA            complement(join(73893..74473,74909..75046,75650..75811,
FT                   76702..76823,77094..77182,77362..77580,79690..79812,
FT                   79932..80103,80996..81195,81289..81425,83428..83556,
FT                   98684..98803))
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /product="solute carrier family 13 (sodium-dependent
FT                   dicarboxylate transporter), member 2, transcript variant
FT                   mCT11960"
FT                   /note="gene_id=mCG10810.2 transcript_id=mCT11960.1 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(73924..74473,74909..75046,75650..75811,
FT                   76702..76823,77090..77182,77362..77580,79690..79812,
FT                   79932..79989,83448..83556,98684..98817))
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /product="solute carrier family 13 (sodium-dependent
FT                   dicarboxylate transporter), member 2, transcript variant
FT                   mCT170946"
FT                   /note="gene_id=mCG10810.2 transcript_id=mCT170946.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(74306..74473,74909..75046,75650..75811,
FT                   76702..76823,77094..77182,77362..77580,79690..79812,
FT                   79932..80103,80996..81195,81289..81425,83428..83556,
FT                   98684..98785))
FT                   /codon_start=1
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /product="solute carrier family 13 (sodium-dependent
FT                   dicarboxylate transporter), member 2, isoform CRA_a"
FT                   /note="gene_id=mCG10810.2 transcript_id=mCT11960.1
FT                   protein_id=mCP13501.2 isoform=CRA_a"
FT                   /protein_id="EDL15570.1"
FT                   NPPNSTVPGH"
FT   CDS             complement(join(76763..76823,77090..77182,77362..77580,
FT                   79690..79812,79932..79989,83448..83556,98684..98785))
FT                   /codon_start=1
FT                   /gene="Slc13a2"
FT                   /locus_tag="mCG_10810"
FT                   /product="solute carrier family 13 (sodium-dependent
FT                   dicarboxylate transporter), member 2, isoform CRA_b"
FT                   /note="gene_id=mCG10810.2 transcript_id=mCT170946.0
FT                   protein_id=mCP93864.0 isoform=CRA_b"
FT                   /protein_id="EDL15571.1"
FT   CDS             <80944..81603
FT                   /codon_start=1
FT                   /locus_tag="mCG_146185"
FT                   /product="mCG146185"
FT                   /note="gene_id=mCG146185.0 transcript_id=mCT186288.0
FT                   protein_id=mCP107516.0"
FT                   /protein_id="EDL15569.1"
FT   gene            142287..148555
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /note="gene_id=mCG1602.1"
FT   mRNA            join(142287..142617,142963..143815,145237..145320,
FT                   147307..147463,147983..148555)
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /product="DNA segment, Chr 11, ERATO Doi 18, expressed,
FT                   transcript variant mCT8427"
FT                   /note="gene_id=mCG1602.1 transcript_id=mCT8427.1 created on
FT                   04-MAR-2003"
FT   mRNA            join(142362..142617,145237..145320,147307..147463,
FT                   147983..148234)
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /product="DNA segment, Chr 11, ERATO Doi 18, expressed,
FT                   transcript variant mCT180864"
FT                   /note="gene_id=mCG1602.1 transcript_id=mCT180864.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(142390..142617,142963..143815,145237..145320,
FT                   147307..147463,147983..148040)
FT                   /codon_start=1
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /product="DNA segment, Chr 11, ERATO Doi 18, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG1602.1 transcript_id=mCT8427.1
FT                   protein_id=mCP13499.2 isoform=CRA_b"
FT                   /protein_id="EDL15573.1"
FT                   P"
FT   CDS             join(142390..142617,145237..145305)
FT                   /codon_start=1
FT                   /gene="D11Ertd18e"
FT                   /locus_tag="mCG_1602"
FT                   /product="DNA segment, Chr 11, ERATO Doi 18, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1602.1 transcript_id=mCT180864.0
FT                   protein_id=mCP103786.0 isoform=CRA_a"
FT                   /db_xref="GOA:F6QD87"
FT                   /db_xref="MGI:MGI:1098733"
FT                   /db_xref="UniProtKB/TrEMBL:F6QD87"
FT                   /protein_id="EDL15572.1"
FT   gene            complement(149905..174213)
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /note="gene_id=mCG1598.2"
FT   mRNA            complement(join(149905..151644,151819..151940,
FT                   159767..159956,160044..160146,163833..164068,
FT                   164174..164265,164526..164738,167177..167795,
FT                   173598..174213))
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /product="RIKEN cDNA A830091I15, transcript variant
FT                   mCT8425"
FT                   /note="gene_id=mCG1598.2 transcript_id=mCT8425.2 created on
FT                   01-OCT-2002"
FT   mRNA            complement(join(151497..151644,151819..151940,
FT                   159767..159956,160044..160266,163833..164068,
FT                   164174..164265,164526..164738,167177..167795,
FT                   173598..>174067))
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /product="RIKEN cDNA A830091I15, transcript variant
FT                   mCT191005"
FT                   /note="gene_id=mCG1598.2 transcript_id=mCT191005.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(151515..151644,151819..151940,
FT                   159767..159956,160044..160146,163833..164068,
FT                   164174..164265,164526..164738,167177..167795,
FT                   173598..174067))
FT                   /codon_start=1
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /product="RIKEN cDNA A830091I15, isoform CRA_b"
FT                   /note="gene_id=mCG1598.2 transcript_id=mCT8425.2
FT                   protein_id=mCP13437.2 isoform=CRA_b"
FT                   /protein_id="EDL15575.1"
FT   CDS             complement(join(151515..151644,151819..151940,
FT                   159767..159956,160044..160266,163833..164068,
FT                   164174..164265,164526..164738,167177..167795,
FT                   173598..174067))
FT                   /codon_start=1
FT                   /gene="A830091I15Rik"
FT                   /locus_tag="mCG_1598"
FT                   /product="RIKEN cDNA A830091I15, isoform CRA_a"
FT                   /note="gene_id=mCG1598.2 transcript_id=mCT191005.0
FT                   protein_id=mCP111973.0 isoform=CRA_a"
FT                   /protein_id="EDL15574.1"
FT                   SLEGATPMGLP"
FT   gene            152495..218329
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /note="gene_id=mCG1603.2"
FT   mRNA            join(152495..152540,213053..213185,215443..215571,
FT                   216569..216654,217504..217607,217970..218329)
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), transcript variant mCT8429"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT8429.2 created on
FT                   22-JUL-2002"
FT   mRNA            join(152495..152540,213085..213185,215119..215347,
FT                   215443..215571,216569..216654,217504..217607,
FT                   217970..218329)
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), transcript variant mCT170953"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170953.0 created
FT                   on 22-JUL-2002"
FT   mRNA            join(152495..152540,213109..213185,215443..215571,
FT                   216569..216654,217504..217811)
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), transcript variant mCT170954"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170954.0 created
FT                   on 22-JUL-2002"
FT   gene            175895..178932
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /note="gene_id=mCG1595.1"
FT   mRNA            join(175895..176022,176112..176231,176310..176651,
FT                   176731..176870,177038..177194,177304..177456,
FT                   178183..178533,178747..178932)
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, transcript variant mCT8421"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT8421.1 created on
FT                   22-JUL-2002"
FT   mRNA            join(175896..175972,176112..176231,176310..176651,
FT                   176731..176777,176823..176870,177038..177194,
FT                   177304..177456,178183..178533,178747..178929)
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, transcript variant mCT170944"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170944.0 created
FT                   on 22-JUL-2002"
FT   mRNA            join(175900..176022,176112..176217,176310..176651,
FT                   176731..176870,177038..>177093)
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, transcript variant mCT170945"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170945.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(175959..176022,176112..176231,176310..176651,
FT                   176731..176870,177038..177194,177304..177456,
FT                   178183..178533,178747..178856)
FT                   /codon_start=1
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, isoform CRA_c"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT8421.1
FT                   protein_id=mCP13421.1 isoform=CRA_c"
FT                   /db_xref="GOA:P29788"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001212"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR020436"
FT                   /db_xref="InterPro:IPR036024"
FT                   /db_xref="InterPro:IPR036375"
FT                   /db_xref="MGI:MGI:98940"
FT                   /db_xref="UniProtKB/Swiss-Prot:P29788"
FT                   /protein_id="EDL15582.1"
FT   CDS             join(176144..176231,176310..176651,176731..176777,
FT                   176823..176870,177038..177194,177304..177456,
FT                   178183..178533,178747..178856)
FT                   /codon_start=1
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, isoform CRA_a"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170944.0
FT                   protein_id=mCP93863.0 isoform=CRA_a"
FT                   /protein_id="EDL15580.1"
FT   CDS             join(176333..176651,176731..176870,177038..>177093)
FT                   /codon_start=1
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, isoform CRA_b"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170945.0
FT                   protein_id=mCP93862.0 isoform=CRA_b"
FT                   /protein_id="EDL15581.1"
FT                   VLDPGYPR"
FT   mRNA            join(177064..177194,177304..177451,178277..178533,
FT                   178747..178866)
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, transcript variant mCT170943"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170943.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(177126..177194,177304..177451,178277..178446)
FT                   /codon_start=1
FT                   /gene="Vtn"
FT                   /locus_tag="mCG_1595"
FT                   /product="vitronectin, isoform CRA_d"
FT                   /note="gene_id=mCG1595.1 transcript_id=mCT170943.0
FT                   protein_id=mCP93861.0 isoform=CRA_d"
FT                   /protein_id="EDL15583.1"
FT   gene            180099..181124
FT                   /gene="Og9x"
FT                   /locus_tag="mCG_1590"
FT                   /note="gene_id=mCG1590.1"
FT   mRNA            join(180099..180186,180348..180508,180632..181124)
FT                   /gene="Og9x"
FT                   /locus_tag="mCG_1590"
FT                   /product="OG9 homeobox gene"
FT                   /note="gene_id=mCG1590.1 transcript_id=mCT8416.1 created on
FT                   03-JAN-2003"
FT   CDS             join(180159..180186,180348..180508,180632..181015)
FT                   /codon_start=1
FT                   /gene="Og9x"
FT                   /locus_tag="mCG_1590"
FT                   /product="OG9 homeobox gene"
FT                   /note="gene_id=mCG1590.1 transcript_id=mCT8416.1
FT                   protein_id=mCP13408.0"
FT                   /protein_id="EDL15584.1"
FT   gene            complement(183632..188738)
FT                   /gene="AI316787"
FT                   /locus_tag="mCG_1604"
FT                   /note="gene_id=mCG1604.1"
FT   mRNA            complement(join(183632..184414,184928..185040,
FT                   185262..185304,186334..186423,186957..187030,
FT                   188506..188738))
FT                   /gene="AI316787"
FT                   /locus_tag="mCG_1604"
FT                   /product="expressed sequence AI316787"
FT                   /note="gene_id=mCG1604.1 transcript_id=mCT8430.1 created on
FT                   01-OCT-2002"
FT   CDS             complement(join(184319..184414,184928..185040,
FT                   185262..185304,186334..186423,186957..187030,
FT                   188506..188716))
FT                   /codon_start=1
FT                   /gene="AI316787"
FT                   /locus_tag="mCG_1604"
FT                   /product="expressed sequence AI316787"
FT                   /note="gene_id=mCG1604.1 transcript_id=mCT8430.1
FT                   protein_id=mCP13393.1"
FT                   /db_xref="GOA:B2RV69"
FT                   /db_xref="InterPro:IPR021013"
FT                   /db_xref="MGI:MGI:2144113"
FT                   /db_xref="UniProtKB/TrEMBL:B2RV69"
FT                   /protein_id="EDL15585.1"
FT   gene            188855..198978
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /note="gene_id=mCG1592.2"
FT   mRNA            join(188855..189081,190529..190610,191697..191794,
FT                   193428..193524,194162..194237,194434..194541,
FT                   194682..194818,195562..195588,195789..195914,
FT                   197761..197840,198403..198978)
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /product="polymerase (DNA-directed), delta interacting
FT                   protein 2, transcript variant mCT8418"
FT                   /note="gene_id=mCG1592.2 transcript_id=mCT8418.2 created on
FT                   22-JUL-2002"
FT   CDS             join(188921..189081,190529..190610,191697..191794,
FT                   193428..193524,194162..194237,194434..194541,
FT                   194682..194818,195562..195588,195789..195914,
FT                   197761..197840,198403..198517)
FT                   /codon_start=1
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /product="polymerase (DNA-directed), delta interacting
FT                   protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG1592.2 transcript_id=mCT8418.2
FT                   protein_id=mCP13413.1 isoform=CRA_a"
FT                   /protein_id="EDL15586.1"
FT   mRNA            join(193502..193524,194162..194237,194434..194541,
FT                   194682..194818,195771..195833)
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /product="polymerase (DNA-directed), delta interacting
FT                   protein 2, transcript variant mCT170948"
FT                   /note="gene_id=mCG1592.2 transcript_id=mCT170948.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(194205..194237,194434..194541,194682..194744)
FT                   /codon_start=1
FT                   /gene="Poldip2"
FT                   /locus_tag="mCG_1592"
FT                   /product="polymerase (DNA-directed), delta interacting
FT                   protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG1592.2 transcript_id=mCT170948.0
FT                   protein_id=mCP93866.0 isoform=CRA_b"
FT                   /protein_id="EDL15587.1"
FT   gene            complement(199515..212809)
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /note="gene_id=mCG1605.1"
FT   mRNA            complement(join(199515..202150,204135..204330,
FT                   204860..204912,204999..205088,205679..205848,
FT                   206637..206956,212682..212809))
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), transcript variant mCT8431"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT8431.1 created on
FT                   22-JUL-2002"
FT   mRNA            complement(join(200279..200418,206716..206956,
FT                   212695..212742))
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), transcript variant mCT170955"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT170955.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(200398..200418,206716..206841))
FT                   /codon_start=1
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), isoform CRA_c"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT170955.0
FT                   protein_id=mCP93873.0 isoform=CRA_c"
FT                   /protein_id="EDL15590.1"
FT                   CIP"
FT   mRNA            complement(join(200938..202150,204135..204330,
FT                   204860..204912,204999..205088,205679..205848,
FT                   206637..206956,212695..>212718))
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), transcript variant mCT191054"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT191054.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(201914..202150,204135..204330,
FT                   204860..204912,204999..205088,205679..205848,
FT                   206637..>206949))
FT                   /codon_start=1
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), isoform CRA_a"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT191054.0
FT                   protein_id=mCP112006.0 isoform=CRA_a"
FT                   /protein_id="EDL15588.1"
FT                   DRQLGHQSTHRD"
FT   CDS             complement(join(201914..202150,204135..204330,
FT                   204860..204912,204999..205088,205679..205848,
FT                   206637..206841))
FT                   /codon_start=1
FT                   /gene="Tnfaip1"
FT                   /locus_tag="mCG_1605"
FT                   /product="tumor necrosis factor, alpha-induced protein 1
FT                   (endothelial), isoform CRA_b"
FT                   /note="gene_id=mCG1605.1 transcript_id=mCT8431.1
FT                   protein_id=mCP13390.1 isoform=CRA_b"
FT                   /protein_id="EDL15589.1"
FT   mRNA            join(213003..213185,216622..216654,217504..217607,
FT                   217970..218326)
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), transcript variant mCT170952"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170952.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(215445..215571,216569..216654,217504..217607,
FT                   217970..218051)
FT                   /codon_start=1
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170953.0
FT                   protein_id=mCP93872.0 isoform=CRA_a"
FT                   /protein_id="EDL15576.1"
FT   CDS             join(215445..215571,216569..216654,217504..217607,
FT                   217970..218051)
FT                   /codon_start=1
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT8429.2
FT                   protein_id=mCP13366.1 isoform=CRA_a"
FT                   /protein_id="EDL15579.1"
FT   CDS             join(215445..215571,216569..216654,217504..217611)
FT                   /codon_start=1
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), isoform CRA_b"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170954.0
FT                   protein_id=mCP93870.0 isoform=CRA_b"
FT                   /protein_id="EDL15577.1"
FT                   ER"
FT   CDS             join(216649..216654,217504..217607,217970..218051)
FT                   /codon_start=1
FT                   /gene="Ift20"
FT                   /locus_tag="mCG_1603"
FT                   /product="intraflagellar transport 20 homolog
FT                   (Chlamydomonas), isoform CRA_c"
FT                   /note="gene_id=mCG1603.2 transcript_id=mCT170952.0
FT                   protein_id=mCP93871.0 isoform=CRA_c"
FT                   /protein_id="EDL15578.1"
FT                   CKVEAEQNEFIDQFIFQK"
FT   gene            complement(218426..227343)
FT                   /locus_tag="mCG_1594"
FT                   /note="gene_id=mCG1594.1"
FT   mRNA            complement(join(218426..219405,220095..220239,
FT                   227137..227343))
FT                   /locus_tag="mCG_1594"
FT                   /product="mCG1594"
FT                   /note="gene_id=mCG1594.1 transcript_id=mCT8420.1 created on
FT                   03-JAN-2003"
FT   CDS             complement(join(219146..219405,220095..220239,
FT                   227137..227262))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1594"
FT                   /product="mCG1594"
FT                   /note="gene_id=mCG1594.1 transcript_id=mCT8420.1
FT                   protein_id=mCP13428.1"
FT                   /protein_id="EDL15591.1"
FT                   NPYYKYEEKRKKK"
FT   gene            complement(244797..373538)
FT                   /gene="Nlk"
FT                   /locus_tag="mCG_1601"
FT                   /note="gene_id=mCG1601.1"
FT   mRNA            complement(join(244797..245582,248078..248171,
FT                   248840..249038,251448..251534,259935..260036,
FT                   263481..263690,265917..266002,267495..267601,
FT                   294887..294942,303189..303318,372856..373538))
FT                   /gene="Nlk"
FT                   /locus_tag="mCG_1601"
FT                   /product="nemo like kinase"
FT                   /note="gene_id=mCG1601.1 transcript_id=mCT8428.1 created on
FT                   22-JUL-2002"
FT   CDS             complement(join(245528..245582,248078..248171,
FT                   248840..249038,251448..251534,259935..260036,
FT                   263481..263690,265917..266002,267495..267601,
FT                   294887..294942,303189..303318,372856..373277))
FT                   /codon_start=1
FT                   /gene="Nlk"
FT                   /locus_tag="mCG_1601"
FT                   /product="nemo like kinase"
FT                   /note="gene_id=mCG1601.1 transcript_id=mCT8428.1
FT                   protein_id=mCP13497.1"
FT                   /protein_id="EDL15592.1"
FT   assembly_gap    322464..322483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    346068..346087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    349124..349143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    373540..374511
FT                   /estimated_length=972
FT                   /gap_type="unknown"
FT   gene            complement(385955..386921)
FT                   /pseudo
FT                   /locus_tag="mCG_54303"
FT                   /note="gene_id=mCG54303.2"
FT   mRNA            complement(join(385955..386366,386534..386921))
FT                   /pseudo
FT                   /locus_tag="mCG_54303"
FT                   /note="gene_id=mCG54303.2 transcript_id=mCT54486.2 created
FT                   on 01-OCT-2002"
FT   gene            complement(427662..428867)
FT                   /gene="1810009O10Rik"
FT                   /locus_tag="mCG_48761"
FT                   /note="gene_id=mCG48761.2"
FT   mRNA            complement(427662..428867)
FT                   /gene="1810009O10Rik"
FT                   /locus_tag="mCG_48761"
FT                   /product="RIKEN cDNA 1810009O10"
FT                   /note="gene_id=mCG48761.2 transcript_id=mCT48944.2 created
FT                   on 27-AUG-2002"
FT   CDS             complement(428065..428817)
FT                   /codon_start=1
FT                   /gene="1810009O10Rik"
FT                   /locus_tag="mCG_48761"
FT                   /product="RIKEN cDNA 1810009O10"
FT                   /note="gene_id=mCG48761.2 transcript_id=mCT48944.2
FT                   protein_id=mCP34768.1"
FT                   /protein_id="EDL15593.1"
FT   assembly_gap    428879..429463
FT                   /estimated_length=585
FT                   /gap_type="unknown"
FT   assembly_gap    456348..456395
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            503507..516367
FT                   /locus_tag="mCG_51870"
FT                   /note="gene_id=mCG51870.1"
FT   mRNA            join(503507..503532,512914..513054,514986..515078,
FT                   516019..516367)
FT                   /locus_tag="mCG_51870"
FT                   /product="mCG51870"
FT                   /note="gene_id=mCG51870.1 transcript_id=mCT52053.1 created
FT                   on 27-AUG-2002"
FT   CDS             join(512929..513054,514986..515078,516019..516036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51870"
FT                   /product="mCG51870"
FT                   /note="gene_id=mCG51870.1 transcript_id=mCT52053.1
FT                   protein_id=mCP34766.2"
FT                   /protein_id="EDL15594.1"
FT   gene            522035..523319
FT                   /locus_tag="mCG_1032048"
FT                   /note="gene_id=mCG1032048.1"
FT   mRNA            join(522035..522497,522725..522762,523021..523319)
FT                   /locus_tag="mCG_1032048"
FT                   /product="mCG1032048"
FT                   /note="gene_id=mCG1032048.1 transcript_id=mCT149752.1
FT                   created on 01-OCT-2002"
FT   CDS             join(522263..522497,522725..522753)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032048"
FT                   /product="mCG1032048"
FT                   /note="gene_id=mCG1032048.1 transcript_id=mCT149752.1
FT                   protein_id=mCP85338.1"
FT                   /protein_id="EDL15595.1"
FT   assembly_gap    551343..551362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(553600..554053)
FT                   /pseudo
FT                   /locus_tag="mCG_66850"
FT                   /note="gene_id=mCG66850.2"
FT   mRNA            complement(553600..554053)
FT                   /pseudo
FT                   /locus_tag="mCG_66850"
FT                   /note="gene_id=mCG66850.2 transcript_id=mCT67033.2 created
FT                   on 01-OCT-2002"
FT   gene            597728..637417
FT                   /gene="Nos2"
FT                   /locus_tag="mCG_1599"
FT                   /note="gene_id=mCG1599.2"
FT   mRNA            join(597728..597865,599092..599247,605444..605513,
FT                   606621..606740,608450..608598,612222..612384,
FT                   613273..613364,614431..614572,614670..614809,
FT                   616849..617023,617118..617219,621530..621724,
FT                   622102..622184,622509..622653,622739..622843,
FT                   624717..624766,625083..625257,625953..626085,
FT                   626484..626562,626826..627007,627965..628128,
FT                   629673..629880,631765..631852,632210..632331,
FT                   633366..633514,634280..634474,636524..636651,
FT                   637034..637417)
FT                   /gene="Nos2"
FT                   /locus_tag="mCG_1599"
FT                   /product="nitric oxide synthase 2, inducible, macrophage"
FT                   /note="gene_id=mCG1599.2 transcript_id=mCT8426.2 created on
FT                   25-NOV-2002"
FT   CDS             join(599138..599247,605444..605513,606621..606740,
FT                   608450..608598,612222..612384,613273..613364,
FT                   614431..614572,614670..614809,616849..617023,
FT                   617118..617219,621530..621724,622102..622184,
FT                   622509..622653,622739..622843,624717..624766,
FT                   625083..625257,625953..626085,626484..626562,
FT                   626826..627007,627965..628128,629673..629880,
FT                   631765..631852,632210..632331,633366..633514,
FT                   634280..634474,636524..636622)
FT                   /codon_start=1
FT                   /gene="Nos2"
FT                   /locus_tag="mCG_1599"
FT                   /product="nitric oxide synthase 2, inducible, macrophage"
FT                   /note="gene_id=mCG1599.2 transcript_id=mCT8426.2
FT                   protein_id=mCP13443.2"
FT                   /protein_id="EDL15596.1"
FT   assembly_gap    636658..636677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    638984..639673
FT                   /estimated_length=690
FT                   /gap_type="unknown"
FT   gene            complement(640540..662437)
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /note="gene_id=mCG1597.2"
FT   mRNA            complement(join(640540..640887,643328..643415,
FT                   643559..643647,644438..644479))
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, transcript
FT                   variant mCT170950"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170950.0 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(640551..641102,643253..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,648878..648988,650549..650750,
FT                   654174..654262,662339..662430))
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, transcript
FT                   variant mCT170949"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170949.0 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(640551..641102,643253..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,647275..647367,648878..648988,
FT                   650549..650750,654174..654262,662339..662392))
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, transcript
FT                   variant mCT8423"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT8423.2 created on
FT                   22-JUL-2002"
FT   CDS             complement(join(640837..640887,643328..643415,
FT                   643559..643593))
FT                   /codon_start=1
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170950.0
FT                   protein_id=mCP93869.0 isoform=CRA_a"
FT                   /protein_id="EDL15597.1"
FT                   QKRSSLIGIPGR"
FT   mRNA            complement(join(640932..641102,643396..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,648878..648988,650549..650750,
FT                   654174..654262,662339..662437))
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, transcript
FT                   variant mCT170951"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170951.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(640956..641102,643253..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,648878..648988,650549..650750,
FT                   654174..654262,662339..662377))
FT                   /codon_start=1
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170949.0
FT                   protein_id=mCP93868.0 isoform=CRA_d"
FT                   /db_xref="GOA:O08573"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:109496"
FT                   /db_xref="PDB:2D6K"
FT                   /db_xref="PDB:2D6L"
FT                   /db_xref="PDB:2D6M"
FT                   /db_xref="PDB:2D6N"
FT                   /db_xref="PDB:2D6O"
FT                   /db_xref="PDB:2D6P"
FT                   /db_xref="UniProtKB/Swiss-Prot:O08573"
FT                   /protein_id="EDL15600.1"
FT   CDS             complement(join(640956..641102,643253..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,647275..647367,648878..648988,
FT                   650549..650750,654174..654262,662339..662377))
FT                   /codon_start=1
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT8423.2
FT                   protein_id=mCP13441.2 isoform=CRA_c"
FT                   /db_xref="GOA:G3X9T7"
FT                   /db_xref="InterPro:IPR001079"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="MGI:MGI:109496"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9T7"
FT                   /protein_id="EDL15599.1"
FT                   EVAGDIQLTHVQT"
FT   CDS             complement(join(641086..641102,643396..643415,
FT                   643559..643647,644438..644479,645005..645055,
FT                   645559..645594,648878..648988,650549..650750,
FT                   654174..654262,662339..662377))
FT                   /codon_start=1
FT                   /gene="Lgals9"
FT                   /locus_tag="mCG_1597"
FT                   /product="lectin, galactose binding, soluble 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1597.2 transcript_id=mCT170951.0
FT                   protein_id=mCP93867.0 isoform=CRA_b"
FT                   /protein_id="EDL15598.1"
FT                   INLRCVDHM"
FT   gene            complement(692355..>824292)
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /note="gene_id=mCG1593.2"
FT   mRNA            complement(join(692355..693819,697118..697251,
FT                   697911..698046,698238..698369,698943..699076,
FT                   702801..702897,704975..705357,706033..706081,
FT                   706788..706842,710977..711142,714254..714360,
FT                   714446..714507,715911..715994,718642..718702,
FT                   722606..723033,725062..725209,752111..752251,
FT                   823937..824236))
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /product="kinase suppressor of ras 1, transcript variant
FT                   mCT8419"
FT                   /note="gene_id=mCG1593.2 transcript_id=mCT8419.1 created on
FT                   01-APR-2003"
FT   CDS             complement(join(693741..693819,697118..697251,
FT                   697911..698046,698238..698369,698943..699076,
FT                   702801..702897,704975..705357,706033..706081,
FT                   706788..706842,710977..711142,714254..714360,
FT                   714446..714507,715911..715942))
FT                   /codon_start=1
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /product="kinase suppressor of ras 1, isoform CRA_b"
FT                   /note="gene_id=mCG1593.2 transcript_id=mCT8419.1
FT                   protein_id=mCP13375.1 isoform=CRA_b"
FT                   /protein_id="EDL15602.1"
FT                   NPKM"
FT   mRNA            complement(join(704265..705357,706033..706081,
FT                   706788..706842,710977..711142,714254..714360,
FT                   714446..714507,715911..715994,718642..718702,
FT                   722606..723033,725062..725209,752111..752251,
FT                   823937..>824292))
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /product="kinase suppressor of ras 1, transcript variant
FT                   mCT190998"
FT                   /note="gene_id=mCG1593.2 transcript_id=mCT190998.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(704971..705357,706033..706081,
FT                   706788..706842,710977..711142,714254..714360,
FT                   714446..714507,715911..715994,718642..718702,
FT                   722606..>722855))
FT                   /codon_start=1
FT                   /gene="Ksr1"
FT                   /locus_tag="mCG_1593"
FT                   /product="kinase suppressor of ras 1, isoform CRA_a"
FT                   /note="gene_id=mCG1593.2 transcript_id=mCT190998.0
FT                   protein_id=mCP111972.0 isoform=CRA_a"
FT                   /protein_id="EDL15601.1"
FT                   HLAIITR"
FT   assembly_gap    706140..706159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    767877..767896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    788926..789076
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    857871..857890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    867790..868209
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    886405..886424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(917915..933202)
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /note="gene_id=mCG1589.2"
FT   mRNA            complement(join(917915..918990,919216..919323,
FT                   920123..920236,920512..920684,922991..923091,
FT                   924698..924829,926919..927187,929509..929677,
FT                   932881..933202))
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /product="WD repeat and SOCS box-containing 1, transcript
FT                   variant mCT8415"
FT                   /note="gene_id=mCG1589.2 transcript_id=mCT8415.1 created on
FT                   30-JUL-2002"
FT   mRNA            complement(join(917915..918990,919216..919323,
FT                   920123..920236,920512..920684,921928..922103,
FT                   922991..923091,924698..924829,926919..927187,
FT                   929509..929677,932881..933191))
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /product="WD repeat and SOCS box-containing 1, transcript
FT                   variant mCT171268"
FT                   /note="gene_id=mCG1589.2 transcript_id=mCT171268.0 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(918831..918990,919216..919323,
FT                   920123..920236,920512..920684,922991..923091,
FT                   924698..924829,926919..927187,929509..929677,
FT                   932881..932920))
FT                   /codon_start=1
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /product="WD repeat and SOCS box-containing 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1589.2 transcript_id=mCT8415.1
FT                   protein_id=mCP13496.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TFQ2"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR036036"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="MGI:MGI:1926139"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TFQ2"
FT                   /protein_id="EDL15604.1"
FT   CDS             complement(join(922080..922103,922991..923091,
FT                   924698..924829,926919..927187,929509..929677,
FT                   932881..932920))
FT                   /codon_start=1
FT                   /gene="Wsb1"
FT                   /locus_tag="mCG_1589"
FT                   /product="WD repeat and SOCS box-containing 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1589.2 transcript_id=mCT171268.0
FT                   protein_id=mCP94187.0 isoform=CRA_a"
FT                   /protein_id="EDL15603.1"
FT   assembly_gap    944920..944939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    967341..967364
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    975321..975381
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    1016826..1017088
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    1037386..1037405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1048018..1128831)
FT                   /pseudo
FT                   /locus_tag="mCG_1600"
FT                   /note="gene_id=mCG1600.1"
FT   mRNA            complement(join(1048018..1048921,1128536..1128831))
FT                   /pseudo
FT                   /locus_tag="mCG_1600"
FT                   /note="gene_id=mCG1600.1 transcript_id=mCT8424.1 created on
FT                   01-OCT-2002"
FT   assembly_gap    1054018..1054292
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   gene            1060730..1258831
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /note="gene_id=mCG119763.1"
FT   mRNA            join(1060730..1061280,1063617..1063700,1067171..1067361,
FT                   1072800..1072906,1085363..1085430,1085651..1085726,
FT                   1086343..1086500,1088445..1088618,1089004..1089126,
FT                   1089633..1089707,1095501..1095632,1102462..1102596,
FT                   1105527..1105640,1111788..1111867,1113633..1113756,
FT                   1115630..1115791,1117791..1118040,1118572..1118645,
FT                   1118834..1118917,1120712..1121152,1121543..1121682,
FT                   1121967..1122089,1122659..1122742,1123749..1123865,
FT                   1124427..1124608,1125068..1125279,1131037..1131198,
FT                   1131333..1131436,1136007..1136142,1140469..1140531,
FT                   1145953..1146111,1147009..1147106,1148671..1148817,
FT                   1150565..1150711,1153009..1153119,1212821..1213253,
FT                   1214011..1214351,1217548..1217750,1222572..1222765,
FT                   1223490..1223630,1224189..1224468,1224886..1225100,
FT                   1225692..1225753,1225892..1226006,1228212..1228352,
FT                   1231089..1231215,1232699..1232830,1233917..1234052,
FT                   1236623..1236780,1242042..1242164,1242636..1242769,
FT                   1243142..1243242,1245872..1246037,1246346..1246392,
FT                   1247453..1247669,1255476..1258830)
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /product="neurofibromatosis 1, transcript variant
FT                   mCT120940"
FT                   /note="gene_id=mCG119763.1 transcript_id=mCT120940.1
FT                   created on 01-OCT-2002"
FT   mRNA            join(<1061135..1061280,1063617..1063700,1067171..1067361,
FT                   1072800..1072906,1085363..1085430,1085651..1085726,
FT                   1086343..1086500,1088445..1088618,1089004..1089126,
FT                   1089633..1089707,1095501..1095632,1102462..1102596,
FT                   1105527..1105640,1111788..1111867,1113633..1113756,
FT                   1115630..1115791,1117791..1118040,1118572..1118645,
FT                   1118834..1118917,1120712..1121152,1121543..1121682,
FT                   1121967..1122089,1122659..1122742,1123749..1123865,
FT                   1124427..1124608,1125068..1125279,1131037..1131198,
FT                   1131333..1131436,1136007..1136142,1140469..1140531,
FT                   1145953..1146111,1147009..1147106,1148671..1148817,
FT                   1150565..1150711,1153009..1153119,1212821..1213253,
FT                   1214011..1214351,1217548..1217750,1222572..1222765,
FT                   1223490..1223630,1224189..1224468,1224886..1225100,
FT                   1225692..1225753,1225892..1226006,1226626..1226727,
FT                   1228212..1228352,1231089..1231215,1232699..1232830,
FT                   1233917..1234052,1236623..1236780,1242042..1242164,
FT                   1242639..1242769,1243142..1243242,1245872..1246014,
FT                   1246346..1246392,1247453..1247669,1255476..1258831)
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /product="neurofibromatosis 1, transcript variant
FT                   mCT191009"
FT                   /note="gene_id=mCG119763.1 transcript_id=mCT191009.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1061137..1061280,1063617..1063700,1067171..1067361,
FT                   1072800..1072906,1085363..1085430,1085651..1085726,
FT                   1086343..1086500,1088445..1088618,1089004..1089126,
FT                   1089633..1089707,1095501..1095632,1102462..1102596,
FT                   1105527..1105640,1111788..1111867,1113633..1113756,
FT                   1115630..1115791,1117791..1118040,1118572..1118645,
FT                   1118834..1118917,1120712..1121152,1121543..1121682,
FT                   1121967..1122089,1122659..1122742,1123749..1123865,
FT                   1124427..1124608,1125068..1125279,1131037..1131198,
FT                   1131333..1131436,1136007..1136142,1140469..1140531,
FT                   1145953..1146111,1147009..1147106,1148671..1148817,
FT                   1150565..1150711,1153009..1153119,1212821..1213253,
FT                   1214011..1214351,1217548..1217750,1222572..1222765,
FT                   1223490..1223630,1224189..1224468,1224886..1225100,
FT                   1225692..1225753,1225892..1226006,1226626..1226727,
FT                   1228212..1228352,1231089..1231215,1232699..1232830,
FT                   1233917..1234052,1236623..1236780,1242042..1242164,
FT                   1242639..1242769,1243142..1243242,1245872..1246014,
FT                   1246346..1246392,1247453..1247669,1255476..1255618)
FT                   /codon_start=1
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /product="neurofibromatosis 1, isoform CRA_a"
FT                   /note="gene_id=mCG119763.1 transcript_id=mCT191009.0
FT                   protein_id=mCP111962.0 isoform=CRA_a"
FT                   /protein_id="EDL15605.1"
FT                   KIV"
FT   CDS             join(1061278..1061280,1063617..1063700,1067171..1067361,
FT                   1072800..1072906,1085363..1085430,1085651..1085726,
FT                   1086343..1086500,1088445..1088618,1089004..1089126,
FT                   1089633..1089707,1095501..1095632,1102462..1102596,
FT                   1105527..1105640,1111788..1111867,1113633..1113756,
FT                   1115630..1115791,1117791..1118040,1118572..1118645,
FT                   1118834..1118917,1120712..1121152,1121543..1121682,
FT                   1121967..1122089,1122659..1122742,1123749..1123865,
FT                   1124427..1124608,1125068..1125279,1131037..1131198,
FT                   1131333..1131436,1136007..1136142,1140469..1140531,
FT                   1145953..1146111,1147009..1147106,1148671..1148817,
FT                   1150565..1150711,1153009..1153119,1212821..1213253,
FT                   1214011..1214351,1217548..1217750,1222572..1222765,
FT                   1223490..1223630,1224189..1224468,1224886..1225100,
FT                   1225692..1225753,1225892..1226006,1228212..1228352,
FT                   1231089..1231215,1232699..1232830,1233917..1234052,
FT                   1236623..1236780,1242042..1242164,1242636..1242769,
FT                   1243142..1243242,1245872..1246037,1246346..1246392,
FT                   1247453..1247507)
FT                   /codon_start=1
FT                   /gene="Nf1"
FT                   /locus_tag="mCG_119763"
FT                   /product="neurofibromatosis 1, isoform CRA_b"
FT                   /note="gene_id=mCG119763.1 transcript_id=mCT120940.1
FT                   protein_id=mCP85382.1 isoform=CRA_b"
FT                   /protein_id="EDL15606.1"
FT                   LNFLMP"
FT   assembly_gap    1070277..1070302
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    1128541..1128560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1158978..1161266)
FT                   /locus_tag="mCG_1032050"
FT                   /note="gene_id=mCG1032050.1"
FT   mRNA            complement(join(1158978..1159648,1160620..1160800,
FT                   1160874..1160954,1161182..1161266))
FT                   /locus_tag="mCG_1032050"
FT                   /product="mCG1032050"
FT                   /note="gene_id=mCG1032050.1 transcript_id=mCT149754.1
FT                   created on 01-OCT-2002"
FT   CDS             complement(1159178..1159636)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032050"
FT                   /product="mCG1032050"
FT                   /note="gene_id=mCG1032050.1 transcript_id=mCT149754.1
FT                   protein_id=mCP85356.1"
FT                   /protein_id="EDL15607.1"
FT   gene            complement(1178570..1181216)
FT                   /gene="Omg"
FT                   /locus_tag="mCG_19069"
FT                   /note="gene_id=mCG19069.2"
FT   mRNA            complement(join(1178570..1180245,1181121..1181216))
FT                   /gene="Omg"
FT                   /locus_tag="mCG_19069"
FT                   /product="oligodendrocyte myelin glycoprotein"
FT                   /note="gene_id=mCG19069.2 transcript_id=mCT17422.2 created
FT                   on 30-JUL-2002"
FT   CDS             complement(join(1178917..1180245,1181121..1181123))
FT                   /codon_start=1
FT                   /gene="Omg"
FT                   /locus_tag="mCG_19069"
FT                   /product="oligodendrocyte myelin glycoprotein"
FT                   /note="gene_id=mCG19069.2 transcript_id=mCT17422.2
FT                   protein_id=mCP13488.1"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:106586"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA53"
FT                   /protein_id="EDL15608.1"
FT   gene            complement(1192241..1207807)
FT                   /locus_tag="mCG_119756"
FT                   /note="gene_id=mCG119756.1"
FT   mRNA            complement(join(1192241..1193980,1200830..1200953,
FT                   1204800..1205020,1207587..1207778))
FT                   /locus_tag="mCG_119756"
FT                   /product="mCG119756, transcript variant mCT172621"
FT                   /note="gene_id=mCG119756.1 transcript_id=mCT172621.0
FT                   created on 27-AUG-2002"
FT   CDS             complement(1192631..1193965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119756"
FT                   /product="mCG119756, isoform CRA_b"
FT                   /note="gene_id=mCG119756.1 transcript_id=mCT172621.0
FT                   protein_id=mCP95540.0 isoform=CRA_b"
FT                   /protein_id="EDL15610.1"
FT   mRNA            complement(join(1203781..1205020,1207587..1207807))
FT                   /locus_tag="mCG_119756"
FT                   /product="mCG119756, transcript variant mCT120933"
FT                   /note="gene_id=mCG119756.1 transcript_id=mCT120933.1
FT                   created on 27-AUG-2002"
FT   CDS             complement(1204329..1205000)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119756"
FT                   /product="mCG119756, isoform CRA_a"
FT                   /note="gene_id=mCG119756.1 transcript_id=mCT120933.1
FT                   protein_id=mCP85321.1 isoform=CRA_a"
FT                   /db_xref="GOA:P20934"
FT                   /db_xref="InterPro:IPR008608"
FT                   /db_xref="MGI:MGI:95458"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20934"
FT                   /protein_id="EDL15609.1"
FT                   N"
FT   gene            1268432..1370336
FT                   /gene="Rab11fip4"
FT                   /locus_tag="mCG_19056"
FT                   /note="gene_id=mCG19056.2"
FT   mRNA            join(1268432..1268656,1296842..1296929,1297680..1297768,
FT                   1357952..1358175,1360505..1360699,1361385..1361519,
FT                   1361763..1361798,1362190..1362289,1362548..1362651,
FT                   1363714..1363854,1366757..1366838,1367600..1367737,
FT                   1367814..1367969,1368898..1369041,1369865..1370336)
FT                   /gene="Rab11fip4"
FT                   /locus_tag="mCG_19056"
FT                   /product="RAB11 family interacting protein 4 (class II)"
FT                   /note="gene_id=mCG19056.2 transcript_id=mCT17408.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(1268498..1268656,1296842..1296929,1297680..1297768,
FT                   1357952..1358175,1360505..1360699,1361385..1361519,
FT                   1361763..1361798,1362190..1362289,1362548..1362651,
FT                   1363714..1363854,1366757..1366838,1367600..1367737,
FT                   1367814..1367969,1368898..1369041,1369865..1369981)
FT                   /codon_start=1
FT                   /gene="Rab11fip4"
FT                   /locus_tag="mCG_19056"
FT                   /product="RAB11 family interacting protein 4 (class II)"
FT                   /note="gene_id=mCG19056.2 transcript_id=mCT17408.2
FT                   protein_id=mCP13432.2"
FT                   /protein_id="EDL15611.1"
FT                   "
FT   assembly_gap    1273687..1273706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1284292..>1300364)
FT                   /locus_tag="mCG_145247"
FT                   /note="gene_id=mCG145247.0"
FT   mRNA            complement(join(1284292..1286152,1293048..1293109,
FT                   1300101..>1300364))
FT                   /locus_tag="mCG_145247"
FT                   /product="mCG145247"
FT                   /note="gene_id=mCG145247.0 transcript_id=mCT184671.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1285104..>1285505)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145247"
FT                   /product="mCG145247"
FT                   /note="gene_id=mCG145247.0 transcript_id=mCT184671.0
FT                   protein_id=mCP105663.0"
FT                   /protein_id="EDL15612.1"
FT   gene            complement(1347536..>1352251)
FT                   /locus_tag="mCG_145957"
FT                   /note="gene_id=mCG145957.0"
FT   mRNA            complement(join(1347536..1347712,1351497..1351643,
FT                   1352217..>1352251))
FT                   /locus_tag="mCG_145957"
FT                   /product="mCG145957"
FT                   /note="gene_id=mCG145957.0 transcript_id=mCT186065.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(1347595..1347712,1351497..>1351600))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145957"
FT                   /product="mCG145957"
FT                   /note="gene_id=mCG145957.0 transcript_id=mCT186065.0
FT                   protein_id=mCP107512.0"
FT                   /protein_id="EDL15613.1"
FT   assembly_gap    1489603..1489622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1533367..1533455
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    1544319..1544338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1554674..1554693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1574718..1576024
FT                   /pseudo
FT                   /locus_tag="mCG_49134"
FT                   /note="gene_id=mCG49134.2"
FT   mRNA            1574718..1576024
FT                   /pseudo
FT                   /locus_tag="mCG_49134"
FT                   /note="gene_id=mCG49134.2 transcript_id=mCT49317.2 created
FT                   on 11-NOV-2002"
FT   assembly_gap    1581361..1581470
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    1583476..1587734
FT                   /estimated_length=4259
FT                   /gap_type="unknown"
FT   assembly_gap    1596879..1596898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1612131..1640598)
FT                   /gene="Utp6"
FT                   /locus_tag="mCG_19061"
FT                   /note="gene_id=mCG19061.1"
FT   mRNA            complement(join(1612131..1614304,1615868..1615940,
FT                   1619089..1619155,1620073..1620182,1620322..1620402,
FT                   1621426..1621605,1623974..1624051,1624401..1624480,
FT                   1627086..1627270,1628965..1629046,1629794..1629875,
FT                   1631772..1631849,1633806..1633924,1634932..1634995,
FT                   1635536..1635583,1636981..1637073,1637304..1637345,
FT                   1638942..1639026,1640413..1640598))
FT                   /gene="Utp6"
FT                   /locus_tag="mCG_19061"
FT                   /product="UTP6, small subunit (SSU) processome component,
FT                   homolog (yeast)"
FT                   /note="gene_id=mCG19061.1 transcript_id=mCT17412.2 created
FT                   on 03-OCT-2002"
FT   CDS             complement(join(1614150..1614304,1615868..1615940,
FT                   1619089..1619155,1620073..1620182,1620322..1620402,
FT                   1621426..1621605,1623974..1624051,1624401..1624480,
FT                   1627086..1627270,1628965..1629046,1629794..1629875,
FT                   1631772..1631849,1633806..1633924,1634932..1634995,
FT                   1635536..1635583,1636981..1637073,1637304..1637345,
FT                   1638942..1639026,1640413..1640504))
FT                   /codon_start=1
FT                   /gene="Utp6"
FT                   /locus_tag="mCG_19061"
FT                   /product="UTP6, small subunit (SSU) processome component,
FT                   homolog (yeast)"
FT                   /note="gene_id=mCG19061.1 transcript_id=mCT17412.2
FT                   protein_id=mCP13478.2"
FT                   /protein_id="EDL15614.1"
FT   gene            <1671300..1714743
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /note="gene_id=mCG19060.3"
FT   mRNA            join(<1671300..1671793,1673811..1673857,1673939..1674003,
FT                   1679678..1679746,1688134..1688183,1691179..1691264,
FT                   1693985..1694216,1695764..1695857,1700300..1700405,
FT                   1702713..1702890,1705531..1705622,1705789..1705932,
FT                   1706418..1706575,1709769..1709967,1710628..1710707,
FT                   1712466..1714743)
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   transcript variant mCT191056"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT191056.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1671301..1671793,1673811..1673857,1673939..1674003,
FT                   1679678..1679746,1688134..1688183,1691179..1691264,
FT                   1693985..1694216,1695764..1695857,1700300..1700405,
FT                   1702713..1702890,1705531..1705622,1705789..1705932,
FT                   1706418..1706575,1709769..1709967,1710628..1710707,
FT                   1712466..1712811)
FT                   /codon_start=1
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT191056.0
FT                   protein_id=mCP112009.0 isoform=CRA_c"
FT                   /protein_id="EDL15617.1"
FT                   "
FT   mRNA            join(1671431..1671793,1673811..1673857,1673939..1674003,
FT                   1679678..1679746,1688134..1688183,1691179..1691264,
FT                   1693985..1694216,1695764..1695857,1700300..1700405,
FT                   1702713..1702890,1705531..1705622,1705789..1705932,
FT                   1706418..1706575,1709769..1709913,1710628..1710707,
FT                   1712466..1714742)
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   transcript variant mCT17413"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT17413.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(1671431..1671793,1673811..1673857,1673939..1674003,
FT                   1688134..1688183,1691179..1691264,1693985..1694216,
FT                   1695764..1695857,1700300..1700405,1702713..1702890,
FT                   1705531..1705709,1706362..1706575,1709769..1709967,
FT                   1710628..1710707,1712466..1712808)
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   transcript variant mCT173979"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT173979.0 created
FT                   on 03-OCT-2002"
FT   CDS             join(1671514..1671793,1673811..1673857,1673939..1674003,
FT                   1688134..1688183,1691179..1691264,1693985..1694216,
FT                   1695764..1695857,1700300..1700405,1702713..1702890,
FT                   1705531..1705709,1706362..1706442)
FT                   /codon_start=1
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT173979.0
FT                   protein_id=mCP96898.0 isoform=CRA_a"
FT                   /protein_id="EDL15615.1"
FT                   IIQKVLG"
FT   CDS             join(1673969..1674003,1679678..1679746,1688134..1688183,
FT                   1691179..1691264,1693985..1694216,1695764..1695857,
FT                   1700300..1700405,1702713..1702890,1705531..1705622,
FT                   1705789..1705932,1706418..1706575,1709769..1709913,
FT                   1710628..1710707,1712466..1712811)
FT                   /codon_start=1
FT                   /gene="Suz12"
FT                   /locus_tag="mCG_19060"
FT                   /product="suppressor of zeste 12 homolog (Drosophila),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG19060.3 transcript_id=mCT17413.2
FT                   protein_id=mCP13450.2 isoform=CRA_b"
FT                   /protein_id="EDL15616.1"
FT   gene            complement(1699101..>1710489)
FT                   /locus_tag="mCG_145253"
FT                   /note="gene_id=mCG145253.0"
FT   mRNA            complement(join(1699101..1699293,1701304..1702286,
FT                   1703094..1703547,1710191..>1710489))
FT                   /locus_tag="mCG_145253"
FT                   /product="mCG145253"
FT                   /note="gene_id=mCG145253.0 transcript_id=mCT184677.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(1701423..>1701641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145253"
FT                   /product="mCG145253"
FT                   /note="gene_id=mCG145253.0 transcript_id=mCT184677.0
FT                   protein_id=mCP105669.0"
FT                   /protein_id="EDL15618.1"
FT   assembly_gap    1726408..1726941
FT                   /estimated_length=534
FT                   /gap_type="unknown"
FT   gene            complement(1727197..1761599)
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /note="gene_id=mCG19064.1"
FT   mRNA            complement(join(1727197..1728428,1729283..1729395,
FT                   1737104..1737275,1738483..1738705,1739891..1740068,
FT                   1740789..1740876,1744883..1745090,1761427..1761599))
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, transcript
FT                   variant mCT17417"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT17417.3 created
FT                   on 20-FEB-2003"
FT   mRNA            complement(join(1727215..1728428,1729283..1729393,
FT                   1737139..1737275,1738483..1738705,1739891..1740068,
FT                   1740789..1740876,1744883..1745090,1761427..>1761598))
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, transcript
FT                   variant mCT191064"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT191064.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(1727215..1728428,1737143..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..1761581))
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, transcript
FT                   variant mCT180679"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT180679.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(join(1728172..1728428,1729283..1729395,
FT                   1737104..1737275,1738483..1738705,1739891..1740068,
FT                   1740789..1740876,1744883..1745090,1761427..1761555))
FT                   /codon_start=1
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, isoform CRA_a"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT17417.3
FT                   protein_id=mCP13466.3 isoform=CRA_a"
FT                   /protein_id="EDL15619.1"
FT   CDS             complement(join(1728353..1728428,1737143..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..1761555))
FT                   /codon_start=1
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, isoform CRA_d"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT180679.0
FT                   protein_id=mCP103600.0 isoform=CRA_d"
FT                   /protein_id="EDL15622.1"
FT                   HCHI"
FT   CDS             complement(join(1729355..1729393,1737139..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..>1761597))
FT                   /codon_start=1
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, isoform CRA_c"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT191064.0
FT                   protein_id=mCP112012.0 isoform=CRA_c"
FT                   /protein_id="EDL15621.1"
FT                   SQTEETV"
FT   mRNA            complement(join(1736786..1736988,1737143..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..1761579))
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, transcript
FT                   variant mCT180678"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT180678.0 created
FT                   on 20-FEB-2003"
FT   CDS             complement(join(1736859..1736988,1737143..1737275,
FT                   1738483..1738705,1739891..1740068,1740789..1740876,
FT                   1744883..1745090,1761427..1761555))
FT                   /codon_start=1
FT                   /gene="Crlf3"
FT                   /locus_tag="mCG_19064"
FT                   /product="cytokine receptor-like factor 3, isoform CRA_b"
FT                   /note="gene_id=mCG19064.1 transcript_id=mCT180678.0
FT                   protein_id=mCP103601.0 isoform=CRA_b"
FT                   /protein_id="EDL15620.1"
FT   assembly_gap    1750092..1750177
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    1756110..1756178
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    1767881..1767900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1770349..1815496
FT                   /gene="C130052G03Rik"
FT                   /locus_tag="mCG_119750"
FT                   /note="gene_id=mCG119750.1"
FT   mRNA            join(1770349..1770783,1775102..1776969,1778900..1778996,
FT                   1781260..1781421,1782728..1782854,1784206..1784287,
FT                   1787200..1787384,1789119..1789273,1790000..1790159,
FT                   1790583..1790771,1792111..1792207,1793385..1793464,
FT                   1793711..1793850,1794792..1794942,1799601..1799777,
FT                   1804703..1804767,1807893..1808073,1811876..1812054,
FT                   1813137..1813978,1814701..1814859,1814965..1815496)
FT                   /gene="C130052G03Rik"
FT                   /locus_tag="mCG_119750"
FT                   /product="RIKEN cDNA C130052G03"
FT                   /note="gene_id=mCG119750.1 transcript_id=mCT120927.1
FT                   created on 03-OCT-2002"
FT   CDS             join(1770718..1770783,1775102..1776969,1778900..1778996,
FT                   1781260..1781421,1782728..1782854,1784206..1784287,
FT                   1787200..1787384,1789119..1789273,1790000..1790159,
FT                   1790583..1790771,1792111..1792207,1793385..1793464,
FT                   1793711..1793850,1794792..1794942,1799601..1799777,
FT                   1804703..1804767,1807893..1808073,1811876..1812054,
FT                   1813137..1813978,1814701..1814859,1814965..1815043)
FT                   /codon_start=1
FT                   /gene="C130052G03Rik"
FT                   /locus_tag="mCG_119750"
FT                   /product="RIKEN cDNA C130052G03"
FT                   /note="gene_id=mCG119750.1 transcript_id=mCT120927.1
FT                   protein_id=mCP85486.1"
FT                   /protein_id="EDL15623.1"
FT   assembly_gap    1788038..1788057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1811038..1811057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1817347..1822799)
FT                   /gene="1110002N22Rik"
FT                   /locus_tag="mCG_19068"
FT                   /note="gene_id=mCG19068.2"
FT   mRNA            complement(join(1817347..1817951,1818590..1818739,
FT                   1820538..1820995,1822749..1822799))
FT                   /gene="1110002N22Rik"
FT                   /locus_tag="mCG_19068"
FT                   /product="RIKEN cDNA 1110002N22"
FT                   /note="gene_id=mCG19068.2 transcript_id=mCT17420.2 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(1817508..1817951,1818590..1818739,
FT                   1820538..1820995,1822749..1822791))
FT                   /codon_start=1
FT                   /gene="1110002N22Rik"
FT                   /locus_tag="mCG_19068"
FT                   /product="RIKEN cDNA 1110002N22"
FT                   /note="gene_id=mCG19068.2 transcript_id=mCT17420.2
FT                   protein_id=mCP13354.2"
FT                   /protein_id="EDL15624.1"
FT   assembly_gap    1830049..1830068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1834880..1860207
FT                   /gene="Centa2"
FT                   /locus_tag="mCG_19057"
FT                   /note="gene_id=mCG19057.1"
FT   mRNA            join(1834880..1835074,1835755..1835885,1837709..1837800,
FT                   1840927..1841006,1842912..1843024,1846437..1846583,
FT                   1851442..1851525,1854848..1854910,1856816..1856893,
FT                   1857806..1858034,1859156..1860207)
FT                   /gene="Centa2"
FT                   /locus_tag="mCG_19057"
FT                   /product="centaurin, alpha 2"
FT                   /note="gene_id=mCG19057.1 transcript_id=mCT17409.2 created
FT                   on 03-OCT-2002"
FT   CDS             join(1834981..1835074,1835755..1835885,1837709..1837800,
FT                   1840927..1841006,1842912..1843024,1846437..1846583,
FT                   1851442..1851525,1854848..1854910,1856816..1856893,
FT                   1857806..1858034,1859156..1859190)
FT                   /codon_start=1
FT                   /gene="Centa2"
FT                   /locus_tag="mCG_19057"
FT                   /product="centaurin, alpha 2"
FT                   /note="gene_id=mCG19057.1 transcript_id=mCT17409.2
FT                   protein_id=mCP13451.2"
FT                   /db_xref="GOA:Q5SSK2"
FT                   /db_xref="InterPro:IPR001164"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR037849"
FT                   /db_xref="InterPro:IPR037851"
FT                   /db_xref="MGI:MGI:2663075"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SSK2"
FT                   /protein_id="EDL15625.1"
FT   gene            complement(1839625..>1858389)
FT                   /locus_tag="mCG_146186"
FT                   /note="gene_id=mCG146186.0"
FT   mRNA            complement(join(1839625..1840015,1857716..1857832,
FT                   1857916..>1858389))
FT                   /locus_tag="mCG_146186"
FT                   /product="mCG146186"
FT                   /note="gene_id=mCG146186.0 transcript_id=mCT186289.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(1839950..1840015,1857716..1857832,
FT                   1857916..>1858116))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146186"
FT                   /product="mCG146186"
FT                   /note="gene_id=mCG146186.0 transcript_id=mCT186289.0
FT                   protein_id=mCP107517.0"
FT                   /protein_id="EDL15626.1"
FT   gene            1860259..1861344
FT                   /locus_tag="mCG_1032052"
FT                   /note="gene_id=mCG1032052.0"
FT   mRNA            join(1860259..1860376,1861087..1861344)
FT                   /locus_tag="mCG_1032052"
FT                   /product="mCG1032052"
FT                   /note="gene_id=mCG1032052.0 transcript_id=mCT149756.0
FT                   created on 31-MAR-2003"
FT   CDS             join(1860351..1860376,1861087..1861186)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032052"
FT                   /product="mCG1032052"
FT                   /note="gene_id=mCG1032052.0 transcript_id=mCT149756.0
FT                   protein_id=mCP85372.1"
FT                   /protein_id="EDL15627.1"
FT   assembly_gap    1862907..1862926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1864603..1880744
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /note="gene_id=mCG19055.2"
FT   mRNA            join(1864603..1864988,1870276..1870419,1874938..1875100,
FT                   1877925..1877999,1879552..1880743)
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /product="ring finger protein 135, transcript variant
FT                   mCT17407"
FT                   /note="gene_id=mCG19055.2 transcript_id=mCT17407.2 created
FT                   on 27-AUG-2002"
FT   mRNA            join(1864626..1864882,1879872..1880744)
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /product="ring finger protein 135, transcript variant
FT                   mCT172628"
FT                   /note="gene_id=mCG19055.2 transcript_id=mCT172628.0 created
FT                   on 27-AUG-2002"
FT   CDS             join(1864650..1864988,1870276..1870419,1874938..1875100,
FT                   1877925..1877999,1879552..1880084)
FT                   /codon_start=1
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /product="ring finger protein 135, isoform CRA_b"
FT                   /note="gene_id=mCG19055.2 transcript_id=mCT17407.2
FT                   protein_id=mCP13444.1 isoform=CRA_b"
FT                   /db_xref="GOA:B2RRA5"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:1919206"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRA5"
FT                   /protein_id="EDL15629.1"
FT                   WLYGLSPGNYLEIKQLNT"
FT   CDS             join(1864844..1864882,1879872..1880084)
FT                   /codon_start=1
FT                   /gene="Rnf135"
FT                   /locus_tag="mCG_19055"
FT                   /product="ring finger protein 135, isoform CRA_a"
FT                   /note="gene_id=mCG19055.2 transcript_id=mCT172628.0
FT                   protein_id=mCP95547.0 isoform=CRA_a"
FT                   /protein_id="EDL15628.1"
FT   assembly_gap    1867138..1868390
FT                   /estimated_length=1253
FT                   /gap_type="unknown"
FT   gene            <1890077..1947800
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /note="gene_id=mCG19063.2"
FT   mRNA            join(<1890077..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1946733..1947800)
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, transcript
FT                   variant mCT17415"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT17415.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(1890085..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1938505..1938627,1946733..1947734)
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, transcript
FT                   variant mCT173980"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT173980.0 created
FT                   on 03-OCT-2002"
FT   mRNA            join(<1890110..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1936853..1936948,1946733..1947754)
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, transcript
FT                   variant mCT191063"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT191063.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1890227..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1936853..1936948,1946733..1946850)
FT                   /codon_start=1
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT191063.0
FT                   protein_id=mCP112011.0 isoform=CRA_c"
FT                   /protein_id="EDL15632.1"
FT   CDS             join(<1890227..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1946733..1946850)
FT                   /codon_start=1
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT17415.2
FT                   protein_id=mCP13452.2 isoform=CRA_b"
FT                   /protein_id="EDL15631.1"
FT                   "
FT   CDS             join(1890239..1890314,1901249..1901307,1904894..1904975,
FT                   1906577..1906620,1907054..1907107,1908271..1908323,
FT                   1914373..1914481,1914920..1915021,1923012..1923110,
FT                   1923564..1923672,1924361..1924481,1926993..1927077,
FT                   1927658..1927803,1929429..1929529,1931199..1931329,
FT                   1932034..1932117,1933958..1934077,1935651..1935853,
FT                   1938505..1938627,1946733..1946850)
FT                   /codon_start=1
FT                   /gene="Rhot1"
FT                   /locus_tag="mCG_19063"
FT                   /product="ras homolog gene family, member T1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19063.2 transcript_id=mCT173980.0
FT                   protein_id=mCP96899.0 isoform=CRA_a"
FT                   /protein_id="EDL15630.1"
FT   assembly_gap    1962097..1962116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1981236..1981842
FT                   /estimated_length=607
FT                   /gap_type="unknown"
FT   gene            <1981892..2036152
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /note="gene_id=mCG19052.2"
FT   mRNA            join(1981892..1982251,1983648..1983671,2000547..2000705,
FT                   2004348..2004584,2011933..2012081,2013171..2013283,
FT                   2019243..2019343,2028708..2028768,2035323..2036152)
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /product="rhomboid, veinlet-like 3 (Drosophila), transcript
FT                   variant mCT17332"
FT                   /note="gene_id=mCG19052.2 transcript_id=mCT17332.2 created
FT                   on 03-OCT-2002"
FT   mRNA            join(<1981892..1982251,1983648..1983671,2000547..2000705,
FT                   2004348..2004572,2011933..2012081,2013171..2013283,
FT                   2019243..2019343,2028708..2028768,2035323..2036152)
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /product="rhomboid, veinlet-like 3 (Drosophila), transcript
FT                   variant mCT191027"
FT                   /note="gene_id=mCG19052.2 transcript_id=mCT191027.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<1982069..1982251,1983648..1983671,2000547..2000705,
FT                   2004348..2004572,2011933..2012081,2013171..2013283,
FT                   2019243..2019343,2028708..2028768,2035323..2035594)
FT                   /codon_start=1
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /product="rhomboid, veinlet-like 3 (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG19052.2 transcript_id=mCT191027.0
FT                   protein_id=mCP111975.0 isoform=CRA_b"
FT                   /protein_id="EDL15634.1"
FT   CDS             join(1982141..1982251,1983648..1983671,2000547..2000705,
FT                   2004348..2004584,2011933..2012081,2013171..2013283,
FT                   2019243..2019343,2028708..2028768,2035323..2035594)
FT                   /codon_start=1
FT                   /gene="Rhbdl3"
FT                   /locus_tag="mCG_19052"
FT                   /product="rhomboid, veinlet-like 3 (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG19052.2 transcript_id=mCT17332.2
FT                   protein_id=mCP13409.2 isoform=CRA_a"
FT                   /protein_id="EDL15633.1"
FT                   LDLKLPPAP"
FT   assembly_gap    2006172..2006191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2017995..2018014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2025610..2025898
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    2028833..2028952
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   gene            complement(2042399..2059911)
FT                   /locus_tag="mCG_19053"
FT                   /note="gene_id=mCG19053.1"
FT   mRNA            complement(join(2042399..2045925,2046743..2046846,
FT                   2049969..2050105,2050435..2050499,2052238..2052357,
FT                   2055547..2055611,2055967..2056124,2057414..2057539,
FT                   2058710..2058790,2059749..2059911))
FT                   /locus_tag="mCG_19053"
FT                   /product="mCG19053"
FT                   /note="gene_id=mCG19053.1 transcript_id=mCT17333.2 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(2045719..2045925,2046743..2046846,
FT                   2049969..2050105,2050435..2050499,2052238..2052357,
FT                   2055547..2055611,2055967..2056124,2057414..2057539,
FT                   2058710..2058790,2059749..2059888))
FT                   /codon_start=1
FT                   /locus_tag="mCG_19053"
FT                   /product="mCG19053"
FT                   /note="gene_id=mCG19053.1 transcript_id=mCT17333.2
FT                   protein_id=mCP13427.2"
FT                   /protein_id="EDL15635.1"
FT                   V"
FT   gene            <2065237..2078044
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /note="gene_id=mCG19062.3"
FT   mRNA            join(<2065237..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073308,2073742..2073899,2074991..2076190)
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, transcript variant
FT                   mCT191058"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT191058.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(2065248..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073308,2073742..2073899,2074991..2075083,
FT                   2076193..2076438,2077009..2077168,2077297..2078044)
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, transcript variant
FT                   mCT171271"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT171271.1 created
FT                   on 03-JAN-2003"
FT   mRNA            join(2065252..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073296,2073742..2073899,2076193..2076438,
FT                   2077009..2077168,2077297..2078044)
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, transcript variant
FT                   mCT17414"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT17414.0 created
FT                   on 03-JAN-2003"
FT   CDS             join(<2065353..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073308,2073742..2073899,2074991..2075152)
FT                   /codon_start=1
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, isoform CRA_b"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT191058.0
FT                   protein_id=mCP112010.0 isoform=CRA_b"
FT                   /protein_id="EDL15637.1"
FT   CDS             join(2065362..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073308,2073742..2073899,2074991..2075083,
FT                   2076193..2076438,2077009..2077168,2077297..2077457)
FT                   /codon_start=1
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, isoform CRA_c"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT171271.1
FT                   protein_id=mCP94190.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q9JMD0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:1340045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JMD0"
FT                   /protein_id="EDL15638.1"
FT   CDS             join(2065362..2065402,2067810..2067936,2069709..2069847,
FT                   2070885..2071052,2071162..2071237,2071681..2071728,
FT                   2073238..2073296,2073742..2073899,2076193..2076438,
FT                   2077009..2077168,2077297..2077457)
FT                   /codon_start=1
FT                   /gene="Zfp207"
FT                   /locus_tag="mCG_19062"
FT                   /product="zinc finger protein 207, isoform CRA_a"
FT                   /note="gene_id=mCG19062.3 transcript_id=mCT17414.0
FT                   protein_id=mCP13430.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JMD0"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="MGI:MGI:1340045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JMD0"
FT                   /protein_id="EDL15636.1"
FT                   RY"
FT   gene            complement(2085254..2087791)
FT                   /locus_tag="mCG_1032001"
FT                   /note="gene_id=mCG1032001.1"
FT   mRNA            complement(join(2085254..2086182,2086214..2087791))
FT                   /locus_tag="mCG_1032001"
FT                   /product="mCG1032001"
FT                   /note="gene_id=mCG1032001.1 transcript_id=mCT149705.1
FT                   created on 28-MAR-2003"
FT   CDS             complement(2085877..2086065)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032001"
FT                   /product="mCG1032001"
FT                   /note="gene_id=mCG1032001.1 transcript_id=mCT149705.1
FT                   protein_id=mCP85524.1"
FT                   /protein_id="EDL15639.1"
FT                   RDPLASVSRVCATTPGI"
FT   assembly_gap    2086187..2086206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2105448..2107820
FT                   /estimated_length=2373
FT                   /gap_type="unknown"
FT   assembly_gap    2108514..2108743
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   gene            2110939..2155191
FT                   /locus_tag="mCG_19050"
FT                   /note="gene_id=mCG19050.1"
FT   mRNA            join(2110939..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127639,2128240..2128297,2138566..2138760,
FT                   2142918..2143062,2144933..2144993,2147336..2147398,
FT                   2152128..2152253,2152709..2152744,2152952..2153003,
FT                   2153778..2153920,2154036..2155191)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT17330"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT17330.2 created
FT                   on 04-MAR-2003"
FT   mRNA            join(2110965..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127639,2128240..2128297,2138566..2138760,
FT                   2142918..2143062,2144933..2144993,2147336..2147398,
FT                   2152128..2152744,2152952..2153003,2153778..2153920,
FT                   2154036..2154632)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT172626"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172626.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(2110990..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127639,2128240..2128297,2138566..2138760,
FT                   2142918..2143062,2144933..2144993,2147336..2147398,
FT                   2152128..2152253,2152709..2152744,2152952..2153003,
FT                   2153778..2153920)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_d"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT17330.2
FT                   protein_id=mCP13489.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q5BKQ9"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR035295"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="MGI:MGI:1916327"
FT                   /db_xref="UniProtKB/TrEMBL:Q5BKQ9"
FT                   /protein_id="EDL15643.1"
FT   CDS             join(2110990..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127639,2128240..2128297,2138566..2138760,
FT                   2142918..2143062,2144933..2144993,2147336..2147398,
FT                   2152128..2152295)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_b"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172626.0
FT                   protein_id=mCP95544.0 isoform=CRA_b"
FT                   /protein_id="EDL15641.1"
FT   mRNA            join(2111010..2111080,2114031..2114132,2120577..2120701,
FT                   2127568..2127625,2152966..2153003,2153778..2153920,
FT                   2154036..2154236)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT172625"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172625.1 created
FT                   on 04-MAR-2003"
FT   mRNA            join(2111015..2111080,2114031..2114132,2120577..2120701,
FT                   2120847..2120956,2127568..2127639,2128240..2128297,
FT                   2138566..>2138701)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT172627"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172627.0 created
FT                   on 04-MAR-2003"
FT   mRNA            join(2111041..2111080,2114031..2114132,2127568..2127639,
FT                   2128240..2128297,2138566..2138760,2142918..2143062,
FT                   2144933..2144993,2147336..2147398,2152128..2152421)
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, transcript variant mCT180868"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT180868.0 created
FT                   on 04-MAR-2003"
FT   CDS             join(2114052..2114132,2127568..2127639,2128240..2128297,
FT                   2138566..2138760,2142918..2143062,2144933..2144993,
FT                   2147336..2147398,2152128..2152295)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_e"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT180868.0
FT                   protein_id=mCP103790.0 isoform=CRA_e"
FT                   /protein_id="EDL15644.1"
FT   CDS             join(2120678..2120701,2127568..2127625,2152966..2152982)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_a"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172625.1
FT                   protein_id=mCP95545.1 isoform=CRA_a"
FT                   /protein_id="EDL15640.1"
FT                   /translation="MEAATGQEVELCLECIEWAKSEKRTFLQNYHR"
FT   CDS             join(2120873..2120956,2127568..2127639,2128240..2128297,
FT                   2138566..>2138701)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19050"
FT                   /product="mCG19050, isoform CRA_c"
FT                   /note="gene_id=mCG19050.1 transcript_id=mCT172627.0
FT                   protein_id=mCP95546.0 isoform=CRA_c"
FT                   /protein_id="EDL15642.1"
FT                   LPKARAALTSART"
FT   assembly_gap    2159270..2159478
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   gene            2159566..2163726
FT                   /gene="Cdk5r1"
FT                   /locus_tag="mCG_10740"
FT                   /note="gene_id=mCG10740.1"
FT   mRNA            2159566..2163726
FT                   /gene="Cdk5r1"
FT                   /locus_tag="mCG_10740"
FT                   /product="cyclin-dependent kinase 5, regulatory subunit
FT                   (p35) 1"
FT                   /note="gene_id=mCG10740.1 transcript_id=mCT10726.1 created
FT                   on 13-JUN-2003"
FT   CDS             2160052..2160975
FT                   /codon_start=1
FT                   /gene="Cdk5r1"
FT                   /locus_tag="mCG_10740"
FT                   /product="cyclin-dependent kinase 5, regulatory subunit
FT                   (p35) 1"
FT                   /note="gene_id=mCG10740.1 transcript_id=mCT10726.1
FT                   protein_id=mCP13412.1"
FT                   /db_xref="GOA:Q542T9"
FT                   /db_xref="InterPro:IPR004944"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="MGI:MGI:101764"
FT                   /db_xref="UniProtKB/TrEMBL:Q542T9"
FT                   /protein_id="EDL15645.1"
FT   gene            complement(2164669..2463367)
FT                   /gene="Myo1d"
FT                   /locus_tag="mCG_10736"
FT                   /note="gene_id=mCG10736.1"
FT   mRNA            complement(join(2164669..2166925,2240029..2240183,
FT                   2269590..2269703,2275530..2275634,2276482..2276626,
FT                   2284327..2284550,2320682..2320889,2323027..2323193,
FT                   2340201..2340333,2345849..2345923,2349383..2349453,
FT                   2353657..2353827,2357422..2357536,2357625..2357770,
FT                   2358859..2359062,2359630..2359746,2362828..2362923,
FT                   2365190..2365243,2367133..2367298,2368658..2368751,
FT                   2376059..2376267,2463062..2463367))
FT                   /gene="Myo1d"
FT                   /locus_tag="mCG_10736"
FT                   /product="myosin ID"
FT                   /note="gene_id=mCG10736.1 transcript_id=mCT10722.2 created
FT                   on 11-OCT-2002"
FT   CDS             complement(join(2166769..2166925,2240029..2240183,
FT                   2269590..2269703,2275530..2275634,2276482..2276626,
FT                   2284327..2284550,2320682..2320889,2323027..2323193,
FT                   2340201..2340333,2345849..2345923,2349383..2349453,
FT                   2353657..2353827,2357422..2357536,2357625..2357770,
FT                   2358859..2359062,2359630..2359746,2362828..2362923,
FT                   2365190..2365243,2367133..2367298,2368658..2368751,
FT                   2376059..2376267,2463062..2463156))
FT                   /codon_start=1
FT                   /gene="Myo1d"
FT                   /locus_tag="mCG_10736"
FT                   /product="myosin ID"
FT                   /note="gene_id=mCG10736.1 transcript_id=mCT10722.2
FT                   protein_id=mCP13436.1"
FT                   /protein_id="EDL15646.1"
FT                   PDFTKNRSGFILSVPGN"
FT   assembly_gap    2221458..2221522
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    2222132..2222243
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    2290351..2290370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2291887..2291906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2369110..2369129
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2447826..2447845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2455990..2456009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2473726..2473745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2490876..2491023
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    2492228..2492734
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   gene            2494175..2506079
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /note="gene_id=mCG10741.1"
FT   mRNA            join(2494175..2494277,2496320..2496503,2498033..2498164,
FT                   2499480..2499513,2501317..2501432,2503744..2503803,
FT                   2505026..2506079)
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /product="transmembrane protein 98, transcript variant
FT                   mCT10727"
FT                   /note="gene_id=mCG10741.1 transcript_id=mCT10727.1 created
FT                   on 03-JAN-2003"
FT   mRNA            join(<2494229..2494273,2496320..2496503,2498033..2498164,
FT                   2499480..2499513,2501317..2501432,2503744..2503803,
FT                   2505026..2505845)
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /product="transmembrane protein 98, transcript variant
FT                   mCT191002"
FT                   /note="gene_id=mCG10741.1 transcript_id=mCT191002.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2494273..2494273,2496320..2496503,2498033..2498164,
FT                   2499480..2499513,2501317..2501432,2503744..2503803,
FT                   2505026..2505233)
FT                   /codon_start=1
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /product="transmembrane protein 98, isoform CRA_a"
FT                   /note="gene_id=mCG10741.1 transcript_id=mCT191002.0
FT                   protein_id=mCP111958.0 isoform=CRA_a"
FT                   /protein_id="EDL15647.1"
FT   CDS             join(2496373..2496503,2498033..2498164,2499480..2499513,
FT                   2501317..2501432,2503744..2503803,2505026..2505233)
FT                   /codon_start=1
FT                   /gene="Tmem98"
FT                   /locus_tag="mCG_10741"
FT                   /product="transmembrane protein 98, isoform CRA_b"
FT                   /note="gene_id=mCG10741.1 transcript_id=mCT10727.1
FT                   protein_id=mCP13415.2 isoform=CRA_b"
FT                   /protein_id="EDL15648.1"
FT                   QSAI"
FT   assembly_gap    2506196..2506289
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    2507885..2507904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2530238..2530386
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            complement(2533961..>2541881)
FT                   /locus_tag="mCG_144657"
FT                   /note="gene_id=mCG144657.0"
FT   mRNA            complement(join(2533961..2534811,2535133..2535260,
FT                   2541708..>2541881))
FT                   /locus_tag="mCG_144657"
FT                   /product="mCG144657"
FT                   /note="gene_id=mCG144657.0 transcript_id=mCT184081.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(2534685..2534811,2535133..2535260,
FT                   2541708..>2541725))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144657"
FT                   /product="mCG144657"
FT                   /note="gene_id=mCG144657.0 transcript_id=mCT184081.0
FT                   protein_id=mCP105657.0"
FT                   /protein_id="EDL15649.1"
FT   gene            2541942..2551478
FT                   /locus_tag="mCG_10739"
FT                   /note="gene_id=mCG10739.1"
FT   mRNA            join(2541942..2542121,2545613..2545702,2546481..2546746,
FT                   2547443..2547601,2548032..2548110,2551297..2551478)
FT                   /locus_tag="mCG_10739"
FT                   /product="mCG10739"
FT                   /note="gene_id=mCG10739.1 transcript_id=mCT10725.2 created
FT                   on 28-AUG-2002"
FT   assembly_gap    2544590..2545611
FT                   /estimated_length=1022
FT                   /gap_type="unknown"
FT   CDS             join(2545614..2545702,2546481..2546746,2547443..2547601,
FT                   2548032..2548110,2551297..2551363)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10739"
FT                   /product="mCG10739"
FT                   /note="gene_id=mCG10739.1 transcript_id=mCT10725.2
FT                   protein_id=mCP13498.2"
FT                   /protein_id="EDL15650.1"
FT   assembly_gap    2549874..2550660
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   assembly_gap    2555222..2555241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2563979..2833173)
FT                   /gene="Accn1"
FT                   /locus_tag="mCG_141259"
FT                   /note="gene_id=mCG141259.0"
FT   mRNA            complement(join(2563979..2564955,2565398..2565466,
FT                   2567207..2567286,2570631..2570722,2573768..2573921,
FT                   2575779..2575835,2578009..2578159,2633151..2633278,
FT                   2652144..2652294,2832445..2833173))
FT                   /gene="Accn1"
FT                   /locus_tag="mCG_141259"
FT                   /product="amiloride-sensitive cation channel 1, neuronal
FT                   (degenerin)"
FT                   /note="gene_id=mCG141259.0 transcript_id=mCT174214.0
FT                   created on 11-OCT-2002"
FT   CDS             complement(join(2564854..2564955,2565398..2565466,
FT                   2567207..2567286,2570631..2570722,2573768..2573921,
FT                   2575779..2575835,2578009..2578159,2633151..2633278,
FT                   2652144..2652294,2832445..2833152))
FT                   /codon_start=1
FT                   /gene="Accn1"
FT                   /locus_tag="mCG_141259"
FT                   /product="amiloride-sensitive cation channel 1, neuronal
FT                   (degenerin)"
FT                   /note="gene_id=mCG141259.0 transcript_id=mCT174214.0
FT                   protein_id=mCP97133.0"
FT                   /db_xref="GOA:B2RRQ1"
FT                   /db_xref="InterPro:IPR001873"
FT                   /db_xref="InterPro:IPR004724"
FT                   /db_xref="InterPro:IPR020903"
FT                   /db_xref="MGI:MGI:1100867"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRQ1"
FT                   /protein_id="EDL15651.1"
FT   assembly_gap    2568250..2569609
FT                   /estimated_length=1360
FT                   /gap_type="unknown"
FT   assembly_gap    2590181..2590200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2601542..2601561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2603086..2603133
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    2616761..2616780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2626081..2626299
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    2636973..2636992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2650620..2650804
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    2724129..2724165
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    2725923..2725976
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    2774373..2774392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2793853..2793931
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    2829968..2830066
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    2833174..2833718
FT                   /estimated_length=545
FT                   /gap_type="unknown"
FT   assembly_gap    2838037..2838226
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    2844942..2848512
FT                   /estimated_length=3571
FT                   /gap_type="unknown"
FT   assembly_gap    2924316..2924335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2955927..2955946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3016823..3017634
FT                   /estimated_length=812
FT                   /gap_type="unknown"
FT   assembly_gap    3050620..3050639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3062911..3062931
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    3109112..3109131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3111582..3111601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3112897..3112916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3122445..3124179
FT                   /estimated_length=1735
FT                   /gap_type="unknown"
FT   assembly_gap    3138165..3138279
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    3145983..3146128
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    3147603..3147797
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    3156370..3156412
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    3158039..3158593
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    3160132..3160351
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    3185164..3185183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3187446..3189172)
FT                   /locus_tag="mCG_147531"
FT                   /note="gene_id=mCG147531.0"
FT   mRNA            complement(3187446..3189172)
FT                   /locus_tag="mCG_147531"
FT                   /product="mCG147531"
FT                   /note="gene_id=mCG147531.0 transcript_id=mCT187794.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3188437..3188760)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147531"
FT                   /product="mCG147531"
FT                   /note="gene_id=mCG147531.0 transcript_id=mCT187794.0
FT                   protein_id=mCP109297.0"
FT                   /protein_id="EDL15652.1"
FT                   TPL"
FT   assembly_gap    3225084..3225958
FT                   /estimated_length=875
FT                   /gap_type="unknown"
FT   assembly_gap    3228397..3228416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3229535..3231589
FT                   /estimated_length=2055
FT                   /gap_type="unknown"
FT   assembly_gap    3236948..3237005
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    3237783..3238213
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   gene            complement(3242645..>3243619)
FT                   /locus_tag="mCG_48927"
FT                   /note="gene_id=mCG48927.2"
FT   mRNA            complement(3242645..>3243619)
FT                   /locus_tag="mCG_48927"
FT                   /product="mCG48927"
FT                   /note="gene_id=mCG48927.2 transcript_id=mCT49110.2 created
FT                   on 11-OCT-2002"
FT   CDS             complement(3242804..3243619)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48927"
FT                   /product="mCG48927"
FT                   /note="gene_id=mCG48927.2 transcript_id=mCT49110.2
FT                   protein_id=mCP23934.1"
FT                   /db_xref="GOA:Q3V2K0"
FT                   /db_xref="InterPro:IPR000163"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="MGI:MGI:3588264"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V2K0"
FT                   /protein_id="EDL15653.1"
FT   assembly_gap    3244038..3244057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3257081..3270736
FT                   /estimated_length=13656
FT                   /gap_type="unknown"
FT   assembly_gap    3276186..3276373
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    3277877..3282084
FT                   /estimated_length=4208
FT                   /gap_type="unknown"
FT   assembly_gap    3332700..3349231
FT                   /estimated_length=16532
FT                   /gap_type="unknown"
FT   assembly_gap    3406616..3406635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3421322..3421345
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3428075..3428450
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    3435318..3435365
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    3453383..3453402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3459719..3459926
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    3494638..3494657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3518201..3524057
FT                   /locus_tag="mCG_145245"
FT                   /note="gene_id=mCG145245.0"
FT   mRNA            join(<3518201..3518864,3520955..3522105,3522218..3524057)
FT                   /locus_tag="mCG_145245"
FT                   /product="mCG145245"
FT                   /note="gene_id=mCG145245.0 transcript_id=mCT184669.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    3522106..3522216
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   CDS             <3523566..3523946
FT                   /codon_start=1
FT                   /locus_tag="mCG_145245"
FT                   /product="mCG145245"
FT                   /note="gene_id=mCG145245.0 transcript_id=mCT184669.0
FT                   protein_id=mCP105661.0"
FT                   /protein_id="EDL15654.1"
FT   assembly_gap    3547226..3553468
FT                   /estimated_length=6243
FT                   /gap_type="unknown"
FT   assembly_gap    3559079..3559098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<3625361..3626179)
FT                   /locus_tag="mCG_49975"
FT                   /note="gene_id=mCG49975.1"
FT   mRNA            complement(<3625361..3626179)
FT                   /locus_tag="mCG_49975"
FT                   /product="mCG49975"
FT                   /note="gene_id=mCG49975.1 transcript_id=mCT50158.1 created
FT                   on 13-OCT-2002"
FT   CDS             complement(<3625361..3625954)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49975"
FT                   /product="mCG49975"
FT                   /note="gene_id=mCG49975.1 transcript_id=mCT50158.1
FT                   protein_id=mCP23931.1"
FT                   /protein_id="EDL15655.1"
FT   assembly_gap    3675761..3676086
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   gene            3693559..3695437
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /note="gene_id=mCG8184.2"
FT   mRNA            join(3693559..3693722,3694468..3694585,3694911..3695437)
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /product="chemokine (C-C motif) ligand 2, transcript
FT                   variant mCT7629"
FT                   /note="gene_id=mCG8184.2 transcript_id=mCT7629.1 created on
FT                   31-JUL-2002"
FT   mRNA            join(<3693595..3693722,3694468..3695434)
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /product="chemokine (C-C motif) ligand 2, transcript
FT                   variant mCT191048"
FT                   /note="gene_id=mCG8184.2 transcript_id=mCT191048.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(3693647..3693722,3694468..3694585,3694911..3695163)
FT                   /codon_start=1
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /product="chemokine (C-C motif) ligand 2, isoform CRA_b"
FT                   /note="gene_id=mCG8184.2 transcript_id=mCT7629.1
FT                   protein_id=mCP1004.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q5SVU3"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:98259"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SVU3"
FT                   /protein_id="EDL15657.1"
FT   CDS             <3694590..3694946
FT                   /codon_start=1
FT                   /gene="Ccl2"
FT                   /locus_tag="mCG_8184"
FT                   /product="chemokine (C-C motif) ligand 2, isoform CRA_a"
FT                   /note="gene_id=mCG8184.2 transcript_id=mCT191048.0
FT                   protein_id=mCP112016.0 isoform=CRA_a"
FT                   /protein_id="EDL15656.1"
FT                   FPQFCHQAQERGLC"
FT   gene            3703702..3705506
FT                   /gene="Ccl7"
FT                   /locus_tag="mCG_52384"
FT                   /note="gene_id=mCG52384.1"
FT   mRNA            join(3703702..3703844,3704503..3704614,3704970..3705506)
FT                   /gene="Ccl7"
FT                   /locus_tag="mCG_52384"
FT                   /product="chemokine (C-C motif) ligand 7"
FT                   /note="gene_id=mCG52384.1 transcript_id=mCT52567.1 created
FT                   on 31-JUL-2002"
FT   CDS             join(3703769..3703844,3704503..3704614,3704970..3705075)
FT                   /codon_start=1
FT                   /gene="Ccl7"
FT                   /locus_tag="mCG_52384"
FT                   /product="chemokine (C-C motif) ligand 7"
FT                   /note="gene_id=mCG52384.1 transcript_id=mCT52567.1
FT                   protein_id=mCP23932.2"
FT                   /db_xref="GOA:A9Z1Z1"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:99512"
FT                   /db_xref="UniProtKB/TrEMBL:A9Z1Z1"
FT                   /protein_id="EDL15658.1"
FT   gene            3715808..3720940
FT                   /gene="Ccl11"
FT                   /locus_tag="mCG_8183"
FT                   /note="gene_id=mCG8183.2"
FT   mRNA            join(3715808..3716027,3719664..3719775,3720191..3720940)
FT                   /gene="Ccl11"
FT                   /locus_tag="mCG_8183"
FT                   /product="small chemokine (C-C motif) ligand 11"
FT                   /note="gene_id=mCG8183.2 transcript_id=mCT7628.1 created on
FT                   31-JUL-2002"
FT   CDS             join(3715952..3716027,3719664..3719775,3720191..3720296)
FT                   /codon_start=1
FT                   /gene="Ccl11"
FT                   /locus_tag="mCG_8183"
FT                   /product="small chemokine (C-C motif) ligand 11"
FT                   /note="gene_id=mCG8183.2 transcript_id=mCT7628.1
FT                   protein_id=mCP1016.1"
FT                   /protein_id="EDL15659.1"
FT   assembly_gap    3734147..3773082
FT                   /estimated_length=38936
FT                   /gap_type="unknown"
FT   gene            3778346..3779958
FT                   /locus_tag="mCG_114938"
FT                   /note="gene_id=mCG114938.0"
FT   mRNA            join(3778346..3778475,3779202..3779313,3779692..3779958)
FT                   /locus_tag="mCG_114938"
FT                   /product="mCG114938"
FT                   /note="gene_id=mCG114938.0 transcript_id=mCT116036.0
FT                   created on 31-JUL-2002"
FT   CDS             join(3778400..3778475,3779202..3779313,3779692..3779797)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114938"
FT                   /product="mCG114938"
FT                   /note="gene_id=mCG114938.0 transcript_id=mCT116036.0
FT                   protein_id=mCP85364.1"
FT                   /db_xref="GOA:Q149U7"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:101878"
FT                   /db_xref="UniProtKB/TrEMBL:Q149U7"
FT                   /protein_id="EDL15660.1"
FT   assembly_gap    3786081..3787793
FT                   /estimated_length=1713
FT                   /gap_type="unknown"
FT   assembly_gap    3805950..3807868
FT                   /estimated_length=1919
FT                   /gap_type="unknown"
FT   assembly_gap    3814808..3814912
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    3818572..3818733
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3835830..3835981
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    3840163..3840182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3840708..3969829)
FT                   /locus_tag="mCG_145730"
FT                   /note="gene_id=mCG145730.0"
FT   mRNA            complement(join(3840708..3840960,3841838..3841952,
FT                   3860566..3860707,3860940..3861142,3924661..3924848,
FT                   3925812..3925907,3929935..3930553,3934152..3934264,
FT                   3935466..3935537,3967537..3967667,3969639..3969829))
FT                   /locus_tag="mCG_145730"
FT                   /product="mCG145730"
FT                   /note="gene_id=mCG145730.0 transcript_id=mCT185504.0
FT                   created on 10-JUN-2003"
FT   gene            complement(3840708..3843636)
FT                   /locus_tag="mCG_8193"
FT                   /note="gene_id=mCG8193.2"
FT   mRNA            complement(join(3840708..3841059,3841838..3841952,
FT                   3843488..3843631))
FT                   /locus_tag="mCG_8193"
FT                   /product="mCG8193, transcript variant mCT185505"
FT                   /note="gene_id=mCG8193.2 transcript_id=mCT185505.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(3840709..3840960,3841838..3841952,
FT                   3843488..3843636))
FT                   /locus_tag="mCG_8193"
FT                   /product="mCG8193, transcript variant mCT7613"
FT                   /note="gene_id=mCG8193.2 transcript_id=mCT7613.0 created on
FT                   10-JUN-2003"
FT   CDS             complement(join(3840873..3840960,3841838..3841952,
FT                   3843488..3843563))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8193"
FT                   /product="mCG8193, isoform CRA_b"
FT                   /note="gene_id=mCG8193.2 transcript_id=mCT7613.0
FT                   protein_id=mCP1010.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q0VB35"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:98258"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VB35"
FT                   /protein_id="EDL15663.1"
FT   CDS             complement(join(3840993..3841059,3841838..3841952,
FT                   3843488..3843563))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8193"
FT                   /product="mCG8193, isoform CRA_a"
FT                   /note="gene_id=mCG8193.2 transcript_id=mCT185505.0
FT                   protein_id=mCP106762.0 isoform=CRA_a"
FT                   /db_xref="GOA:B1AVL8"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:98258"
FT                   /db_xref="UniProtKB/TrEMBL:B1AVL8"
FT                   /protein_id="EDL15662.1"
FT   CDS             complement(join(3860640..3860707,3860940..3861142,
FT                   3924661..3924680))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145730"
FT                   /product="mCG145730"
FT                   /note="gene_id=mCG145730.0 transcript_id=mCT185504.0
FT                   protein_id=mCP106763.0"
FT                   /protein_id="EDL15661.1"
FT   assembly_gap    3861391..3861429
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    3880689..3880708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3892854..3893458
FT                   /estimated_length=605
FT                   /gap_type="unknown"
FT   assembly_gap    3898006..3898142
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    3901774..3901793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3934806..3934825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3966659..3966777
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    3985968..3986095
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    4002270..4002289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4013912..4013931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4021042..4021061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4022967..4023284
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   gene            4053183..4110550
FT                   /gene="Tmem132e"
FT                   /locus_tag="mCG_49309"
FT                   /note="gene_id=mCG49309.2"
FT   mRNA            join(4053183..4053397,4098468..4098925,4099202..4099404,
FT                   4101127..4101273,4101524..4101716,4102464..4102607,
FT                   4104654..4104859,4106685..4106973,4107595..4107786,
FT                   4108492..4110550)
FT                   /gene="Tmem132e"
FT                   /locus_tag="mCG_49309"
FT                   /product="transmembrane protein 132E"
FT                   /note="gene_id=mCG49309.2 transcript_id=mCT49492.2 created
FT                   on 13-OCT-2002"
FT   CDS             join(4053331..4053397,4098468..4098925,4099202..4099404,
FT                   4101127..4101273,4101524..4101716,4102464..4102607,
FT                   4104654..4104859,4106685..4106973,4107595..4107786,
FT                   4108492..4109541)
FT                   /codon_start=1
FT                   /gene="Tmem132e"
FT                   /locus_tag="mCG_49309"
FT                   /product="transmembrane protein 132E"
FT                   /note="gene_id=mCG49309.2 transcript_id=mCT49492.2
FT                   protein_id=mCP23928.2"
FT                   /protein_id="EDL15664.1"
FT   assembly_gap    4063888..4063907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4077662..4077752
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    4083198..4083217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4133411..4133430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4186625..4186851
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    4209169..4209202
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    4247424..4247443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4273281..4273300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4277948..4278113
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    4283277..4283296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4297623..4300579
FT                   /locus_tag="mCG_1050993"
FT                   /note="gene_id=mCG1050993.0"
FT   mRNA            join(4297623..4297755,4297846..4297971,4298619..4300579)
FT                   /locus_tag="mCG_1050993"
FT                   /product="mCG1050993"
FT                   /note="gene_id=mCG1050993.0 transcript_id=mCT194782.0
FT                   created on 27-JAN-2005"
FT   CDS             4299296..4299559
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050993"
FT                   /product="mCG1050993"
FT                   /note="gene_id=mCG1050993.0 transcript_id=mCT194782.0
FT                   protein_id=mCP115811.0"
FT                   /db_xref="MGI:MGI:3651541"
FT                   /db_xref="UniProtKB/TrEMBL:Q6R5E2"
FT                   /protein_id="EDL15665.1"
FT   assembly_gap    4307634..4307653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4319637..4320442
FT                   /estimated_length=806
FT                   /gap_type="unknown"
FT   assembly_gap    4354277..4355236
FT                   /estimated_length=960
FT                   /gap_type="unknown"
FT   assembly_gap    4358389..4358408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4358926..4358945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4383261..>4428351)
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /note="gene_id=mCG8191.2"
FT   mRNA            complement(join(4383261..4383445,4383946..4384018,
FT                   4386392..4386494,4387825..4387958,4400343..4400490,
FT                   4401120..4401216,4403652..4403734,4405305..4405464,
FT                   4406039..4406149,4417663..4417766,4418991..4419164,
FT                   4424379..4424513,4426217..4426280,4428051..>4428351))
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /product="chaperonin subunit 6b (zeta), transcript variant
FT                   mCT191013"
FT                   /note="gene_id=mCG8191.2 transcript_id=mCT191013.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4383261..4383445,4383946..4384018,
FT                   4386392..4386494,4387825..4387958,4400343..4400490,
FT                   4401120..4401216,4403652..4403734,4405305..4405464,
FT                   4406039..4406149,4417663..4417766,4418991..4419164,
FT                   4424379..4424513,4426217..4426280,4428120..4428335))
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /product="chaperonin subunit 6b (zeta), transcript variant
FT                   mCT7612"
FT                   /note="gene_id=mCG8191.2 transcript_id=mCT7612.1 created on
FT                   31-JUL-2002"
FT   CDS             complement(join(4383373..4383445,4383946..4384018,
FT                   4386392..4386494,4387825..4387958,4400343..4400490,
FT                   4401120..4401216,4403652..4403734,4405305..4405464,
FT                   4406039..4406149,4417663..4417766,4418991..4419164,
FT                   4424379..4424513,4426217..4426280,4428120..4428256))
FT                   /codon_start=1
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /product="chaperonin subunit 6b (zeta), isoform CRA_b"
FT                   /note="gene_id=mCG8191.2 transcript_id=mCT7612.1
FT                   protein_id=mCP1009.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q497N0"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012722"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="MGI:MGI:1329013"
FT                   /db_xref="UniProtKB/TrEMBL:Q497N0"
FT                   /protein_id="EDL15667.1"
FT                   VDEIMRAGMSSLRD"
FT   CDS             complement(join(4383373..4383445,4383946..4384018,
FT                   4386392..4386494,4387825..4387958,4400343..4400490,
FT                   4401120..4401216,4403652..4403734,4405305..4405464,
FT                   4406039..4406149,4417663..4417766,4418991..4419164,
FT                   4424379..4424513,4426217..4426280,4428051..>4428115))
FT                   /codon_start=1
FT                   /gene="Cct6b"
FT                   /locus_tag="mCG_8191"
FT                   /product="chaperonin subunit 6b (zeta), isoform CRA_a"
FT                   /note="gene_id=mCG8191.2 transcript_id=mCT191013.0
FT                   protein_id=mCP111992.0 isoform=CRA_a"
FT                   /protein_id="EDL15666.1"
FT   assembly_gap    4393625..4393644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4428383..4429956
FT                   /gene="Ccdc16"
FT                   /locus_tag="mCG_8189"
FT                   /note="gene_id=mCG8189.0"
FT   mRNA            4428383..4429956
FT                   /gene="Ccdc16"
FT                   /locus_tag="mCG_8189"
FT                   /product="coiled-coil domain containing 16"
FT                   /note="gene_id=mCG8189.0 transcript_id=mCT7618.0 created on
FT                   31-JUL-2002"
FT   CDS             4428401..4429492
FT                   /codon_start=1
FT                   /gene="Ccdc16"
FT                   /locus_tag="mCG_8189"
FT                   /product="coiled-coil domain containing 16"
FT                   /note="gene_id=mCG8189.0 transcript_id=mCT7618.0
FT                   protein_id=mCP1018.1"
FT                   /protein_id="EDL15668.1"
FT   assembly_gap    4432631..4432650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4445230..4466116
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /note="gene_id=mCG8187.1"
FT   mRNA            join(4445230..4445289,4447254..4447807,4449223..4449366,
FT                   4451536..4451736,4452672..4452823,4453455..4453621,
FT                   4453725..4453802,4454381..4454549,4455945..4456100,
FT                   4457782..4457913,4458412..4458491,4459273..4459360,
FT                   4459617..4459694,4459936..4460059,4461214..4461356,
FT                   4461682..4461756,4462164..4462310,4463330..4463528,
FT                   4464084..4464205,4465189..4466116)
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /product="ligase III, DNA, ATP-dependent, transcript
FT                   variant mCT7617"
FT                   /note="gene_id=mCG8187.1 transcript_id=mCT7617.1 created on
FT                   31-JUL-2002"
FT   mRNA            join(4445230..4445289,4447254..4447807,4449223..4449366,
FT                   4451536..4451736,4452672..4452823,4453455..4453621,
FT                   4453725..4453802,4454381..4454549,4455945..4456100,
FT                   4457782..4457913,4458412..4458491,4459273..4459360,
FT                   4459617..4459694,4459936..4460059,4461214..4461356,
FT                   4461682..4461756,4462164..4462310,4463330..4463528,
FT                   4464084..4464205,4464407..4464561)
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /product="ligase III, DNA, ATP-dependent, transcript
FT                   variant mCT171279"
FT                   /note="gene_id=mCG8187.1 transcript_id=mCT171279.0 created
FT                   on 31-JUL-2002"
FT   assembly_gap    4445524..4445590
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   CDS             join(4447258..4447807,4449223..4449366,4451536..4451736,
FT                   4452672..4452823,4453455..4453621,4453725..4453802,
FT                   4454381..4454549,4455945..4456100,4457782..4457913,
FT                   4458412..4458491,4459273..4459360,4459617..4459694,
FT                   4459936..4460059,4461214..4461356,4461682..4461756,
FT                   4462164..4462310,4463330..4463528,4464084..4464205,
FT                   4465189..4465422)
FT                   /codon_start=1
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /product="ligase III, DNA, ATP-dependent, isoform CRA_a"
FT                   /note="gene_id=mCG8187.1 transcript_id=mCT7617.1
FT                   protein_id=mCP1014.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q80ZH7"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR031916"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="InterPro:IPR036957"
FT                   /db_xref="MGI:MGI:109152"
FT                   /db_xref="UniProtKB/TrEMBL:Q80ZH7"
FT                   /protein_id="EDL15669.1"
FT   CDS             join(4447258..4447807,4449223..4449366,4451536..4451736,
FT                   4452672..4452823,4453455..4453621,4453725..4453802,
FT                   4454381..4454549,4455945..4456100,4457782..4457913,
FT                   4458412..4458491,4459273..4459360,4459617..4459694,
FT                   4459936..4460059,4461214..4461356,4461682..4461756,
FT                   4462164..4462310,4463330..4463528,4464084..4464205,
FT                   4464407..4464463)
FT                   /codon_start=1
FT                   /gene="Lig3"
FT                   /locus_tag="mCG_8187"
FT                   /product="ligase III, DNA, ATP-dependent, isoform CRA_b"
FT                   /note="gene_id=mCG8187.1 transcript_id=mCT171279.0
FT                   protein_id=mCP94198.0 isoform=CRA_b"
FT                   /db_xref="GOA:B1AT03"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR001510"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="InterPro:IPR036957"
FT                   /db_xref="MGI:MGI:109152"
FT                   /db_xref="UniProtKB/TrEMBL:B1AT03"
FT                   /protein_id="EDL15670.1"
FT   gene            complement(4469448..>4535293)
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /note="gene_id=mCG8186.1"
FT   mRNA            complement(join(4469448..4470103,4472427..4472450,
FT                   4473922..4474132,4474942..4475025,4476314..4476757,
FT                   4482328..4482515,4535081..>4535293))
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, transcript variant mCT7616"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT7616.1 created on
FT                   31-JUL-2002"
FT   mRNA            complement(join(4469515..4470103,4472427..4472450,
FT                   4473922..4474132,4476314..4476724,4482328..4482515,
FT                   4492642..4492942))
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, transcript variant mCT171278"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT171278.0 created
FT                   on 31-JUL-2002"
FT   assembly_gap    4469847..4469866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(4469922..4470103,4472427..4472450,
FT                   4473922..4474132,4474942..4475025,4476314..4476757,
FT                   4482328..4482515,4535081..>4535291))
FT                   /codon_start=1
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, isoform CRA_c"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT7616.1
FT                   protein_id=mCP1017.1 isoform=CRA_c partial"
FT                   /protein_id="EDL15673.1"
FT   CDS             complement(join(4469922..4470103,4472427..4472450,
FT                   4473922..4474132,4476314..4476724,4482328..4482507))
FT                   /codon_start=1
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, isoform CRA_b"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT171278.0
FT                   protein_id=mCP94196.0 isoform=CRA_b partial"
FT                   /db_xref="GOA:Q148A8"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="MGI:MGI:1914588"
FT                   /db_xref="UniProtKB/TrEMBL:Q148A8"
FT                   /protein_id="EDL15672.1"
FT   mRNA            complement(join(4471336..4471451,4472427..4472450,
FT                   4473922..4474132,4476314..4476724,4482328..4482515,
FT                   4492642..4492956))
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, transcript variant mCT171277"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT171277.0 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(4471396..4471451,4472427..4472450,
FT                   4473922..4474132,4476314..4476724,4482328..4482507))
FT                   /codon_start=1
FT                   /gene="Rffl"
FT                   /locus_tag="mCG_8186"
FT                   /product="ring finger and FYVE like domain containing
FT                   protein, isoform CRA_a"
FT                   /note="gene_id=mCG8186.1 transcript_id=mCT171277.0
FT                   protein_id=mCP94197.0 isoform=CRA_a"
FT                   /protein_id="EDL15671.1"
FT                   EVFFDLMFHSYV"
FT   assembly_gap    4534073..4534237
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   gene            complement(4540460..4554249)
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /note="gene_id=mCG8185.2"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545224..4545294,4545409..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553604..4553665,
FT                   4553972..4554249))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT171275"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171275.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547493..4547574,4553326..4553444,4553604..4553665,
FT                   4553972..4554249))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT171274"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171274.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4546494..4546589,4547100..4547234,4547493..4547574,
FT                   4553326..4553444,4553604..4553665,4553972..4554249))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT171273"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171273.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545394..4545484,4546494..4546589,4547100..4547234,
FT                   4547493..4547574,4553326..4553444,4553604..4553665,
FT                   4553972..4554249))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT171276"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171276.1 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553326..4553444,
FT                   4553604..4553665,4553972..4554244))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT7619"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT7619.2 created on
FT                   11-JUN-2003"
FT   mRNA            complement(join(4540460..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553604..4553665,
FT                   4553972..>4554216))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT191049"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191049.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4542760..4543046,4543210..4543377,
FT                   4545224..4545294,4545409..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553326..4553444,
FT                   4553604..4553665,4553972..>4554223))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT191050"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191050.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(4542760..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553303..4553444,
FT                   4553604..4553665,4553972..>4554223))
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), transcript variant
FT                   mCT191051"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191051.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545409..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553326..4553444,
FT                   4553604..4553665,4553972..>4554140))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_d"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191050.0
FT                   protein_id=mCP112018.0 isoform=CRA_d"
FT                   /protein_id="EDL15677.1"
FT                   TEEQSPELPGKQT"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547493..4547574,4553326..4553444,4553604..4553665,
FT                   4553972..4554053))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171274.1
FT                   protein_id=mCP94195.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9EPC0"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261809"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EPC0"
FT                   /protein_id="EDL15674.1"
FT                   KQT"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4546494..4546589,4547100..4547234,4547493..4547574,
FT                   4553326..4553444,4553604..4553665,4553972..4554053))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_f"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171273.1
FT                   protein_id=mCP94194.1 isoform=CRA_f"
FT                   /db_xref="GOA:Q9EP85"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261809"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EP85"
FT                   /protein_id="EDL15679.1"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553326..4553444,
FT                   4553604..4553665,4553972..4554053))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_h"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT7619.2
FT                   protein_id=mCP1012.2 isoform=CRA_h"
FT                   /db_xref="GOA:Q9EQS6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQS6"
FT                   /protein_id="EDL15681.1"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553604..>4553629))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_c"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191049.0
FT                   protein_id=mCP112017.0 isoform=CRA_c"
FT                   /protein_id="EDL15676.1"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545394..4545484,4546494..4546589,
FT                   4547100..4547234,4547493..4547574,4553303..>4553370))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_e"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT191051.0
FT                   protein_id=mCP112019.0 isoform=CRA_e"
FT                   /protein_id="EDL15678.1"
FT   CDS             complement(join(4542963..4543046,4543210..4543377,
FT                   4545224..4545294,4545409..4545484,4546494..4546589,
FT                   4547100..4547159))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171275.1
FT                   protein_id=mCP94193.1 isoform=CRA_b"
FT                   /protein_id="EDL15675.1"
FT   CDS             complement(join(4543343..4543377,4545394..4545484,
FT                   4546494..4546589,4547100..4547234,4547493..4547574,
FT                   4553326..4553444,4553604..4553665,4553972..4554053))
FT                   /codon_start=1
FT                   /gene="Rad51l3"
FT                   /locus_tag="mCG_8185"
FT                   /product="RAD51-like 3 (S. cerevisiae), isoform CRA_g"
FT                   /note="gene_id=mCG8185.2 transcript_id=mCT171276.1
FT                   protein_id=mCP94192.1 isoform=CRA_g"
FT                   /db_xref="GOA:Q9EPA9"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1261809"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EPA9"
FT                   /protein_id="EDL15680.1"
FT                   GDQPLDSRLGW"
FT   gene            4555708..4564451
FT                   /locus_tag="mCG_8190"
FT                   /note="gene_id=mCG8190.1"
FT   mRNA            join(4555708..4555986,4561203..4561572,4562245..4562481,
FT                   4563171..4564451)
FT                   /locus_tag="mCG_8190"
FT                   /product="mCG8190"
FT                   /note="gene_id=mCG8190.1 transcript_id=mCT7611.1 created on
FT                   28-AUG-2002"
FT   CDS             join(4555781..4555986,4561203..4561572,4562245..4562481,
FT                   4563171..4563323)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8190"
FT                   /product="mCG8190"
FT                   /note="gene_id=mCG8190.1 transcript_id=mCT7611.1
FT                   protein_id=mCP1011.2"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="MGI:MGI:1926169"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQ03"
FT                   /protein_id="EDL15682.1"
FT   assembly_gap    4556783..4557204
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   gene            complement(4564418..4576926)
FT                   /gene="Nle1"
FT                   /locus_tag="mCG_8192"
FT                   /note="gene_id=mCG8192.1"
FT   mRNA            complement(join(4564418..4564701,4565208..4565278,
FT                   4565360..4565519,4566646..4566848,4567795..4567841,
FT                   4567945..4568080,4568497..4568680,4569790..4569992,
FT                   4570777..4570823,4570943..4571078,4571505..4571644,
FT                   4573461..4573537,4573828..4573925,4574057..4574133,
FT                   4574975..4575054,4576110..4576327,4576649..4576792,
FT                   4576896..4576926))
FT                   /gene="Nle1"
FT                   /locus_tag="mCG_8192"
FT                   /product="notchless homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG8192.1 transcript_id=mCT7610.2 created on
FT                   13-OCT-2002"
FT   CDS             complement(join(4564689..4564701,4565208..4565278,
FT                   4565360..4565519,4566646..4566848,4567795..4567841,
FT                   4567945..4568080,4568497..4568680,4569790..4569992,
FT                   4570777..4570823,4570943..4571078,4571505..4571644,
FT                   4573461..4573537,4573828..4573925,4574057..4574133,
FT                   4574975..4575054,4576110..4576327,4576649..4576792,
FT                   4576896..4576913))
FT                   /codon_start=1
FT                   /gene="Nle1"
FT                   /locus_tag="mCG_8192"
FT                   /product="notchless homolog 1 (Drosophila)"
FT                   /note="gene_id=mCG8192.1 transcript_id=mCT7610.2
FT                   protein_id=mCP1013.2"
FT                   /protein_id="EDL15683.1"
FT   assembly_gap    4567682..4567701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4568777..4568796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4570225..4570431
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    4571660..4571679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4572829..4572965
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            4579839..4610357
FT                   /gene="Unc45b"
FT                   /locus_tag="mCG_8194"
FT                   /note="gene_id=mCG8194.2"
FT   mRNA            join(4579839..4579914,4580235..4580423,4581392..4581428,
FT                   4582188..4582363,4584046..4584135,4585996..4586163,
FT                   4586693..4586861,4590170..4590341,4594339..4594639,
FT                   4597108..4597202,4597385..4597532,4597874..4598014,
FT                   4601100..4601227,4602013..4602079,4603583..4603696,
FT                   4604033..4604148,4604951..4605068,4607404..4607559,
FT                   4609706..4610357)
FT                   /gene="Unc45b"
FT                   /locus_tag="mCG_8194"
FT                   /product="unc-45 homolog B (C. elegans)"
FT                   /note="gene_id=mCG8194.2 transcript_id=mCT7614.2 created on
FT                   13-OCT-2002"
FT   CDS             join(4580235..4580423,4581392..4581428,4582188..4582363,
FT                   4584046..4584135,4585996..4586163,4586693..4586861,
FT                   4590170..4590341,4594339..4594639,4597108..4597202,
FT                   4597385..4597532,4597874..4598014,4601100..4601227,
FT                   4602013..4602079,4603583..4603696,4604033..4604148,
FT                   4604951..4605068,4607404..4607559,4609706..4609966)
FT                   /codon_start=1
FT                   /gene="Unc45b"
FT                   /locus_tag="mCG_8194"
FT                   /product="unc-45 homolog B (C. elegans)"
FT                   /note="gene_id=mCG8194.2 transcript_id=mCT7614.2
FT                   protein_id=mCP1003.2"
FT                   /protein_id="EDL15684.1"
FT                   MDYGFIKPVS"
FT   assembly_gap    4581266..4581285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4587775..4587794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4591170..4592195
FT                   /estimated_length=1026
FT                   /gap_type="unknown"
FT   assembly_gap    4600244..4600546
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   gene            complement(4609559..4627889)
FT                   /locus_tag="mCG_1050995"
FT                   /note="gene_id=mCG1050995.0"
FT   mRNA            complement(join(4609559..4609856,4610669..4610864,
FT                   4627836..4627889))
FT                   /locus_tag="mCG_1050995"
FT                   /product="mCG1050995"
FT                   /note="gene_id=mCG1050995.0 transcript_id=mCT194784.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(4609651..4609856,4610669..4610768))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050995"
FT                   /product="mCG1050995"
FT                   /note="gene_id=mCG1050995.0 transcript_id=mCT194784.0
FT                   protein_id=mCP115813.0"
FT                   /db_xref="MGI:MGI:1923642"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DAQ2"
FT                   /protein_id="EDL15685.1"
FT   assembly_gap    4618766..4618794
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            <4619333..4630171
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /note="gene_id=mCG8197.3"
FT   mRNA            join(<4619333..4619427,4621947..4622012,4623495..4624522,
FT                   4625907..4626032,4627236..4627959,4628131..4630171)
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /product="schlafen 5, transcript variant mCT191024"
FT                   /note="gene_id=mCG8197.3 transcript_id=mCT191024.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4619333..4619427,4621947..4622012,4623495..4624522,
FT                   4625907..4626032,4627236..4627959,4628131..4628935)
FT                   /codon_start=1
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /product="schlafen 5, isoform CRA_a"
FT                   /note="gene_id=mCG8197.3 transcript_id=mCT191024.0
FT                   protein_id=mCP111993.0 isoform=CRA_a"
FT                   /protein_id="EDL15686.1"
FT                   CLASRARTHLYIVKVVF"
FT   mRNA            join(4619349..4619427,4621947..4622012,4623495..4624522,
FT                   4625907..4626032,4627236..4627434,4629943..4630167)
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /product="schlafen 5, transcript variant mCT7607"
FT                   /note="gene_id=mCG8197.3 transcript_id=mCT7607.2 created on
FT                   13-OCT-2002"
FT   CDS             join(4623523..4624522,4625907..4626032,4627236..4627434,
FT                   4629943..4630027)
FT                   /codon_start=1
FT                   /gene="Slfn5"
FT                   /locus_tag="mCG_8197"
FT                   /product="schlafen 5, isoform CRA_b"
FT                   /note="gene_id=mCG8197.3 transcript_id=mCT7607.2
FT                   protein_id=mCP1008.2 isoform=CRA_b"
FT                   /protein_id="EDL15687.1"
FT                   RDDLQEQIMKT"
FT   assembly_gap    4630899..4630918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4636990..4637009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4638566..4638585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4643405..4643424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4644464..4644483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4646840..4650860
FT                   /estimated_length=4021
FT                   /gap_type="unknown"
FT   gene            complement(4652411..4695321)
FT                   /locus_tag="mCG_118877"
FT                   /note="gene_id=mCG118877.1"
FT   mRNA            complement(join(4652411..4653402,4653570..4654293,
FT                   4655972..4656106,4691568..4692637,4695248..4695321))
FT                   /locus_tag="mCG_118877"
FT                   /product="mCG118877"
FT                   /note="gene_id=mCG118877.1 transcript_id=mCT120052.1
FT                   created on 19-JUN-2003"
FT   CDS             complement(join(4652592..4653402,4653570..4654293,
FT                   4655972..4656106,4691568..4692630))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118877"
FT                   /product="mCG118877"
FT                   /note="gene_id=mCG118877.1 transcript_id=mCT120052.1
FT                   protein_id=mCP85427.1"
FT                   /protein_id="EDL15688.1"
FT   assembly_gap    4657610..4659272
FT                   /estimated_length=1663
FT                   /gap_type="unknown"
FT   assembly_gap    4667129..4668979
FT                   /estimated_length=1851
FT                   /gap_type="unknown"
FT   assembly_gap    4670130..4670228
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    4673032..4673051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4674188..4674207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4675459..4675478
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4682321..4682455
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    4683837..4683856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4689741..4689760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4690767..4690786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4696761..4700230
FT                   /estimated_length=3470
FT                   /gap_type="unknown"
FT   gene            complement(<4703652..>4710032)
FT                   /locus_tag="mCG_118892"
FT                   /note="gene_id=mCG118892.0"
FT   mRNA            complement(join(<4703652..4704375,4706040..4706174,
FT                   4708976..>4710032))
FT                   /locus_tag="mCG_118892"
FT                   /product="mCG118892"
FT                   /note="gene_id=mCG118892.0 transcript_id=mCT120053.0
FT                   created on 13-OCT-2002"
FT   CDS             complement(join(<4703652..4704375,4706040..4706174,
FT                   4708976..4710032))
FT                   /codon_start=1
FT                   /locus_tag="mCG_118892"
FT                   /product="mCG118892"
FT                   /note="gene_id=mCG118892.0 transcript_id=mCT120053.0
FT                   protein_id=mCP85430.0"
FT                   /protein_id="EDL15689.1"
FT                   DFI"
FT   assembly_gap    4718083..4723951
FT                   /estimated_length=5869
FT                   /gap_type="unknown"
FT   gene            4733370..4738967
FT                   /gene="Slfn2"
FT                   /locus_tag="mCG_118881"
FT                   /note="gene_id=mCG118881.0"
FT   mRNA            join(4733370..4733601,4737544..4738967)
FT                   /gene="Slfn2"
FT                   /locus_tag="mCG_118881"
FT                   /product="schlafen 2"
FT                   /note="gene_id=mCG118881.0 transcript_id=mCT120041.0
FT                   created on 31-JUL-2002"
FT   CDS             join(4733552..4733601,4737544..4738630)
FT                   /codon_start=1
FT                   /gene="Slfn2"
FT                   /locus_tag="mCG_118881"
FT                   /product="schlafen 2"
FT                   /note="gene_id=mCG118881.0 transcript_id=mCT120041.0
FT                   protein_id=mCP85326.1"
FT                   /db_xref="GOA:Q9Z0I6"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR029684"
FT                   /db_xref="MGI:MGI:1313258"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z0I6"
FT                   /protein_id="EDL15690.1"
FT   assembly_gap    4741309..4744315
FT                   /estimated_length=3007
FT                   /gap_type="unknown"
FT   assembly_gap    4756586..4756605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4780974..4780993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4785507..4791321
FT                   /gene="Slfn1"
FT                   /locus_tag="mCG_18884"
FT                   /note="gene_id=mCG18884.0"
FT   mRNA            join(4785507..4785724,4789683..4791321)
FT                   /gene="Slfn1"
FT                   /locus_tag="mCG_18884"
FT                   /product="schlafen 1"
FT                   /note="gene_id=mCG18884.0 transcript_id=mCT15931.0 created
FT                   on 31-JUL-2002"
FT   CDS             4789722..4790735
FT                   /codon_start=1
FT                   /gene="Slfn1"
FT                   /locus_tag="mCG_18884"
FT                   /product="schlafen 1"
FT                   /note="gene_id=mCG18884.0 transcript_id=mCT15931.0
FT                   protein_id=mCP3883.1"
FT                   /db_xref="GOA:Q9Z0I7"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR029684"
FT                   /db_xref="MGI:MGI:1313259"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z0I7"
FT                   /protein_id="EDL15691.1"
FT   assembly_gap    4804650..4807380
FT                   /estimated_length=2731
FT                   /gap_type="unknown"
FT   gene            4809238..4824266
FT                   /locus_tag="mCG_118890"
FT                   /note="gene_id=mCG118890.2"
FT   mRNA            join(4809238..4809445,4809615..4809696,4809880..4809965,
FT                   4810129..4810851,4813726..4813811,4819323..4819501,
FT                   4820580..4821619,4822718..4824265)
FT                   /locus_tag="mCG_118890"
FT                   /product="mCG118890, transcript variant mCT120050"
FT                   /note="gene_id=mCG118890.2 transcript_id=mCT120050.2
FT                   created on 16-JUN-2003"
FT   mRNA            join(4810655..4810851,4813726..4813811,4822718..4824266)
FT                   /locus_tag="mCG_118890"
FT                   /product="mCG118890, transcript variant mCT174212"
FT                   /note="gene_id=mCG118890.2 transcript_id=mCT174212.1
FT                   created on 16-JUN-2003"
FT   CDS             join(4820842..4821619,4822718..4823349)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118890"
FT                   /product="mCG118890, isoform CRA_a"
FT                   /note="gene_id=mCG118890.2 transcript_id=mCT120050.2
FT                   protein_id=mCP85420.1 isoform=CRA_a"
FT                   /protein_id="EDL15692.1"
FT                   FSRNVLTHIRI"
FT   CDS             4822720..4823349
FT                   /codon_start=1
FT                   /locus_tag="mCG_118890"
FT                   /product="mCG118890, isoform CRA_b"
FT                   /note="gene_id=mCG118890.2 transcript_id=mCT174212.1
FT                   protein_id=mCP97131.0 isoform=CRA_b"
FT                   /db_xref="GOA:A0A1L1SUL4"
FT                   /db_xref="InterPro:IPR029684"
FT                   /db_xref="MGI:MGI:1329010"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1L1SUL4"
FT                   /protein_id="EDL15693.1"
FT   gene            4825384..4849829
FT                   /locus_tag="mCG_141260"
FT                   /note="gene_id=mCG141260.0"
FT   mRNA            join(4825384..4825463,4846590..4847659,4848534..4849829)
FT                   /locus_tag="mCG_141260"
FT                   /product="mCG141260"
FT                   /note="gene_id=mCG141260.0 transcript_id=mCT174215.0
FT                   created on 13-OCT-2002"
FT   CDS             join(4846720..4847659,4848534..4849147)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141260"
FT                   /product="mCG141260"
FT                   /note="gene_id=mCG141260.0 transcript_id=mCT174215.0
FT                   protein_id=mCP97134.0"
FT                   /db_xref="GOA:Q9Z0I5"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR029684"
FT                   /db_xref="MGI:MGI:1329005"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z0I5"
FT                   /protein_id="EDL15694.1"
FT                   "
FT   gene            4857592..4860631
FT                   /locus_tag="mCG_118897"
FT                   /note="gene_id=mCG118897.1"
FT   mRNA            join(4857592..4857697,4858499..4858678,4859581..4860631)
FT                   /locus_tag="mCG_118897"
FT                   /product="mCG118897, transcript variant mCT120059"
FT                   /note="gene_id=mCG118897.1 transcript_id=mCT120059.1
FT                   created on 13-OCT-2002"
FT   mRNA            join(4857655..4857697,4859581..4859947)
FT                   /locus_tag="mCG_118897"
FT                   /product="mCG118897, transcript variant mCT174213"
FT                   /note="gene_id=mCG118897.1 transcript_id=mCT174213.0
FT                   created on 13-OCT-2002"
FT   CDS             4859608..4859886
FT                   /codon_start=1
FT                   /locus_tag="mCG_118897"
FT                   /product="mCG118897, isoform CRA_a"
FT                   /note="gene_id=mCG118897.1 transcript_id=mCT174213.0
FT                   protein_id=mCP97132.0 isoform=CRA_a"
FT                   /protein_id="EDL15695.1"
FT   CDS             4859608..4859886
FT                   /codon_start=1
FT                   /locus_tag="mCG_118897"
FT                   /product="mCG118897, isoform CRA_a"
FT                   /note="gene_id=mCG118897.1 transcript_id=mCT120059.1
FT                   protein_id=mCP85470.1 isoform=CRA_a"
FT                   /protein_id="EDL15696.1"
FT   assembly_gap    4882659..4886125
FT                   /estimated_length=3467
FT                   /gap_type="unknown"
FT   assembly_gap    4887292..4887311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4890884..4890903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<4915824..>4920916)
FT                   /locus_tag="mCG_59729"
FT                   /note="gene_id=mCG59729.1"
FT   mRNA            complement(join(<4915824..4916327,4919890..>4920916))
FT                   /locus_tag="mCG_59729"
FT                   /product="mCG59729"
FT                   /note="gene_id=mCG59729.1 transcript_id=mCT59912.1 created
FT                   on 13-OCT-2002"
FT   CDS             complement(join(<4915824..4916327,4919890..4920916))
FT                   /codon_start=1
FT                   /locus_tag="mCG_59729"
FT                   /product="mCG59729"
FT                   /note="gene_id=mCG59729.1 transcript_id=mCT59912.1
FT                   protein_id=mCP33421.1"
FT                   /protein_id="EDL15697.1"
FT   assembly_gap    4917075..4917309
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   gene            complement(4931339..>4935672)
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /note="gene_id=mCG11692.2"
FT   mRNA            complement(join(4931339..4933134,4934182..4934735,
FT                   4935010..4935247,4935406..4935668))
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /product="peroxisomal biogenesis factor 12, transcript
FT                   variant mCT16940"
FT                   /note="gene_id=mCG11692.2 transcript_id=mCT16940.1 created
FT                   on 31-JUL-2002"
FT   mRNA            complement(join(4931340..4933134,4934182..4934735,
FT                   4935010..4935247,4935534..>4935672))
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /product="peroxisomal biogenesis factor 12, transcript
FT                   variant mCT191015"
FT                   /note="gene_id=mCG11692.2 transcript_id=mCT191015.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(4932735..4933134,4934182..4934735,
FT                   4935010..>4935177))
FT                   /codon_start=1
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /product="peroxisomal biogenesis factor 12, isoform CRA_b"
FT                   /note="gene_id=mCG11692.2 transcript_id=mCT191015.0
FT                   protein_id=mCP111959.0 isoform=CRA_b"
FT                   /protein_id="EDL15699.1"
FT   CDS             complement(join(4932735..4933134,4934182..4934735,
FT                   4935010..4935135))
FT                   /codon_start=1
FT                   /gene="Pex12"
FT                   /locus_tag="mCG_11692"
FT                   /product="peroxisomal biogenesis factor 12, isoform CRA_a"
FT                   /note="gene_id=mCG11692.2 transcript_id=mCT16940.1
FT                   protein_id=mCP11659.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TLN1"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="MGI:MGI:2144177"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLN1"
FT                   /protein_id="EDL15698.1"
FT   gene            4939174..5044120
FT                   /gene="Ap2b1"
FT                   /locus_tag="mCG_140993"
FT                   /note="gene_id=mCG140993.0"
FT   mRNA            join(4939174..4939523,4944911..4944970,4953109..4953214,
FT                   4958627..4958762,4961199..4961444,4969666..4969856,
FT                   4972061..4972282,4973023..4973143,4973447..4973542,
FT                   4975993..4976108,4980670..4980835,4981996..4982094,
FT                   4986038..4986297,4990369..4990573,5005028..5005174,
FT                   5008983..5009054,5028781..5028865,5029773..5029859,
FT                   5036842..5036996,5041658..5043084,5043929..5044120)
FT                   /gene="Ap2b1"
FT                   /locus_tag="mCG_140993"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /note="gene_id=mCG140993.0 transcript_id=mCT172631.0
FT                   created on 28-AUG-2002"
FT   CDS             join(4944934..4944970,4953109..4953214,4958627..4958762,
FT                   4961199..4961444,4969666..4969856,4972061..4972282,
FT                   4973023..4973143,4973447..4973542,4975993..4976108,
FT                   4980670..4980835,4981996..4982094,4986038..4986297,
FT                   4990369..4990573,5005028..5005174,5008983..5009054,
FT                   5028781..5028865,5029773..5029859,5036842..5036996,
FT                   5041658..5041732)
FT                   /codon_start=1
FT                   /gene="Ap2b1"
FT                   /locus_tag="mCG_140993"
FT                   /product="adaptor-related protein complex 2, beta 1
FT                   subunit"
FT                   /note="gene_id=mCG140993.0 transcript_id=mCT172631.0
FT                   protein_id=mCP95550.0"
FT                   /protein_id="EDL15700.1"
FT                   KN"
FT   assembly_gap    4976301..4976320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4978076..4978095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4979579..4979598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5006003..5007886
FT                   /estimated_length=1884
FT                   /gap_type="unknown"
FT   assembly_gap    5048656..5049216
FT                   /estimated_length=561
FT                   /gap_type="unknown"
FT   gene            5051580..>5057922
FT                   /gene="Rasl10b"
FT                   /locus_tag="mCG_11691"
FT                   /note="gene_id=mCG11691.2"
FT   mRNA            join(5051580..5051944,5056958..5057082,5057656..>5057922)
FT                   /gene="Rasl10b"
FT                   /locus_tag="mCG_11691"
FT                   /product="RAS-like, family 10, member B"
FT                   /note="gene_id=mCG11691.2 transcript_id=mCT16933.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(5051729..5051944,5056958..5057082,5057656..>5057922)
FT                   /codon_start=1
FT                   /gene="Rasl10b"
FT                   /locus_tag="mCG_11691"
FT                   /product="RAS-like, family 10, member B"
FT                   /note="gene_id=mCG11691.2 transcript_id=mCT16933.2
FT                   protein_id=mCP11649.2"
FT                   /protein_id="EDL15701.1"
FT   gene            complement(5063932..>5068528)
FT                   /gene="RP23-249K18.2"
FT                   /locus_tag="mCG_11686"
FT                   /note="gene_id=mCG11686.2"
FT   mRNA            complement(join(5063932..5064255,5065316..5065423,
FT                   5066355..5066596,5068144..>5068528))
FT                   /gene="RP23-249K18.2"
FT                   /locus_tag="mCG_11686"
FT                   /product="hypothetical protein LOC237891"
FT                   /note="created on 18-OCT-2002"
FT   CDS             complement(join(5064097..5064255,5065316..5065423,
FT                   5066355..5066596,5068144..5068528))
FT                   /codon_start=1
FT                   /gene="RP23-249K18.2"
FT                   /locus_tag="mCG_11686"
FT                   /product="hypothetical protein LOC237891"
FT                   /protein_id="EDL15702.1"
FT                   RKFPLWAWLERHRHSS"
FT   assembly_gap    5075427..5075446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5076854..5080381
FT                   /gene="1700020L24Rik"
FT                   /locus_tag="mCG_11687"
FT                   /note="gene_id=mCG11687.2"
FT   mRNA            join(5076854..5076919,5079452..5079761,5079841..5080381)
FT                   /gene="1700020L24Rik"
FT                   /locus_tag="mCG_11687"
FT                   /product="RIKEN cDNA 1700020L24"
FT                   /note="gene_id=mCG11687.2 transcript_id=mCT16936.2 created
FT                   on 28-AUG-2002"
FT   CDS             join(5076907..5076919,5079452..5079761,5079841..5080087)
FT                   /codon_start=1
FT                   /gene="1700020L24Rik"
FT                   /locus_tag="mCG_11687"
FT                   /product="RIKEN cDNA 1700020L24"
FT                   /note="gene_id=mCG11687.2 transcript_id=mCT16936.2
FT                   protein_id=mCP11666.2"
FT                   /protein_id="EDL15703.1"
FT   assembly_gap    5079163..5079205
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   gene            complement(5081039..5102231)
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /note="gene_id=mCG11680.3"
FT   mRNA            complement(join(5081039..5082111,5082925..5083020,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102121))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT191041"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191041.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(5081039..5082111,5082925..5083062,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102121))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT191042"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191042.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(5081039..5082111,5082925..5083092,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102121))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT191043"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191043.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(<5081717..5082111,5082925..5083092,
FT                   5083985..5084230,5086693..5086917,5090529..5090716,
FT                   5090803..5090882,5101908..5102231))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT16928"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT16928.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(5081717..5082111,5082925..5083020,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102117))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191041.0
FT                   protein_id=mCP111998.0 isoform=CRA_c"
FT                   /protein_id="EDL15706.1"
FT                   GCWNANSGGALF"
FT   CDS             complement(join(5081717..5082111,5082925..5083062,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102117))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191042.0
FT                   protein_id=mCP111999.0 isoform=CRA_d"
FT                   /protein_id="EDL15707.1"
FT   CDS             complement(join(5081717..5082111,5082925..5083092,
FT                   5083377..5083526,5083985..5084230,5086693..5086917,
FT                   5090529..5090716,5090803..5090882,5101908..>5102117))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT191043.0
FT                   protein_id=mCP112000.0 isoform=CRA_e"
FT                   /protein_id="EDL15708.1"
FT   CDS             complement(join(5081717..5082111,5082925..5083092,
FT                   5083985..5084230,5086693..5086917,5090529..5090716,
FT                   5090803..5090882,5101908..5102018))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT16928.2
FT                   protein_id=mCP11658.2 isoform=CRA_a"
FT                   /protein_id="EDL15704.1"
FT                   GCWNANSGGALF"
FT   mRNA            complement(join(5090545..5090716,5090803..5090982,
FT                   5101908..5102231))
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), transcript
FT                   variant mCT174519"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT174519.0 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(5090649..5090716,5090803..5090959))
FT                   /codon_start=1
FT                   /gene="Mmp28"
FT                   /locus_tag="mCG_11680"
FT                   /product="matrix metallopeptidase 28 (epilysin), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11680.3 transcript_id=mCT174519.0
FT                   protein_id=mCP97438.0 isoform=CRA_b"
FT                   /protein_id="EDL15705.1"
FT   assembly_gap    5109385..5115614
FT                   /estimated_length=6230
FT                   /gap_type="unknown"
FT   gene            5119382..5152830
FT                   /gene="Taf15"
FT                   /locus_tag="mCG_118745"
FT                   /note="gene_id=mCG118745.0"
FT   mRNA            join(5119382..5119503,5128229..5128268,5130870..5130921,
FT                   5131029..5131113,5131196..5131298,5133393..5133583,
FT                   5135094..5135214,5143333..5143367,5143965..5143997,
FT                   5145144..5145253,5147178..5147307,5148823..5148915,
FT                   5150313..5150394,5150495..5150583,5150709..5151167,
FT                   5152504..5152830)
FT                   /gene="Taf15"
FT                   /locus_tag="mCG_118745"
FT                   /product="TAF15 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG118745.0 transcript_id=mCT119914.1
FT                   created on 08-NOV-2002"
FT   CDS             join(5119497..5119503,5128229..5128268,5130870..5130921,
FT                   5131029..5131113,5131196..5131298,5133393..5133583,
FT                   5135094..5135214,5143333..5143367,5143965..5143997,
FT                   5145144..5145253,5147178..5147307,5148823..5148915,
FT                   5150313..5150394,5150495..5150583,5150709..5151167,
FT                   5152504..5152808)
FT                   /codon_start=1
FT                   /gene="Taf15"
FT                   /locus_tag="mCG_118745"
FT                   /product="TAF15 RNA polymerase II, TATA box binding protein
FT                   (TBP)-associated factor"
FT                   /note="gene_id=mCG118745.0 transcript_id=mCT119914.1
FT                   protein_id=mCP85045.1"
FT                   /protein_id="EDL15709.1"
FT                   NGKCFVILQ"
FT   assembly_gap    5129817..5129836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5132447..5132537
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   gene            complement(5171842..5176564)
FT                   /gene="Ccl5"
FT                   /locus_tag="mCG_11684"
FT                   /note="gene_id=mCG11684.1"
FT   mRNA            complement(join(5171842..5172127,5175219..5175330,
FT                   5176453..5176564))
FT                   /gene="Ccl5"
FT                   /locus_tag="mCG_11684"
FT                   /product="chemokine (C-C motif) ligand 5"
FT                   /note="gene_id=mCG11684.1 transcript_id=mCT16931.0 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(5172040..5172127,5175219..5175330,
FT                   5176453..5176528))
FT                   /codon_start=1
FT                   /gene="Ccl5"
FT                   /locus_tag="mCG_11684"
FT                   /product="chemokine (C-C motif) ligand 5"
FT                   /note="gene_id=mCG11684.1 transcript_id=mCT16931.0
FT                   protein_id=mCP11675.1"
FT                   /db_xref="GOA:Q5XZF2"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR030595"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:98262"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XZF2"
FT                   /protein_id="EDL15710.1"
FT   assembly_gap    5199891..5199910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5205274..5205293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5220993..5224949)
FT                   /gene="Ccl9"
FT                   /locus_tag="mCG_19020"
FT                   /note="gene_id=mCG19020.1"
FT   mRNA            complement(join(5220993..5221830,5222178..5222286,
FT                   5222710..5222781,5224724..5224949))
FT                   /gene="Ccl9"
FT                   /locus_tag="mCG_19020"
FT                   /product="chemokine (C-C motif) ligand 9"
FT                   /note="gene_id=mCG19020.1 transcript_id=mCT16894.1 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(5221719..5221830,5222178..5222286,
FT                   5222710..5222781,5224724..5224799))
FT                   /codon_start=1
FT                   /gene="Ccl9"
FT                   /locus_tag="mCG_19020"
FT                   /product="chemokine (C-C motif) ligand 9"
FT                   /note="gene_id=mCG19020.1 transcript_id=mCT16894.1
FT                   protein_id=mCP11639.1"
FT                   /db_xref="GOA:Q3U9T8"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:104533"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U9T8"
FT                   /protein_id="EDL15711.1"
FT                   QRCIERLEQNSQPRTYKQ"
FT   assembly_gap    5227652..5228197
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   gene            <5230952..5272627
FT                   /gene="E230016K23Rik"
FT                   /locus_tag="mCG_144658"
FT                   /note="gene_id=mCG144658.0"
FT   mRNA            join(<5230952..5231030,5250190..5250323,5258952..5259076,
FT                   5259763..5259833,5260054..5260153,5269772..5269908,
FT                   5270288..5270459,5270572..5270737,5271470..5272627)
FT                   /gene="E230016K23Rik"
FT                   /locus_tag="mCG_144658"
FT                   /product="RIKEN cDNA E230016K23"
FT                   /note="gene_id=mCG144658.0 transcript_id=mCT184082.0
FT                   created on 05-JUN-2003"
FT   gene            complement(5236795..5241918)
FT                   /gene="Ccl6"
FT                   /locus_tag="mCG_11623"
FT                   /note="gene_id=mCG11623.1"
FT   mRNA            complement(join(5236795..5237842,5238205..5238316,
FT                   5238678..5238725,5241794..5241918))
FT                   /gene="Ccl6"
FT                   /locus_tag="mCG_11623"
FT                   /product="chemokine (C-C motif) ligand 6"
FT                   /note="gene_id=mCG11623.1 transcript_id=mCT16923.1 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(5237728..5237842,5238205..5238316,
FT                   5238678..5238725,5241794..5241869))
FT                   /codon_start=1
FT                   /gene="Ccl6"
FT                   /locus_tag="mCG_11623"
FT                   /product="chemokine (C-C motif) ligand 6"
FT                   /note="gene_id=mCG11623.1 transcript_id=mCT16923.1
FT                   protein_id=mCP11644.2"
FT                   /protein_id="EDL15713.1"
FT                   KQGPRSGNKVIA"
FT   CDS             join(<5270573..5270737,5271470..5271835)
FT                   /codon_start=1
FT                   /gene="E230016K23Rik"
FT                   /locus_tag="mCG_144658"
FT                   /product="RIKEN cDNA E230016K23"
FT                   /note="gene_id=mCG144658.0 transcript_id=mCT184082.0
FT                   protein_id=mCP105658.0"
FT                   /protein_id="EDL15712.1"
FT                   FSALSFVEIRLPS"
FT   gene            complement(5293877..5294561)
FT                   /locus_tag="mCG_50795"
FT                   /note="gene_id=mCG50795.1"
FT   mRNA            complement(5293877..5294561)
FT                   /locus_tag="mCG_50795"
FT                   /product="mCG50795"
FT                   /note="gene_id=mCG50795.1 transcript_id=mCT50978.1 created
FT                   on 11-NOV-2002"
FT   CDS             complement(5293966..5294541)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50795"
FT                   /product="mCG50795"
FT                   /note="gene_id=mCG50795.1 transcript_id=mCT50978.1
FT                   protein_id=mCP33422.0"
FT                   /db_xref="GOA:S4R1R7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="MGI:MGI:3649210"
FT                   /db_xref="UniProtKB/TrEMBL:S4R1R7"
FT                   /protein_id="EDL15714.1"
FT   gene            complement(5296765..5298277)
FT                   /gene="Ccl3"
FT                   /locus_tag="mCG_11624"
FT                   /note="gene_id=mCG11624.0"
FT   mRNA            complement(join(5296765..5297263,5297489..5297600,
FT                   5298122..5298277))
FT                   /gene="Ccl3"
FT                   /locus_tag="mCG_11624"
FT                   /product="chemokine (C-C motif) ligand 3"
FT                   /note="gene_id=mCG11624.0 transcript_id=mCT16924.1 created
FT                   on 31-JUL-2002"
FT   CDS             complement(join(5297173..5297263,5297489..5297600,
FT                   5298122..5298197))
FT                   /codon_start=1
FT                   /gene="Ccl3"
FT                   /locus_tag="mCG_11624"
FT                   /product="chemokine (C-C motif) ligand 3"
FT                   /note="gene_id=mCG11624.0 transcript_id=mCT16924.1
FT                   protein_id=mCP11648.1"
FT                   /db_xref="GOA:Q5QNW0"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:98260"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QNW0"
FT                   /protein_id="EDL15715.1"
FT   gene            5311503..5313598
FT                   /gene="Ccl4"
FT                   /locus_tag="mCG_11627"
FT                   /note="gene_id=mCG11627.1"
FT   mRNA            join(5311503..5311656,5312377..5312491,5313212..5313598)
FT                   /gene="Ccl4"
FT                   /locus_tag="mCG_11627"
FT                   /product="chemokine (C-C motif) ligand 4"
FT                   /note="gene_id=mCG11627.1 transcript_id=mCT16927.1 created
FT                   on 31-JUL-2002"
FT   CDS             join(5311581..5311656,5312377..5312491,5313212..5313299)
FT                   /codon_start=1
FT                   /gene="Ccl4"
FT                   /locus_tag="mCG_11627"
FT                   /product="chemokine (C-C motif) ligand 4"
FT                   /note="gene_id=mCG11627.1 transcript_id=mCT16927.1
FT                   protein_id=mCP11650.2"
FT                   /db_xref="GOA:Q5QNV9"
FT                   /db_xref="InterPro:IPR000827"
FT                   /db_xref="InterPro:IPR001811"
FT                   /db_xref="InterPro:IPR036048"
FT                   /db_xref="MGI:MGI:98261"
FT                   /db_xref="UniProtKB/TrEMBL:Q5QNV9"
FT                   /protein_id="EDL15716.1"
FT   assembly_gap    5344439..5344458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5353210..5355352
FT                   /locus_tag="mCG_147555"
FT                   /note="gene_id=mCG147555.0"
FT   mRNA            join(5353210..5353256,5353877..5354025,5355152..5355352)
FT                   /locus_tag="mCG_147555"
FT                   /product="mCG147555"
FT                   /note="gene_id=mCG147555.0 transcript_id=mCT187818.0
FT                   created on 13-JAN-2004"
FT   CDS             join(5354000..5354025,5355152..5355317)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147555"
FT                   /product="mCG147555"
FT                   /note="gene_id=mCG147555.0 transcript_id=mCT187818.0
FT                   protein_id=mCP109321.0"
FT                   /protein_id="EDL15717.1"
FT                   ALELHSWTRKIYIVVTMP"
FT   gene            5358098..5360422
FT                   /gene="Expi"
FT                   /locus_tag="mCG_11682"
FT                   /note="gene_id=mCG11682.1"
FT   mRNA            join(5358098..5358281,5358939..5359081,5360238..5360422)
FT                   /gene="Expi"
FT                   /locus_tag="mCG_11682"
FT                   /product="extracellular proteinase inhibitor"
FT                   /note="gene_id=mCG11682.1 transcript_id=mCT16930.2 created
FT                   on 31-JUL-2002"
FT   CDS             join(5358200..5358281,5358939..5359081)
FT                   /codon_start=1
FT                   /gene="Expi"
FT                   /locus_tag="mCG_11682"
FT                   /product="extracellular proteinase inhibitor"
FT                   /note="gene_id=mCG11682.1 transcript_id=mCT16930.2
FT                   protein_id=mCP11652.2"
FT                   /protein_id="EDL15718.1"
FT   assembly_gap    5368440..5368472
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            5396150..5401795
FT                   /gene="1100001G20Rik"
FT                   /locus_tag="mCG_1032064"
FT                   /note="gene_id=mCG1032064.1"
FT   mRNA            join(5396150..5396276,5398386..5398486,5401647..5401795)
FT                   /gene="1100001G20Rik"
FT                   /locus_tag="mCG_1032064"
FT                   /product="RIKEN cDNA 1100001G20"
FT                   /note="gene_id=mCG1032064.1 transcript_id=mCT149768.1
FT                   created on 05-SEP-2002"
FT   CDS             join(5396180..5396276,5398386..5398480)
FT                   /codon_start=1
FT                   /gene="1100001G20Rik"
FT                   /locus_tag="mCG_1032064"
FT                   /product="RIKEN cDNA 1100001G20"
FT                   /note="gene_id=mCG1032064.1 transcript_id=mCT149768.1
FT                   protein_id=mCP85151.1"
FT                   /db_xref="GOA:Q8BTE6"
FT                   /db_xref="InterPro:IPR008197"
FT                   /db_xref="InterPro:IPR036645"
FT                   /db_xref="MGI:MGI:1913357"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BTE6"
FT                   /protein_id="EDL15719.1"
FT                   GPEEQCVSIGCSHICTTN"
FT   gene            5402846..5431918
FT                   /locus_tag="mCG_118740"
FT                   /note="gene_id=mCG118740.0"
FT   mRNA            join(5402846..5403094,5403287..5403430,5404858..5404965,
FT                   5406458..5406598,5407437..5407552,5408452..5408566,
FT                   5410047..5410148,5414034..5414171,5415001..5415308,
FT                   5416226..5416403,5418204..5418410,5418816..5418915,
FT                   5421393..5421748,5423018..5423140,5423570..5423656,
FT                   5424851..5424985,5425764..5425886,5426388..5426512,
FT                   5427995..5428091,5428551..5428755,5430301..5431918)
FT                   /locus_tag="mCG_118740"
FT                   /product="mCG118740, transcript variant mCT119912"
FT                   /note="gene_id=mCG118740.0 transcript_id=mCT119912.1
FT                   created on 05-SEP-2002"
FT   mRNA            join(<5402866..5403298,5404858..5404965,5406458..5406598,
FT                   5407437..5407552,5408452..5408566,5410047..5410148,
FT                   5414034..5414171,5415001..5415308,5416226..5416403,
FT                   5418204..5418410,5418816..5418915,5421393..5421748,
FT                   5423018..5423140,5423570..5423656,5424851..5424985,
FT                   5425764..5425886,5426388..5426512,5427995..5428091,
FT                   5428551..5428755,5430301..5431171)
FT                   /locus_tag="mCG_118740"
FT                   /product="mCG118740, transcript variant mCT190999"
FT                   /note="gene_id=mCG118740.0 transcript_id=mCT190999.0
FT                   created on 08-MAR-2004"
FT   CDS             join(5402876..5403094,5403287..5403430,5404858..5404965,
FT                   5406458..5406598,5407437..5407552,5408452..5408566,
FT                   5410047..5410148,5414034..5414171,5415001..5415308,
FT                   5416226..5416403,5418204..5418410,5418816..5418915,
FT                   5421393..5421748,5423018..5423140,5423570..5423656,
FT                   5424851..5424985,5425764..5425886,5426388..5426512,
FT                   5427995..5428091,5428551..5428755,5430301..5430872)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118740"
FT                   /product="mCG118740, isoform CRA_a"
FT                   /note="gene_id=mCG118740.0 transcript_id=mCT119912.1
FT                   protein_id=mCP85541.1 isoform=CRA_a"
FT                   /protein_id="EDL15720.1"
FT                   LRGPSDQ"
FT   CDS             join(<5403278..5403298,5404858..5404965,5406458..5406598,
FT                   5407437..5407552,5408452..5408566,5410047..5410148,
FT                   5414034..5414171,5415001..5415308,5416226..5416403,
FT                   5418204..5418410,5418816..5418915,5421393..5421748,
FT                   5423018..5423140,5423570..5423656,5424851..5424985,
FT                   5425764..5425886,5426388..5426512,5427995..5428091,
FT                   5428551..5428755,5430301..5430872)
FT                   /codon_start=1
FT                   /locus_tag="mCG_118740"
FT                   /product="mCG118740, isoform CRA_b"
FT                   /note="gene_id=mCG118740.0 transcript_id=mCT190999.0
FT                   protein_id=mCP111961.0 isoform=CRA_b"
FT                   /protein_id="EDL15721.1"
FT                   EQVMLRGPSDQ"
FT   gene            5449541..5450695
FT                   /locus_tag="mCG_11619"
FT                   /note="gene_id=mCG11619.2"
FT   mRNA            5449541..5450695
FT                   /locus_tag="mCG_11619"
FT                   /product="mCG11619"
FT                   /note="gene_id=mCG11619.2 transcript_id=mCT16919.2 created
FT                   on 11-NOV-2002"
FT   CDS             5449599..5450174
FT                   /codon_start=1
FT                   /locus_tag="mCG_11619"
FT                   /product="mCG11619"
FT                   /note="gene_id=mCG11619.2 transcript_id=mCT16919.2
FT                   protein_id=mCP11676.2"
FT                   /protein_id="EDL15722.1"
FT   assembly_gap    5463230..5463249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5466727..5498365)
FT                   /locus_tag="mCG_147535"
FT                   /note="gene_id=mCG147535.0"
FT   mRNA            complement(join(5466727..5469488,5498090..5498365))
FT                   /locus_tag="mCG_147535"
FT                   /product="mCG147535"
FT                   /note="gene_id=mCG147535.0 transcript_id=mCT187798.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5467139..5467531)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147535"
FT                   /product="mCG147535"
FT                   /note="gene_id=mCG147535.0 transcript_id=mCT187798.0
FT                   protein_id=mCP109301.0"
FT                   /protein_id="EDL15723.1"
FT   assembly_gap    5482514..5482593
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    5488769..5489029
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    5494387..5494600
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    5497796..5498033
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   gene            5499715..5555231
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /note="gene_id=mCG19019.3"
FT   mRNA            join(5499715..5500080,5513434..5513475,5531931..5532076)
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, transcript variant
FT                   mCT171270"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT171270.0 created
FT                   on 31-JUL-2002"
FT   mRNA            join(<5499889..5500232,5504744..5504943,5510979..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554760)
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, transcript variant
FT                   mCT16893"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT16893.0 created
FT                   on 31-JUL-2002"
FT   mRNA            join(<5499889..5500232,5504744..5504943,5511057..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554419)
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, transcript variant
FT                   mCT171269"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT171269.0 created
FT                   on 31-JUL-2002"
FT   CDS             join(5499889..5500232,5504744..5504943,5510979..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554343)
FT                   /codon_start=1
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, isoform CRA_a"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT16893.0
FT                   protein_id=mCP11677.0 isoform=CRA_a"
FT                   /protein_id="EDL15724.1"
FT   CDS             join(5499889..5500232,5504744..5504943,5511057..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554343)
FT                   /codon_start=1
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, isoform CRA_d"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT171269.0
FT                   protein_id=mCP94189.0 isoform=CRA_d"
FT                   /protein_id="EDL15727.1"
FT                   LTSMSSSKQCPLQAW"
FT   CDS             join(5499889..5500080,5513434..5513475,5531931..5532011)
FT                   /codon_start=1
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, isoform CRA_b"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT171270.0
FT                   protein_id=mCP94188.0 isoform=CRA_b"
FT                   /protein_id="EDL15725.1"
FT                   "
FT   mRNA            join(<5501801..5501955,5504744..5504943,5510979..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5555231)
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, transcript variant
FT                   mCT191026"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT191026.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5501951..5501955,5504744..5504943,5510979..5511243,
FT                   5513240..5513475,5531931..5532091,5538510..5538645,
FT                   5542784..5542978,5545624..5545742,5554323..5554343)
FT                   /codon_start=1
FT                   /gene="Tcf2"
FT                   /locus_tag="mCG_19019"
FT                   /product="transcription factor 2, isoform CRA_c"
FT                   /note="gene_id=mCG19019.3 transcript_id=mCT191026.0
FT                   protein_id=mCP111974.0 isoform=CRA_c"
FT                   /protein_id="EDL15726.1"
FT   assembly_gap    5506224..5506375
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    5509191..5509946
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    5534944..5535692
FT                   /estimated_length=749
FT                   /gap_type="unknown"
FT   assembly_gap    5537694..5537881
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    5540195..5540214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5548808..5548827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5582612..5582631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5591711..5612655
FT                   /gene="Ddx52"
FT                   /locus_tag="mCG_11621"
FT                   /note="gene_id=mCG11621.1"
FT   mRNA            join(5591711..5591841,5592820..5593018,5594113..5594246,
FT                   5595682..5595867,5598024..5598167,5599162..5599273,
FT                   5600869..5600941,5601691..5601894,5602806..5602896,
FT                   5604660..5604782,5604868..5605018,5605551..5605626,
FT                   5607045..5607116,5609026..5609112,5611329..5612655)
FT                   /gene="Ddx52"
FT                   /locus_tag="mCG_11621"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 52"
FT                   /note="gene_id=mCG11621.1 transcript_id=mCT16921.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(5591755..5591841,5592820..5593018,5594113..5594246,
FT                   5595682..5595867,5598024..5598167,5599162..5599273,
FT                   5600869..5600941,5601691..5601894,5602806..5602896,
FT                   5604660..5604782,5604868..5605018,5605551..5605626,
FT                   5607045..5607116,5609026..5609112,5611329..5611386)
FT                   /codon_start=1
FT                   /gene="Ddx52"
FT                   /locus_tag="mCG_11621"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 52"
FT                   /note="gene_id=mCG11621.1 transcript_id=mCT16921.2
FT                   protein_id=mCP11636.2"
FT                   /db_xref="GOA:Q8K301"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1925644"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8K301"
FT                   /protein_id="EDL15728.1"
FT   gene            <5613933..5691738
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /note="gene_id=mCG11683.2"
FT   mRNA            join(<5613933..5613981,5626739..5626860,5628579..5628709,
FT                   5631076..5631181,5637611..5637665,5639355..5639551,
FT                   5640370..5640618,5644004..5644137,5651534..5651646,
FT                   5651849..5651911,5658294..5659226,5669266..5669628,
FT                   5672942..5673105,5673959..5674012,5674676..5674772,
FT                   5676277..5676425,5688872..5688982,5689317..5689352,
FT                   5690458..5691737)
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /product="AP1 gamma subunit binding protein 1, transcript
FT                   variant mCT16934"
FT                   /note="gene_id=mCG11683.2 transcript_id=mCT16934.2 created
FT                   on 18-OCT-2002"
FT   CDS             join(5613933..5613981,5626739..5626860,5628579..5628709,
FT                   5631076..5631181,5637611..5637665,5639355..5639551,
FT                   5640370..5640618,5644004..5644137,5651534..5651646,
FT                   5651849..5651911,5658294..5659226,5669266..5669628,
FT                   5672942..5673105,5673959..5674012,5674676..5674772,
FT                   5676277..5676425,5688872..5688982,5689317..5689352,
FT                   5690458..5690589)
FT                   /codon_start=1
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /product="AP1 gamma subunit binding protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11683.2 transcript_id=mCT16934.2
FT                   protein_id=mCP11660.2 isoform=CRA_a"
FT                   /protein_id="EDL15729.1"
FT   assembly_gap    5614075..5614255
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   mRNA            join(<5621206..5621249,5626742..5626860,5628579..5628709,
FT                   5631076..5631181,5631855..5631966,5637588..5637665,
FT                   5639355..5639551,5640370..5640618,5644004..5644137,
FT                   5651534..5651646,5651849..5651911,5658294..5659226,
FT                   5669266..5669628,5672942..5673105,5673959..5674012,
FT                   5674676..5674772,5676277..5676425,5688872..5688982,
FT                   5690458..5691738)
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /product="AP1 gamma subunit binding protein 1, transcript
FT                   variant mCT191045"
FT                   /note="gene_id=mCG11683.2 transcript_id=mCT191045.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5621207..5621249,5626742..5626860,5628579..5628709,
FT                   5631076..5631181,5631855..5631966,5637588..5637665,
FT                   5639355..5639551,5640370..5640618,5644004..5644137,
FT                   5651534..5651646,5651849..5651911,5658294..5659226,
FT                   5669266..5669628,5672942..5673105,5673959..5674012,
FT                   5674676..5674772,5676277..5676425,5688872..5688982,
FT                   5690458..5690589)
FT                   /codon_start=1
FT                   /gene="Ap1gbp1"
FT                   /locus_tag="mCG_11683"
FT                   /product="AP1 gamma subunit binding protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11683.2 transcript_id=mCT191045.0
FT                   protein_id=mCP112001.0 isoform=CRA_b"
FT                   /protein_id="EDL15730.1"
FT                   GLLLPDLL"
FT   assembly_gap    5672208..5672227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5676007..5676026
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5694961..5695644
FT                   /estimated_length=684
FT                   /gap_type="unknown"
FT   gene            complement(5698105..5719323)
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /note="gene_id=mCG11620.2"
FT   mRNA            complement(join(5698105..5699374,5700896..5700984,
FT                   5718543..5718642,5719135..5719323))
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, transcript
FT                   variant mCT16920"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT16920.2 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5698105..5699374,5700896..5700984,
FT                   5718543..5718642,5718753..5718862))
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, transcript
FT                   variant mCT185272"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT185272.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(5698105..5699374,5700896..5700984,
FT                   5717047..5717142))
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, transcript
FT                   variant mCT185273"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT185273.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(5698681..5699277)
FT                   /codon_start=1
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, isoform CRA_a"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT185272.0
FT                   protein_id=mCP106530.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TLZ7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020417"
FT                   /db_xref="InterPro:IPR020420"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1927168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLZ7"
FT                   /protein_id="EDL15731.1"
FT   CDS             complement(5698681..5699277)
FT                   /codon_start=1
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, isoform CRA_a"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT185273.0
FT                   protein_id=mCP106531.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TLZ7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020417"
FT                   /db_xref="InterPro:IPR020420"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1927168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLZ7"
FT                   /protein_id="EDL15732.1"
FT   CDS             complement(5698681..5699277)
FT                   /codon_start=1
FT                   /gene="Dusp14"
FT                   /locus_tag="mCG_11620"
FT                   /product="dual specificity phosphatase 14, isoform CRA_a"
FT                   /note="gene_id=mCG11620.2 transcript_id=mCT16920.2
FT                   protein_id=mCP11643.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TLZ7"
FT                   /db_xref="InterPro:IPR000340"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR020417"
FT                   /db_xref="InterPro:IPR020420"
FT                   /db_xref="InterPro:IPR020422"
FT                   /db_xref="InterPro:IPR024950"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="MGI:MGI:1927168"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TLZ7"
FT                   /protein_id="EDL15733.1"
FT   assembly_gap    5728059..5728350
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   gene            complement(5728834..5782715)
FT                   /gene="Tada2l"
FT                   /locus_tag="mCG_11688"
FT                   /note="gene_id=mCG11688.1"
FT   mRNA            complement(join(5728834..5729933,5734598..5734641,
FT                   5735523..5735655,5736995..5737066,5740422..5740532,
FT                   5741849..5741892,5743457..5743520,5752928..5753000,
FT                   5754067..5754155,5756064..5756221,5763042..5763133,
FT                   5771303..5771362,5774138..5774244,5780048..5780155,
FT                   5782663..5782715))
FT                   /gene="Tada2l"
FT                   /locus_tag="mCG_11688"
FT                   /product="transcriptional adaptor 2 (ADA2 homolog,
FT                   yeast)-like"
FT                   /note="gene_id=mCG11688.1 transcript_id=mCT16937.2 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(5729887..5729933,5734598..5734641,
FT                   5735523..5735655,5736995..5737066,5740422..5740532,
FT                   5741849..5741892,5743457..5743520,5752928..5753000,
FT                   5754067..5754155,5756064..5756221,5763042..5763133,
FT                   5771303..5771362,5774138..5774244,5780048..5780072))
FT                   /codon_start=1
FT                   /gene="Tada2l"
FT                   /locus_tag="mCG_11688"
FT                   /product="transcriptional adaptor 2 (ADA2 homolog,
FT                   yeast)-like"
FT                   /note="gene_id=mCG11688.1 transcript_id=mCT16937.2
FT                   protein_id=mCP11678.2"
FT                   /protein_id="EDL15734.1"
FT   assembly_gap    5731160..5732455
FT                   /estimated_length=1296
FT                   /gap_type="unknown"
FT   assembly_gap    5761770..5761789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5766332..5766381
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    5780925..5781101
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    5782884..5782913
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    5796665..5796684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5800866..5801350
FT                   /estimated_length=485
FT                   /gap_type="unknown"
FT   assembly_gap    5802639..5802746
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    5804890..5804909
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5813080..5813099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5817764..5817783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5818863..5818882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5819998..5820017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5823230..5823812
FT                   /estimated_length=583
FT                   /gap_type="unknown"
FT   assembly_gap    5827375..5827470
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    5833414..5833467
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    5840826..5841256
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   gene            5849244..6057523
FT                   /gene="Acaca"
FT                   /locus_tag="mCG_141310"
FT                   /note="gene_id=mCG141310.0"
FT   mRNA            join(5849244..5849493,5867952..5868084,5869638..5869776,
FT                   5876902..5877011,5878204..5878285,5879894..5879992,
FT                   5882451..5882557,5885182..5885292,5892341..5892550,
FT                   5896793..5896963,5898722..5898883,5899209..5899372,
FT                   5902929..5903079,5904747..5904850,5910199..5910280,
FT                   5910691..5910836,5912834..5912984,5914135..5914269,
FT                   5915021..5915167,5915907..5916095,5916783..5916883,
FT                   5917550..5917638,5923892..5924016,5930109..5930222,
FT                   5931371..5931484,5932441..5932530,5933967..5934085,
FT                   5943875..5943898,5946478..5946621,5947736..5947784,
FT                   5948738..5948845,5953869..5953925,5960918..5960959,
FT                   5965067..5965282,5966313..5966468,5969360..5969563,
FT                   5974116..5974271,5976073..5976186,5991939..5992208,
FT                   5995572..5995669,5999610..5999730,6000349..6000459,
FT                   6017765..6017908,6018428..6018548,6024636..6024732,
FT                   6027466..6027562,6028544..6028679,6036474..6036651,
FT                   6038404..6038516,6047463..6047617,6048169..6048339,
FT                   6053918..6054054,6055422..6055506,6056457..6057523)
FT                   /gene="Acaca"
FT                   /locus_tag="mCG_141310"
FT                   /product="acetyl-Coenzyme A carboxylase alpha"
FT                   /note="gene_id=mCG141310.0 transcript_id=mCT174523.0
FT                   created on 18-OCT-2002"
FT   CDS             join(5849270..5849493,5867952..5868084,5869638..5869776,
FT                   5876902..5877011,5878204..5878285,5879894..5879992,
FT                   5882451..5882557,5885182..5885292,5892341..5892550,
FT                   5896793..5896963,5898722..5898883,5899209..5899372,
FT                   5902929..5903079,5904747..5904850,5910199..5910280,
FT                   5910691..5910836,5912834..5912984,5914135..5914269,
FT                   5915021..5915167,5915907..5916095,5916783..5916883,
FT                   5917550..5917638,5923892..5924016,5930109..5930222,
FT                   5931371..5931484,5932441..5932530,5933967..5934085,
FT                   5943875..5943898,5946478..5946621,5947736..5947784,
FT                   5948738..5948845,5953869..5953925,5960918..5960959,
FT                   5965067..5965282,5966313..5966468,5969360..5969563,
FT                   5974116..5974271,5976073..5976186,5991939..5992208,
FT                   5995572..5995669,5999610..5999730,6000349..6000459,
FT                   6017765..6017908,6018428..6018548,6024636..6024732,
FT                   6027466..6027562,6028544..6028679,6036474..6036651,
FT                   6038404..6038516,6047463..6047617,6048169..6048339,
FT                   6053918..6054054,6055422..6055506,6056457..6056723)
FT                   /codon_start=1
FT                   /gene="Acaca"
FT                   /locus_tag="mCG_141310"
FT                   /product="acetyl-Coenzyme A carboxylase alpha"
FT                   /note="gene_id=mCG141310.0 transcript_id=mCT174523.0
FT                   protein_id=mCP97442.0"
FT                   /protein_id="EDL15735.1"
FT   gene            complement(5861575..5861945)
FT                   /pseudo
FT                   /locus_tag="mCG_11278"
FT                   /note="gene_id=mCG11278.1"
FT   mRNA            complement(5861575..5861945)
FT                   /pseudo
FT                   /locus_tag="mCG_11278"
FT                   /note="gene_id=mCG11278.1 transcript_id=mCT11717.1 created
FT                   on 18-OCT-2002"
FT   assembly_gap    5875691..5875734
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    5918083..5918134
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    5947359..5947691
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    6001351..6001604
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    6003661..6003971
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    6019901..6021070
FT                   /estimated_length=1170
FT                   /gap_type="unknown"
FT   assembly_gap    6050612..6051015
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    6074764..6076197
FT                   /estimated_length=1434
FT                   /gap_type="unknown"
FT   gene            complement(6078876..>6170854)
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /note="gene_id=mCG11286.1"
FT   mRNA            complement(join(6078876..6079039,6098563..6098634,
FT                   6101622..6101702,6105130..6105197,6123496..6123579,
FT                   6126967..6127166,6128932..6129046,6167247..6167384,
FT                   6167787..6168005,6168836..6168931,6169494..6169682,
FT                   6170645..>6170854))
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /product="apoptosis antagonizing transcription factor,
FT                   transcript variant mCT11725"
FT                   /note="gene_id=mCG11286.1 transcript_id=mCT11725.1 created
FT                   on 01-AUG-2002"
FT   mRNA            complement(join(6078903..6079039,6098563..6098634,
FT                   6101622..6101702,6105130..6105197,6123496..6123579,
FT                   6126967..6127166,6128932..6129046,6147638..6147726))
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /product="apoptosis antagonizing transcription factor,
FT                   transcript variant mCT171265"
FT                   /note="gene_id=mCG11286.1 transcript_id=mCT171265.0 created
FT                   on 01-AUG-2002"
FT   CDS             complement(join(6078976..6079039,6098563..6098634,
FT                   6101622..6101702,6105130..6105197,6123496..6123579,
FT                   6126967..6127005))
FT                   /codon_start=1
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /product="apoptosis antagonizing transcription factor,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11286.1 transcript_id=mCT171265.0
FT                   protein_id=mCP94184.0 isoform=CRA_a"
FT                   /protein_id="EDL15736.1"
FT   CDS             complement(join(6123530..6123579,6126967..6127166,
FT                   6128932..6129046,6167247..6167384,6167787..6168005,
FT                   6168836..6168931,6169494..6169682,6170645..>6170852))
FT                   /codon_start=1
FT                   /gene="Aatf"
FT                   /locus_tag="mCG_11286"
FT                   /product="apoptosis antagonizing transcription factor,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11286.1 transcript_id=mCT11725.1
FT                   protein_id=mCP11656.1 isoform=CRA_b"
FT                   /protein_id="EDL15737.1"
FT                   PEGLG"
FT   assembly_gap    6126207..6126930
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    6135685..6135994
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    6157027..6157046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6158538..6158557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6176729..6182884)
FT                   /gene="Lhx1"
FT                   /locus_tag="mCG_11270"
FT                   /note="gene_id=mCG11270.1"
FT   mRNA            complement(join(6176729..6177278,6177634..6177799,
FT                   6179040..6179317,6179411..6179637,6181356..6182884))
FT                   /gene="Lhx1"
FT                   /locus_tag="mCG_11270"
FT                   /product="LIM homeobox protein 1"
FT                   /note="gene_id=mCG11270.1 transcript_id=mCT11711.1 created
FT                   on 01-AUG-2002"
FT   CDS             complement(join(6176899..6177278,6177634..6177799,
FT                   6179040..6179317,6179411..6179637,6181356..6181525))
FT                   /codon_start=1
FT                   /gene="Lhx1"
FT                   /locus_tag="mCG_11270"
FT                   /product="LIM homeobox protein 1"
FT                   /note="gene_id=mCG11270.1 transcript_id=mCT11711.1
FT                   protein_id=mCP11661.2"
FT                   /db_xref="GOA:Q569N5"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR001781"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017970"
FT                   /db_xref="MGI:MGI:99783"
FT                   /db_xref="UniProtKB/TrEMBL:Q569N5"
FT                   /protein_id="EDL15738.1"
FT                   MNEAAVW"
FT   gene            <6183033..6193133
FT                   /locus_tag="mCG_145244"
FT                   /note="gene_id=mCG145244.0"
FT   mRNA            join(<6183033..6183098,6191783..6191963,6192419..6192524,
FT                   6192887..6193133)
FT                   /locus_tag="mCG_145244"
FT                   /product="mCG145244"
FT                   /note="gene_id=mCG145244.0 transcript_id=mCT184668.0
FT                   created on 05-JUN-2003"
FT   CDS             <6192929..6193102
FT                   /codon_start=1
FT                   /locus_tag="mCG_145244"
FT                   /product="mCG145244"
FT                   /note="gene_id=mCG145244.0 transcript_id=mCT184668.0
FT                   protein_id=mCP105660.0"
FT                   /protein_id="EDL15739.1"
FT                   LQCVCPGRMLLG"
FT   assembly_gap    6202607..6203281
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   assembly_gap    6272481..6272500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6277043..6277062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6291524..6292527
FT                   /estimated_length=1004
FT                   /gap_type="unknown"
FT   assembly_gap    6310541..6311013
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    6315274..6315300
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    6346095..6346220
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    6354996..6355015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6361690..6361794
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            complement(<6376442..>6379519)
FT                   /locus_tag="mCG_1032072"
FT                   /note="gene_id=mCG1032072.0"
FT   mRNA            complement(join(<6376442..6376625,6379405..>6379519))
FT                   /locus_tag="mCG_1032072"
FT                   /product="mCG1032072"
FT                   /note="gene_id=mCG1032072.0 transcript_id=mCT149776.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(<6376442..>6376603)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032072"
FT                   /product="mCG1032072"
FT                   /note="gene_id=mCG1032072.0 transcript_id=mCT149776.0
FT                   protein_id=mCP85413.0"
FT                   /protein_id="EDL15740.1"
FT                   IPIIKTTTT"
FT   assembly_gap    6379639..6379976
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    6390182..6390215
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    6408525..6408544
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6463723..6463750
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    6467346..6467542
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    6471758..6475600
FT                   /estimated_length=3843
FT                   /gap_type="unknown"
FT   gene            complement(6477518..>6483967)
FT                   /gene="Mrm1"
FT                   /locus_tag="mCG_145254"
FT                   /note="gene_id=mCG145254.0"
FT   mRNA            complement(join(6477518..6478966,6479141..6479260,
FT                   6479360..6479492,6483052..6483145,6483289..>6483967))
FT                   /gene="Mrm1"
FT                   /locus_tag="mCG_145254"
FT                   /product="mitochondrial rRNA methyltransferase 1 homolog
FT                   (S. cerevisiae)"
FT                   /note="gene_id=mCG145254.0 transcript_id=mCT184678.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(6478887..6478966,6479141..6479260,
FT                   6479360..6479492,6483052..6483145,6483289..>6483938))
FT                   /codon_start=1
FT                   /gene="Mrm1"
FT                   /locus_tag="mCG_145254"
FT                   /product="mitochondrial rRNA methyltransferase 1 homolog
FT                   (S. cerevisiae)"
FT                   /note="gene_id=mCG145254.0 transcript_id=mCT184678.0
FT                   protein_id=mCP105670.0"
FT                   /protein_id="EDL15741.1"
FT                   SQKKGFPVQERGQLLQDS"
FT   assembly_gap    6479099..6479128
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            complement(6484230..6493440)
FT                   /gene="BC022224"
FT                   /locus_tag="mCG_11280"
FT                   /note="gene_id=mCG11280.1"
FT   mRNA            complement(join(6484230..6485753,6485855..6485920,
FT                   6486117..6486209,6486763..6486892,6487524..6487618,
FT                   6489820..6490029,6493191..6493440))
FT                   /gene="BC022224"
FT                   /locus_tag="mCG_11280"
FT                   /product="cDNA sequence BC022224"
FT                   /note="gene_id=mCG11280.1 transcript_id=mCT11719.1 created
FT                   on 18-OCT-2002"
FT   CDS             complement(join(6485712..6485753,6485855..6485920,
FT                   6486117..6486209,6486763..6486892,6487524..6487618,
FT                   6489820..6490029,6493191..6493337))
FT                   /codon_start=1
FT                   /gene="BC022224"
FT                   /locus_tag="mCG_11280"
FT                   /product="cDNA sequence BC022224"
FT                   /note="gene_id=mCG11280.1 transcript_id=mCT11719.1
FT                   protein_id=mCP11657.2"
FT                   /protein_id="EDL15742.1"
FT   gene            <6493616..6495308
FT                   /locus_tag="mCG_145243"
FT                   /note="gene_id=mCG145243.0"
FT   mRNA            join(<6493616..6493852,6494342..6494482,6494930..6495308)
FT                   /locus_tag="mCG_145243"
FT                   /product="mCG145243"
FT                   /note="gene_id=mCG145243.0 transcript_id=mCT184667.0
FT                   created on 05-JUN-2003"
FT   CDS             <6493617..6493850
FT                   /codon_start=1
FT                   /locus_tag="mCG_145243"
FT                   /product="mCG145243"
FT                   /note="gene_id=mCG145243.0 transcript_id=mCT184667.0
FT                   protein_id=mCP105659.0"
FT                   /protein_id="EDL15743.1"
FT   gene            complement(6496799..6534726)
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /note="gene_id=mCG11275.1"
FT   mRNA            complement(join(6496799..6497652,6498774..6499022,
FT                   6500804..6500952,6501038..6501163,6502280..6502427,
FT                   6504420..6504614,6504700..6504874,6505854..6506063,
FT                   6518630..6518743,6518831..6518956,6523012..6523110,
FT                   6525121..6525374,6526814..6526894,6534452..6534726))
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /product="gametogenetin binding protein 2, transcript
FT                   variant mCT11714"
FT                   /note="gene_id=mCG11275.1 transcript_id=mCT11714.1 created
FT                   on 06-SEP-2002"
FT   mRNA            complement(join(6497298..6497652,6498774..6499022,
FT                   6500804..6500952,6501038..6501165,6523012..6523110,
FT                   6525121..6525374,6526814..6526894,6534452..>6534643))
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /product="gametogenetin binding protein 2, transcript
FT                   variant mCT172620"
FT                   /note="gene_id=mCG11275.1 transcript_id=mCT172620.0 created
FT                   on 06-SEP-2002"
FT   CDS             complement(join(6497449..6497652,6498774..6499022,
FT                   6500804..6500952,6501038..6501163,6502280..6502427,
FT                   6504420..6504614,6504700..6504874,6505854..6506063,
FT                   6518630..6518743,6518831..6518956,6523012..6523110,
FT                   6525121..6525374,6526814..6526894,6534452..6534544))
FT                   /codon_start=1
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /product="gametogenetin binding protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG11275.1 transcript_id=mCT11714.1
FT                   protein_id=mCP11646.1 isoform=CRA_b"
FT                   /protein_id="EDL15745.1"
FT   CDS             complement(join(6497449..6497652,6498774..6499022,
FT                   6500804..6500952,6501038..6501165,6523012..6523110,
FT                   6525121..>6525338))
FT                   /codon_start=1
FT                   /gene="Ggnbp2"
FT                   /locus_tag="mCG_11275"
FT                   /product="gametogenetin binding protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG11275.1 transcript_id=mCT172620.0
FT                   protein_id=mCP95539.0 isoform=CRA_a"
FT                   /protein_id="EDL15744.1"
FT                   WLTTAGAN"
FT   assembly_gap    6517296..6517514
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    6534781..6535211
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   gene            complement(6540869..6545085)
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /note="gene_id=mCG52793.2"
FT   mRNA            complement(join(6540869..6543068,6545063..6545085))
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class W, transcript variant mCT180885"
FT                   /note="gene_id=mCG52793.2 transcript_id=mCT180885.0 created
FT                   on 05-MAR-2003"
FT   mRNA            complement(join(6540869..6543068,6544275..6544676))
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class W, transcript variant mCT52976"
FT                   /note="gene_id=mCG52793.2 transcript_id=mCT52976.2 created
FT                   on 05-MAR-2003"
FT   CDS             complement(6541546..6543057)
FT                   /codon_start=1
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class W, isoform CRA_a"
FT                   /note="gene_id=mCG52793.2 transcript_id=mCT180885.0
FT                   protein_id=mCP103807.0 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZN11"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="MGI:MGI:1917575"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN11"
FT                   /protein_id="EDL15746.1"
FT   CDS             complement(6541546..6543057)
FT                   /codon_start=1
FT                   /gene="Pigw"
FT                   /locus_tag="mCG_52793"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class W, isoform CRA_a"
FT                   /note="gene_id=mCG52793.2 transcript_id=mCT52976.2
FT                   protein_id=mCP33420.2 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZN11"
FT                   /db_xref="InterPro:IPR009447"
FT                   /db_xref="MGI:MGI:1917575"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZN11"
FT                   /protein_id="EDL15747.1"
FT   assembly_gap    6544677..6545025
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   gene            <6545200..6557802
FT                   /locus_tag="mCG_145248"
FT                   /note="gene_id=mCG145248.0"
FT   mRNA            join(<6545200..6545346,6547422..6547563,6549950..6550088,
FT                   6550419..6550567,6552803..6552916,6556825..6557802)
FT                   /locus_tag="mCG_145248"
FT                   /product="mCG145248"
FT                   /note="gene_id=mCG145248.0 transcript_id=mCT184672.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6547546..6547563,6549950..6550088,6550419..6550567,
FT                   6552803..6552916,6556825..6557031)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145248"
FT                   /product="mCG145248"
FT                   /note="gene_id=mCG145248.0 transcript_id=mCT184672.0
FT                   protein_id=mCP105664.0"
FT                   /protein_id="EDL15748.1"
FT   assembly_gap    6548024..6549047
FT                   /estimated_length=1024
FT                   /gap_type="unknown"
FT   gene            <6559339..6575863
FT                   /locus_tag="mCG_146190"
FT                   /note="gene_id=mCG146190.0"
FT   mRNA            join(<6559339..6559396,6560012..6560108,6560222..6560298,
FT                   6561865..6561955,6562293..6562464,6564121..6564194,
FT                   6564940..6565061,6565218..6565331,6565586..6565762,
FT                   6566095..6566247,6566844..6566951,6567901..6567971,
FT                   6570286..6570389,6571982..6572148,6572252..6572381,
FT                   6572966..6573051,6574000..6574299,6575139..6575863)
FT                   /locus_tag="mCG_146190"
FT                   /product="mCG146190"
FT                   /note="gene_id=mCG146190.0 transcript_id=mCT186293.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<6559340..6559396,6560012..6560108,6560222..6560298,
FT                   6561865..6561955,6562293..6562464,6564121..6564194,
FT                   6564940..6565061,6565218..6565331,6565586..6565762,
FT                   6566095..6566247,6566844..6566951,6567901..6567971,
FT                   6570286..6570389,6571982..6572148,6572252..6572381,
FT                   6572966..6573051,6574000..6574299,6575139..6575267)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146190"
FT                   /product="mCG146190"
FT                   /note="gene_id=mCG146190.0 transcript_id=mCT186293.0
FT                   protein_id=mCP107522.0"
FT                   /protein_id="EDL15749.1"
FT   gene            complement(6575701..6581116)
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /note="gene_id=mCG11283.3"
FT   mRNA            complement(join(6575701..6576394,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581114))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT11722"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT11722.2 created
FT                   on 16-JUN-2003"
FT   mRNA            complement(join(6575701..6576284,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581105))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT185827"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT185827.0 created
FT                   on 16-JUN-2003"
FT   mRNA            complement(join(6575764..6576394,6577968..6578182,
FT                   6578957..6579031,6580845..6580876,6581002..6581116))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT180850"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT180850.1 created
FT                   on 16-JUN-2003"
FT   mRNA            complement(join(6575764..6576394,6577968..6578048,
FT                   6578957..6579129,6580845..6580876,6581002..6581116))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT180851"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT180851.1 created
FT                   on 16-JUN-2003"
FT   CDS             complement(join(6576085..6576284,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581087))
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_c"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT185827.0
FT                   protein_id=mCP107085.0 isoform=CRA_c"
FT                   /protein_id="EDL15752.1"
FT   CDS             complement(join(6576213..6576394,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581087))
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_a"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT11722.2
FT                   protein_id=mCP11634.2 isoform=CRA_a"
FT                   /protein_id="EDL15750.1"
FT   CDS             complement(join(6576213..6576394,6577968..6578048,
FT                   6578957..6579077))
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_b"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT180851.1
FT                   protein_id=mCP103772.0 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:3051596"
FT                   /db_xref="UniProtKB/TrEMBL:Q5FW88"
FT                   /protein_id="EDL15751.1"
FT   CDS             complement(6576213..6576341)
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_d"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT180850.1
FT                   protein_id=mCP103773.1 isoform=CRA_d"
FT                   /protein_id="EDL15753.1"
FT   mRNA            complement(join(6576262..6576640,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581116))
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, transcript variant
FT                   mCT185826"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT185826.0 created
FT                   on 16-JUN-2003"
FT   CDS             complement(join(6576597..6576640,6577968..6578048,
FT                   6578957..6579031,6580845..6580876,6581002..6581087))
FT                   /codon_start=1
FT                   /gene="Znhit3"
FT                   /locus_tag="mCG_11283"
FT                   /product="zinc finger, HIT type 3, isoform CRA_e"
FT                   /note="gene_id=mCG11283.3 transcript_id=mCT185826.0
FT                   protein_id=mCP107084.0 isoform=CRA_e"
FT                   /protein_id="EDL15754.1"
FT                   L"
FT   assembly_gap    6597034..6597896
FT                   /estimated_length=863
FT                   /gap_type="unknown"
FT   gene            6622549..6630807
FT                   /gene="Car4"
FT                   /locus_tag="mCG_11273"
FT                   /note="gene_id=mCG11273.2"
FT   mRNA            join(6622549..6622705,6627149..6627202,6628101..6628256,
FT                   6628856..6629001,6629111..6629191,6629298..6629364,
FT                   6629476..6629639,6630374..6630807)
FT                   /gene="Car4"
FT                   /locus_tag="mCG_11273"
FT                   /product="carbonic anhydrase 4"
FT                   /note="gene_id=mCG11273.2 transcript_id=mCT11712.2 created
FT                   on 01-AUG-2002"
FT   CDS             join(6622651..6622705,6627149..6627202,6628101..6628256,
FT                   6628856..6629001,6629111..6629191,6629298..6629364,
FT                   6629476..6629639,6630374..6630568)
FT                   /codon_start=1
FT                   /gene="Car4"
FT                   /locus_tag="mCG_11273"
FT                   /product="carbonic anhydrase 4"
FT                   /note="gene_id=mCG11273.2 transcript_id=mCT11712.2
FT                   protein_id=mCP11665.1"
FT                   /protein_id="EDL15755.1"
FT   assembly_gap    6647210..6648516
FT                   /estimated_length=1307
FT                   /gap_type="unknown"
FT   gene            complement(6650897..>6807969)
FT                   /locus_tag="mCG_11277"
FT                   /note="gene_id=mCG11277.1"
FT   mRNA            complement(join(6650897..6653048,6653734..6653826,
FT                   6654803..6655227,6658922..6659210,6660855..6661046,
FT                   6672277..6672397,6673462..6673548,6676428..6676612,
FT                   6684142..6684353,6686277..6686388,6688668..6688819,
FT                   6689243..6689417,6692031..6692204,6693288..6693393,
FT                   6693613..6693751,6695573..6695647,6696995..6697076,
FT                   6698581..6698735,6703131..6703248,6705810..6705950,
FT                   6707302..6707477,6709795..6709987,6712017..6712119,
FT                   6717694..6717755,6718498..6718581,6721241..6721356,
FT                   6726462..6726593,6744616..6744775,6771248..6771375,
FT                   6807912..>6807969))
FT                   /locus_tag="mCG_11277"
FT                   /product="mCG11277"
FT                   /note="gene_id=mCG11277.1 transcript_id=mCT11716.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(6652875..6653048,6653734..6653826,
FT                   6654803..6655227,6658922..6659210,6660855..6661046,
FT                   6672277..6672397,6673462..6673548,6676428..6676612,
FT                   6684142..6684353,6686277..6686388,6688668..6688819,
FT                   6689243..6689417,6692031..6692204,6693288..6693393,
FT                   6693613..6693751,6695573..6695647,6696995..6697076,
FT                   6698581..6698735,6703131..6703248,6705810..6705950,
FT                   6707302..6707477,6709795..6709987,6712017..6712119,
FT                   6717694..6717755,6718498..6718581,6721241..6721356,
FT                   6726462..6726593,6744616..6744775,6771248..6771375,
FT                   6807912..6807969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11277"
FT                   /product="mCG11277"
FT                   /note="gene_id=mCG11277.1 transcript_id=mCT11716.2
FT                   protein_id=mCP11640.2"
FT                   /protein_id="EDL15756.1"