spacer

EBI Dbfetch

ID   CH466554; SV 1; linear; genomic DNA; CON; MUS; 22133581 BP.
XX
AC   CH466554;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 6)
XX
DE   Mus musculus 232000009825236 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-22133581
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-22133581
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; d4259d9fe891fb2748d1367800049a75.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000216.
DR   Ensembl-Gn; ENSMUSG00000031516; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031517; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031519; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031520; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031521; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031559; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031562; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031568; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031590; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031591; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031627; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031637; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031645; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039375; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048516; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054764; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061974; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063049; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033915; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033918; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033919; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033920; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033963; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033965; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033966; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034000; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034012; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049577; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066451; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080353; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118811; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129132; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132032; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149992; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170263; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175692; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190840; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..22133581
FT                   /organism="Mus musculus"
FT                   /chromosome="8"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    1121..6179
FT                   /estimated_length=5059
FT                   /gap_type="unknown"
FT   assembly_gap    10293..15645
FT                   /estimated_length=5353
FT                   /gap_type="unknown"
FT   assembly_gap    19496..25232
FT                   /estimated_length=5737
FT                   /gap_type="unknown"
FT   assembly_gap    27514..37277
FT                   /estimated_length=9764
FT                   /gap_type="unknown"
FT   assembly_gap    50619..51398
FT                   /estimated_length=780
FT                   /gap_type="unknown"
FT   assembly_gap    73552..73899
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    90816..90835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    109671..109873
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    111798..112918
FT                   /estimated_length=1121
FT                   /gap_type="unknown"
FT   assembly_gap    114501..116445
FT                   /estimated_length=1945
FT                   /gap_type="unknown"
FT   assembly_gap    117986..118674
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    120793..120875
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    123228..123247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    131823..133121
FT                   /estimated_length=1299
FT                   /gap_type="unknown"
FT   assembly_gap    136176..136925
FT                   /estimated_length=750
FT                   /gap_type="unknown"
FT   assembly_gap    140957..146674
FT                   /estimated_length=5718
FT                   /gap_type="unknown"
FT   assembly_gap    149231..149250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    151205..151224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    152636..152655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    155815..156207
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    161764..162226
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    167279..167298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    169688..184126
FT                   /estimated_length=14439
FT                   /gap_type="unknown"
FT   gene            complement(184136..350529)
FT                   /gene="Wrn"
FT                   /locus_tag="mCG_2443"
FT                   /note="gene_id=mCG2443.1"
FT   mRNA            complement(join(184136..184903,187572..187680,
FT                   195273..195435,197819..197950,200547..200661,
FT                   201998..202110,202251..202326,222360..222433,
FT                   223193..223265,224131..224228,224304..224474,
FT                   236980..237121,242889..242981,243408..243509,
FT                   247077..247258,250797..250971,253138..253325,
FT                   266753..266859,271715..271797,277360..277428,
FT                   278222..278330,278568..278635,280168..280243,
FT                   281490..281628,283834..283914,285702..286128,
FT                   290649..290763,295658..295727,297478..297627,
FT                   307207..307355,307777..307922,316654..316766,
FT                   317885..317989,350374..350529))
FT                   /gene="Wrn"
FT                   /locus_tag="mCG_2443"
FT                   /product="Werner syndrome homolog (human)"
FT                   /note="gene_id=mCG2443.1 transcript_id=mCT1424.2 created on
FT                   16-JUL-2002"
FT   CDS             complement(join(184732..184903,187572..187680,
FT                   195273..195435,197819..197950,200547..200661,
FT                   201998..202110,202251..202326,222360..222433,
FT                   223193..223265,224131..224228,224304..224474,
FT                   236980..237121,242889..242981,243408..243509,
FT                   247077..247258,250797..250971,253138..253325,
FT                   266753..266859,271715..271797,277360..277428,
FT                   278222..278330,278568..278635,280168..280243,
FT                   281490..281628,283834..283914,285702..286128,
FT                   290649..290763,295658..295727,297478..297627,
FT                   307207..307355,307777..307922,316654..316766,
FT                   317885..317962))
FT                   /codon_start=1
FT                   /gene="Wrn"
FT                   /locus_tag="mCG_2443"
FT                   /product="Werner syndrome homolog (human)"
FT                   /note="gene_id=mCG2443.1 transcript_id=mCT1424.2
FT                   protein_id=mCP23051.2"
FT                   /protein_id="EDL35409.1"
FT                   /translation="METTSLQRKFPEWMSMQSQRCATEEKACVQKSVLEDNLPFLEFPG
FT                   SIVYSYEASDCSFLSEDISMRLSDGDVVGFDMEWPPIYKPGKRSRVAVIQLCVSENKCY
FT                   LFHISSMSVFPQGLKMLLENKSIKKAGVGIEGDQWKLLRDFDVKLESFVELTDVANEKL
FT                   KCAETWSLNGLVKHVLGKQLLKDKSIRCSNWSNFPLTEDQKLYAATDAYAGLIIYQKLG
FT                   NLGDTVQVFALNKAEENLPLEMKKQLNLISEEMRDLANRFPVTCRNLETLQRVPVILKS
FT                   ISENLCSLRKVICGPTNTETRLKPGSSFNLLSSEDSAAAGEKEKQIGKHSTFAKIKEEP
FT                   WDPELDSLVKQEEVDVFRNQVKQEKGESENEIEDNLLREDMERTCVIPSISENELQDLE
FT                   QQAKEEKYNDVSHQLSEHLSPNDDENDSSYIIESDEDLEMEMLKSLENLNSDMVEPTHS
FT                   KWLEMGTNGCLPPEEEDGHGNEAIKEEQEEEDHLLPEPNAKQINCLKTYFGHSSFKPVQ
FT                   WKVIHSVLEERRDNVVVMATGYGKSLCFQYPPVYTGKIGIVISPLISLMEDQVLQLELS
FT                   NVPACLLGSAQSKNILGDVKLGKYRVIYITPEFCSGNLDLLQKLDSSIGITLIAVDEAH
FT                   CISEWGHDFRSSFRMLGSLKTALPLVPVIALSATASSSIREDIISCLNLKDPQITCTGF
FT                   DRPNLYLEVGRKTGNILQDLKPFLVRKASSAWEFEGPTIIYCPSRKMTEQVTAELGKLN
FT                   LACRTYHAGMKISERKDVHHRFLRDEIQCVVATVAFGMGINKADIRKVIHYGAPKEMES
FT                   YYQEIGRAGRDGLQSSCHLLWAPADFNTSRNLLIEIHDEKFRLYKLKMMVKMEKYLHSS
FT                   QCRRRIILSHFEDKCLQKASLDIMGTEKCCDNCRPRLNHCLTANNSEDASQDFGPQAFQ
FT                   LLSAVDILQEKFGIGIPILFLRGSNSQRLPDKYRGHRLFGAGKEQAESWWKTLSHHLIA
FT                   EGFLVEVPKENKYIKTCSLTKKGRKWLGEASSQSPPSLLLQANEEMFPRKVLLPSSNPV
FT                   SPETTQHSSNQNPAGLTTKQSNLERTHSYKVPEKVSSGTNIPKKSAVMPSPGTSSSPLE
FT                   PAISAQELDARTGLYARLVEARQKHANKMDVPPAILATNKVLLDMAKMRPTTVENMKQI
FT                   DGVSEGKAALLAPLLGVIKHFCQVTSVQTDLLSSAKPHKEQEKSQEMEKKDCSLPQSVA
FT                   VTYTLFQEKKMPLHSIAENRLLPLTAVGMHLAQAVKAGYPLDMERAGLTPETWKIIMDV
FT                   IRNPPINSDMYKVKLIRMLVPENLDTYLIHMAIEILQSGSDSRTQHHLQSQRENYPSGL
FT                   PKEMCPQLIPAAHHQWPRPKRKVSLVKMTTMEQFVCPTSSFL"
FT   assembly_gap    186655..187571
FT                   /estimated_length=917
FT                   /gap_type="unknown"
FT   assembly_gap    188174..188406
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    191162..191280
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    204029..204048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    205417..205436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    207965..207984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    210453..210472
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    211614..211633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    213926..213945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    215736..215755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    217028..218989
FT                   /estimated_length=1962
FT                   /gap_type="unknown"
FT   assembly_gap    220909..220928
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222164..222183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    228324..228343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    229685..229704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    231664..231944
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    242085..242104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    303326..303345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    306830..306849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            350654..352511
FT                   /locus_tag="mCG_50689"
FT                   /note="gene_id=mCG50689.2"
FT   mRNA            join(350654..350674,351310..352511)
FT                   /locus_tag="mCG_50689"
FT                   /product="mCG50689"
FT                   /note="gene_id=mCG50689.2 transcript_id=mCT50872.2 created
FT                   on 05-AUG-2002"
FT   assembly_gap    350909..351104
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   CDS             351316..352368
FT                   /codon_start=1
FT                   /locus_tag="mCG_50689"
FT                   /product="mCG50689"
FT                   /note="gene_id=mCG50689.2 transcript_id=mCT50872.2
FT                   protein_id=mCP42779.2"
FT                   /protein_id="EDL35410.1"
FT                   /translation="MERARRRGGGGSGGGRGRGGKNVGGPGLSKSRLYPQAQHSHYPHY
FT                   SASATPNQSGGTSEIQELASKRVDIQKKRFYLDVKQSSRGRFLKIAEVWIGRGRQDNIR
FT                   KSKLTLSLSVAAELKDCLGDFIEHYAHLGLKGHRQEHGQSKEQVSRRRQKHSAPSPPVS
FT                   VGSEEHPHSVLKTDYIERDNRKYYLDLKENQRGRFLRIRQTMMRGTGMIGYFGHSLGQE
FT                   QTIVLPAQGMIEFRDALVQLIEDYGEGDIEERRCGDDDPLELPEGTSFRVDNKRFYFDV
FT                   GSNKYGIFLKVSEVRPPYRNTITVPFKAWTRFGENFIKYEEEMRKICNSHKEKRMDGRR
FT                   ASGEEQECLD"
FT   assembly_gap    354837..354856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    385542..385561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    403634..403877
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    412046..412251
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    423812..423900
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   gene            442745..444320
FT                   /locus_tag="mCG_50005"
FT                   /note="gene_id=mCG50005.2"
FT   mRNA            442745..444320
FT                   /locus_tag="mCG_50005"
FT                   /product="mCG50005"
FT                   /note="gene_id=mCG50005.2 transcript_id=mCT50188.2 created
FT                   on 05-AUG-2002"
FT   CDS             443448..444068
FT                   /codon_start=1
FT                   /locus_tag="mCG_50005"
FT                   /product="mCG50005"
FT                   /note="gene_id=mCG50005.2 transcript_id=mCT50188.2
FT                   protein_id=mCP42777.2"
FT                   /protein_id="EDL35411.1"
FT                   /translation="MGKGDPKKPRGKMSSYALFVKTCWEEHKKKHPDASVNFSGFSKKC
FT                   SERWNTMSAKEKGKFEGMAKADKARYEREMKTYIAPKGKTKKKFKDPNAPKRPPSAFFL
FT                   FCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAAKDKQPYEKKAAKLKEKYKKDIAAYR
FT                   AKGNTAAAKKGVVKAEKSKKKKEEEDEEDEEEEDEEDEDDDDD"
FT   assembly_gap    448980..448999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    451233..451882
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    466664..466683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    519743..519762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <528041..543533
FT                   /gene="Tex15"
FT                   /locus_tag="mCG_2438"
FT                   /note="gene_id=mCG2438.1"
FT   mRNA            join(<528041..535075,536885..536934,539466..540700,
FT                   543447..543533)
FT                   /gene="Tex15"
FT                   /locus_tag="mCG_2438"
FT                   /product="testis expressed gene 15"
FT                   /note="gene_id=mCG2438.1 transcript_id=mCT1427.1 created on
FT                   16-JUL-2002"
FT   CDS             join(528041..535075,536885..536934,539466..540700,
FT                   543447..543484)
FT                   /codon_start=1
FT                   /gene="Tex15"
FT                   /locus_tag="mCG_2438"
FT                   /product="testis expressed gene 15"
FT                   /note="gene_id=mCG2438.1 transcript_id=mCT1427.1
FT                   protein_id=mCP23052.1"
FT                   /protein_id="EDL35412.1"
FT                   /translation="MTYFFIYVSTERACSLNNCTIAKRIGKGKDATVIFEHFRKPVDPF
FT                   VQENCPCKALNSEMGPFSSDTSSSYGNVQNGNNSVLEAYNRQTENSSNLRDASQVYTHN
FT                   SGFSFIPTGNTASGNGDLFSVTYLRSILSSISAAFPSHNNTGSSTVITSKLIKDPRLMK
FT                   REQSMRNKSDTAGLSDVLPLDKSLGCGDSQIKLTCMPTSSISSSEVPADHTITSCLNAS
FT                   CFKFSSESSHYQAHNSSSKGHDCIASSSIAVTEQFKEQHSSSFPSSLSNAFSDVRKQKH
FT                   SEEQVQRAQMRSNVPVLTALSSESRNSDESENTCSNDSQGHFSQESPSSDINSIYKVGH
FT                   QMSTVFPAQKKGNLCEYIQDTGMMRASISTEDSTKDGVNHTWCKETVLTNETVSSPIDN
FT                   SNTLYQEHKEGGNLNSLSGNCEKIGVTHKLQVPKFPISSTGDKNELYRAALELECSLTP
FT                   TIECLSQKYPQHSLKHEDNTNFAMTQGLIELKTVQNNQNFCNILSDAFQEAKDVPLASE
FT                   KLIDRVISSAAIDISLDSSVCNIIGEYTCVQRENENGEASPYNCHKEEASHVKDGVQDH
FT                   SLSYDAELSCDLNLKINLQEQRDDKNPNEAKEHNTDNINGSEKQDCLANDHFTNIVEMR
FT                   EIKSNTEVEILNSEECFTFNSFRGKNGKPAETASSESEAVEQRHAPNDQRGLEHLVSTF
FT                   PEIEGSSVCVASNATKQIVGTTVLTVSTSLGDHQKDELKEICSSESSDLGLVKHSISEC
FT                   EIDTDKDKLQDFHQLVNENSALKTGLGSEIEVDLEHDNGSVFQQNMHSQGNDLCEEFEL
FT                   YESLKSRIDWEGLFGSSYEEIESSSFARREGTDQHSSTECNCVSFCSQDKRELHNPIFL
FT                   PDLQVTITNLLSLRISPTDESLELEDNFYKQVTESTEPETNKEGNASGFGMCSQPSGEN
FT                   SSFSCANKFGNSVQESGDVSKSESSHSSNSSHNTHVDQGSGKPNNDSLSTEPSNVTVMN
FT                   DKSKCPTKSKPVFNDTRNKKDMQSRSSKRTLHASSSRGQNIANKDLREHETHEKKRRPT
FT                   SHGSSDRFSSLSQGRIKTFSQSEKHIRNVLNILNNEASLCKSKHLSRKLNKAVLHLKKA
FT                   HRRVHTSLQLISKVGQKRKGPLPKAYAVIHNNFWESCDHQGDSLMSERRYSKHFLSKRK
FT                   YDKQGDKRFLRFDIEESLTPVSKHRLYRTNRERIAECLSNEVMSGHVSSSLTTFHVREF
FT                   CDEEQFPEPQLPLAYTSQSISQLEYTNSIVGNESSSELEHFSETSGNMLDPKETLTEKE
FT                   YQTHTQLCNSDSAKLKNHTTHSIRDIAKECNSEDKTVLCESNPVYLSFIKENTSHSPDK
FT                   SYDSNCKANTDIHISVLGSKKKHILSVDIYEQDNCVSDGVKSGEAIFPIEKCTVPMETT
FT                   SSIPTENIASKSYTIPPVSSILVTAGEEESSVGENGLFDVNENEMNITMHSKLDLTSVT
FT                   EESKICKKNMKNLSCNDSSMLLKENITGPSKRYMAKYIEEEKIRKIEQAVYKKIITEGS
FT                   PISFKYKSQNKILKEKSFHVNKKIITNNLTDSHLSIKNSTVDTIALKDIPNQLKERKEA
FT                   GQIKVNNNSHSDCLSKPAIVETNHRPVLHGNPKVATLQKELKEHRSPNYTSHVTELSQI
FT                   LQRADEAASLQILEEETKLCQNILPLFVQAFERQQECSIDQILISRKLLVEQNLWNNCR
FT                   LKLKPCAVDTWVELQMAMETIQFIENKKRFLEGKPTFRSLLWYDESLYSELLRRPRGYQ
FT                   LQSNFYPGFQGRLKYNAFCELQNYHNQLVEFLTETKKENNSYYALLKYKRQINECEAIM
FT                   KHYSDCFDFCLSVPFACGVNFGDSLGDLETLRKSTLKLISVPGGSPKVHSYPGKKDHLW
FT                   IIIEIVSSKVSFIKSNEEISIKICLYGLEHIYFDAAKSLVWKEKSCSLPKKHSEKNREM
FT                   EEINESAFSKLKKIYDVLSKGLNNEPTSIGLQEDAIIASKQSTLGSISNCRLNKAWLSY
FT                   PDISCVGEILDQAKSADLEELQGLTLRCTDHLEILKKYFQMLQEDNIDNIFIMEENVLD
FT                   MLSNHNLGAVILKPEAIEIYIEIVMISETIHYLKNLIAKKLHNQRFRGMLWFDWSLLPE
FT                   LIGCQEEVVSLSVGDTQTHCLWKLVETAISVLKKELAVIYEYGEASNCSYALHLFYREL
FT                   KELTGVKRLLNNSKYSVSTYIDLVPHTASVNFGNTVAELEHNYKQFFLLLKNVMSVPQK
FT                   DFGKMVHIIKVMKTIEHMKLLSAKDTKLSTHLLFLQMLRNKRNALQQNRQEKMETPVTE
FT                   PGEDSSQPGVSEQTPPGTECTVKNISDSSKKRPVTADTCEVSQGKGNTDTVPSWKKQKV
FT                   TMKDVGNIQTVSKHPSTTGSPPNDENKIGSNSSDSLKSISASPEVVKRQSSVLGSVSPA
FT                   ESVQDTCTPKSESKVEPTDSLPDSLASLTEQQENSNVIEKRNGNSSVAETNDKKDCPLV
FT                   TCDQKDIDASYSPDHTPAQESHKTPVDHTQISPSNLTAGNDDPLVPDASLLSVSASQSE
FT                   KDVYLSGTDFHHENNKILNLSTEDCTGTSSPEPVCIKDKISVLQVDKTQPIKSESPKKS
FT                   MTDAPNLNTAPFGSYGNSALNVNGTVQHTHSEQNSKVLTQKVGPSRNIPPQSACSPVHN
FT                   SSAHSFGTSYPYYSWCFYQYSSSNGTAVTHTYQGMTTYEIQQPPPPVLTTVASTVQSTH
FT                   FNRSYSEHFSYFPGQPQANSFNPGNGYFPSHTPVSYNYQQPVYSQFASHQPVPQATYPY
FT                   PPNPGVPPQVPWTYAPWQQNPFLRRP"
FT   assembly_gap    536332..536351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    560357..561482
FT                   /estimated_length=1126
FT                   /gap_type="unknown"
FT   gene            561483..581405
FT                   /gene="Ppp2cb"
FT                   /locus_tag="mCG_2445"
FT                   /note="gene_id=mCG2445.2"
FT   mRNA            join(561483..561634,572001..572210,573095..573268,
FT                   576798..576887,577014..577175,578369..578487,
FT                   580463..581405)
FT                   /gene="Ppp2cb"
FT                   /locus_tag="mCG_2445"
FT                   /product="protein phosphatase 2 (formerly 2A), catalytic
FT                   subunit, beta isoform"
FT                   /note="gene_id=mCG2445.2 transcript_id=mCT1425.1 created on
FT                   16-JUL-2002"
FT   assembly_gap    568507..568526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(572094..572210,573095..573268,576798..576887,
FT                   577014..577175,578369..578487,580463..580535)
FT                   /codon_start=1
FT                   /gene="Ppp2cb"
FT                   /locus_tag="mCG_2445"
FT                   /product="protein phosphatase 2 (formerly 2A), catalytic
FT                   subunit, beta isoform"
FT                   /note="gene_id=mCG2445.2 transcript_id=mCT1425.1
FT                   protein_id=mCP23073.1"
FT                   /protein_id="EDL35413.1"
FT                   /translation="MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPER
FT                   ITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGG
FT                   LSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETF
FT                   NHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFL
FT                   QFDPAPRRGEPHVTRRTPDYFL"
FT   gene            complement(581630..606920)
FT                   /gene="Ubxd6"
FT                   /locus_tag="mCG_2439"
FT                   /note="gene_id=mCG2439.2"
FT   mRNA            complement(join(581630..583139,584597..584671,
FT                   587758..587799,590632..590769,594677..594802,
FT                   596523..596593,599667..599789,605421..606920))
FT                   /gene="Ubxd6"
FT                   /locus_tag="mCG_2439"
FT                   /product="UBX domain containing 6, transcript variant
FT                   mCT1437"
FT                   /note="gene_id=mCG2439.2 transcript_id=mCT1437.2 created on
FT                   05-AUG-2002"
FT   mRNA            complement(join(581630..583139,584597..584671,
FT                   587758..587799,590632..590769,594677..594797,
FT                   599661..599789,605421..606920))
FT                   /gene="Ubxd6"
FT                   /locus_tag="mCG_2439"
FT                   /product="UBX domain containing 6, transcript variant
FT                   mCT171710"
FT                   /note="gene_id=mCG2439.2 transcript_id=mCT171710.0 created
FT                   on 05-AUG-2002"
FT   mRNA            complement(join(581630..583139,584597..584671,
FT                   587758..587799,590632..590769,594677..594802,
FT                   596523..596593,597370..597492))
FT                   /gene="Ubxd6"
FT                   /locus_tag="mCG_2439"
FT                   /product="UBX domain containing 6, transcript variant
FT                   mCT171711"
FT                   /note="gene_id=mCG2439.2 transcript_id=mCT171711.0 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(582969..583139,584597..584671,
FT                   587758..587799,590632..590769,594677..594802,
FT                   596523..596593,599667..599789,605421..605508))
FT                   /codon_start=1
FT                   /gene="Ubxd6"
FT                   /locus_tag="mCG_2439"
FT                   /product="UBX domain containing 6, isoform CRA_a"
FT                   /note="gene_id=mCG2439.2 transcript_id=mCT1437.2
FT                   protein_id=mCP23080.2 isoform=CRA_a"
FT                   /protein_id="EDL35414.1"
FT                   /translation="MASRGVVGLFLLSALPLLCLELRRGIPSLGIKDLILLSGRIFLLL
FT                   ALLTLVISVTTSWFNSLKPSQGHLKEGEKENEKRRRLVRERQQEAQGEKASRYIENVLK
FT                   PQQEMKLKKLEERFYQMTGETWKLTAGHRLLEGDEDSEFENSSQASFETINGEAARRQN
FT                   LPKFSTEISPAARPLLRKEVPDLPEEPSETAEEVVTVALRCPNGRVLRRRFFKSWNSQV
FT                   LLDWMMKVGYHKSLYRLSTSFPRRALEVEGGSSLEDIGITVDTVLNVEEKEQSSQ"
FT   CDS             complement(join(582969..583139,584597..584671,
FT                   587758..587799,590632..590769,594677..594760))
FT                   /codon_start=1
FT                   /gene="Ubxd6"
FT                   /locus_tag="mCG_2439"
FT                   /product="UBX domain containing 6, isoform CRA_c"
FT                   /note="gene_id=mCG2439.2 transcript_id=mCT171711.0
FT                   protein_id=mCP94630.0 isoform=CRA_c"
FT                   /protein_id="EDL35416.1"
FT                   /translation="MKLKKLEERFYQMTGETWKLTAGHRLLEGDEDSEFENSSQASFET
FT                   INGEAARRQNLPKFSTEISPAARPLLRKEVPDLPEEPSETAEEVVTVALRCPNGRVLRR
FT                   RFFKSWNSQVLLDWMMKVGYHKSLYRLSTSFPRRALEVEGGSSLEDIGITVDTVLNVEE
FT                   KEQSSQ"
FT   assembly_gap    588613..588632
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    594534..594575
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   CDS             complement(join(594787..594797,599661..599789,
FT                   605421..605508))
FT                   /codon_start=1
FT                   /gene="Ubxd6"
FT                   /locus_tag="mCG_2439"
FT                   /product="UBX domain containing 6, isoform CRA_b"
FT                   /note="gene_id=mCG2439.2 transcript_id=mCT171710.0
FT                   protein_id=mCP94629.0 isoform=CRA_b"
FT                   /protein_id="EDL35415.1"
FT                   /translation="MASRGVVGLFLLSALPLLCLELRRGIPSLGIKDLILLSGRIFLLL
FT                   ALLTLVISVTTSWFNSLKPSQGHLKGKSDI"
FT   assembly_gap    601989..602008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    604309..604328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    617082..617557
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   assembly_gap    631582..631601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    632625..634246
FT                   /estimated_length=1622
FT                   /gap_type="unknown"
FT   gene            <636289..664854
FT                   /gene="Gsr"
FT                   /locus_tag="mCG_2441"
FT                   /note="gene_id=mCG2441.2"
FT   mRNA            join(<636289..636315,637035..637123,638479..638548,
FT                   641022..641169,646974..647028,648170..648269,
FT                   649290..649376,652246..652404,656056..656167,
FT                   660464..660595,661668..661801,663838..664854)
FT                   /gene="Gsr"
FT                   /locus_tag="mCG_2441"
FT                   /product="glutathione reductase 1"
FT                   /note="gene_id=mCG2441.2 transcript_id=mCT1426.2 created on
FT                   16-JUL-2002"
FT   CDS             join(<636289..636315,637035..637123,638479..638548,
FT                   641022..641169,646974..647028,648170..648269,
FT                   649290..649376,652246..652404,656056..656167,
FT                   660464..660595,661668..661801,663838..663987)
FT                   /codon_start=1
FT                   /gene="Gsr"
FT                   /locus_tag="mCG_2441"
FT                   /product="glutathione reductase 1"
FT                   /note="gene_id=mCG2441.2 transcript_id=mCT1426.2
FT                   protein_id=mCP23053.1"
FT                   /protein_id="EDL35417.1"
FT                   /translation="VNVGCVPKKVMWNTAVHSEFMHDHVDYGFQSCEGKFSWHVIKQKR
FT                   DAYVSRLNTIYQNNLTKSHIEIIHGYATFADGPRPTVEVNGKKFTAPHILIATGGVPTV
FT                   PHESQIPGASLGITSDGFFQLEDLPSRSVIVGAGYIAVEIAGILSALGSKTSLMIRHDK
FT                   VLRNFDSLISSNCTEELENAGVEVLKFTQVKEVKKTSSGLELQVVTSVPGRKPTTTMIP
FT                   DVDCLLWAIGRDPNSKGLNLNKVGIQTDEKGHILVDEFQNTNVKGVYAVGDVCGKALLT
FT                   PVAIAAGRKLAHRLFECKQDSKLDYDNIPTVVFSHPPIGTVGLTEDEAVHKYGKDNVKI
FT                   YSTAFTPMYHAVTTRKTKCVMKMVCANKEEKVVGIHMQGIGCDEMLQGFAVAVKMGATK
FT                   ADFDNTVAIHPTSSEELVTLR"
FT   gene            658660..659547
FT                   /pseudo
FT                   /locus_tag="mCG_2432"
FT                   /note="gene_id=mCG2432.1"
FT   mRNA            658660..659547
FT                   /pseudo
FT                   /locus_tag="mCG_2432"
FT                   /note="gene_id=mCG2432.1 transcript_id=mCT1431.1 created on
FT                   05-AUG-2002"
FT   assembly_gap    668745..668764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    672095..677423
FT                   /estimated_length=5329
FT                   /gap_type="unknown"
FT   assembly_gap    683145..683335
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   gene            694275..741860
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /note="gene_id=mCG2433.2"
FT   mRNA            join(694275..694314,698303..698475,716961..717052,
FT                   720373..720480,723084..723266,726554..726647,
FT                   740628..740743,741139..741860)
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), transcript variant mCT170821"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT170821.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(694368..694960,698303..698475,716961..717052,
FT                   720373..720480,723084..723266,726554..726647,
FT                   740628..740743,741139..741860)
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), transcript variant mCT170822"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT170822.1 created
FT                   on 13-FEB-2003"
FT   mRNA            join(694368..694841,698303..698475,716961..717052,
FT                   720373..720480,723084..723266,726554..726647,
FT                   740628..740743,741139..741860)
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), transcript variant mCT170820"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT170820.1 created
FT                   on 13-FEB-2003"
FT   mRNA            join(694368..694455,698303..698475,716961..717052,
FT                   720373..720480,723084..723266,726554..726647,
FT                   740628..740743,741139..741860)
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), transcript variant mCT1432"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT1432.2 created on
FT                   13-FEB-2003"
FT   mRNA            join(694368..694455,716961..717052,720373..720480,
FT                   723084..723266,726554..726647,740628..740743,
FT                   741139..741860)
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), transcript variant mCT180441"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT180441.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(698307..698475,716961..717052,720373..720480,
FT                   723084..723266,726554..726647,740628..740743,
FT                   741139..741255)
FT                   /codon_start=1
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), isoform CRA_a"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT1432.2
FT                   protein_id=mCP23074.1 isoform=CRA_a"
FT                   /protein_id="EDL35418.1"
FT                   /translation="MDPSLLRDRELFKKRALSTPVVEKRAVPSESPSSSSSKKKKAKVE
FT                   HGGSSGSKQNSDHNNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLEEIL
FT                   DETQHLDIGLKQKQWLMTEALVNNPKIEVVDGKYAFKPKYNLKDKKALLRLLDNHDQRG
FT                   LGGILLEDIEEGLPNSQKAVKALGDQILFVSRPDKKKILFFNDKSCQFSVDEEFQKLWR
FT                   SVTVESMDEEKIEEYLKRQGISSMQESGPKKVASIQRRKKPASQKKRRFKTHNEHLAGV
FT                   LKDYSDITPGK"
FT   CDS             join(698307..698475,716961..717052,720373..720480,
FT                   723084..723266,726554..726647,740628..740743,
FT                   741139..741255)
FT                   /codon_start=1
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), isoform CRA_a"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT170821.0
FT                   protein_id=mCP93740.0 isoform=CRA_a"
FT                   /protein_id="EDL35419.1"
FT                   /translation="MDPSLLRDRELFKKRALSTPVVEKRAVPSESPSSSSSKKKKAKVE
FT                   HGGSSGSKQNSDHNNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLEEIL
FT                   DETQHLDIGLKQKQWLMTEALVNNPKIEVVDGKYAFKPKYNLKDKKALLRLLDNHDQRG
FT                   LGGILLEDIEEGLPNSQKAVKALGDQILFVSRPDKKKILFFNDKSCQFSVDEEFQKLWR
FT                   SVTVESMDEEKIEEYLKRQGISSMQESGPKKVASIQRRKKPASQKKRRFKTHNEHLAGV
FT                   LKDYSDITPGK"
FT   CDS             join(698307..698475,716961..717052,720373..720480,
FT                   723084..723266,726554..726647,740628..740743,
FT                   741139..741255)
FT                   /codon_start=1
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), isoform CRA_a"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT170822.1
FT                   protein_id=mCP93738.0 isoform=CRA_a"
FT                   /protein_id="EDL35420.1"
FT                   /translation="MDPSLLRDRELFKKRALSTPVVEKRAVPSESPSSSSSKKKKAKVE
FT                   HGGSSGSKQNSDHNNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLEEIL
FT                   DETQHLDIGLKQKQWLMTEALVNNPKIEVVDGKYAFKPKYNLKDKKALLRLLDNHDQRG
FT                   LGGILLEDIEEGLPNSQKAVKALGDQILFVSRPDKKKILFFNDKSCQFSVDEEFQKLWR
FT                   SVTVESMDEEKIEEYLKRQGISSMQESGPKKVASIQRRKKPASQKKRRFKTHNEHLAGV
FT                   LKDYSDITPGK"
FT   CDS             join(698307..698475,716961..717052,720373..720480,
FT                   723084..723266,726554..726647,740628..740743,
FT                   741139..741255)
FT                   /codon_start=1
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), isoform CRA_a"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT170820.1
FT                   protein_id=mCP93739.0 isoform=CRA_a"
FT                   /protein_id="EDL35422.1"
FT                   /translation="MDPSLLRDRELFKKRALSTPVVEKRAVPSESPSSSSSKKKKAKVE
FT                   HGGSSGSKQNSDHNNGSFNLKALSGSSGYKFGVLAKIVNYMKTRHQRGDTHPLTLEEIL
FT                   DETQHLDIGLKQKQWLMTEALVNNPKIEVVDGKYAFKPKYNLKDKKALLRLLDNHDQRG
FT                   LGGILLEDIEEGLPNSQKAVKALGDQILFVSRPDKKKILFFNDKSCQFSVDEEFQKLWR
FT                   SVTVESMDEEKIEEYLKRQGISSMQESGPKKVASIQRRKKPASQKKRRFKTHNEHLAGV
FT                   LKDYSDITPGK"
FT   assembly_gap    701598..701725
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    702809..702828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    704934..705078
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    707293..707312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(717047..717052,720373..720480,723084..723266,
FT                   726554..726647,740628..740743,741139..741255)
FT                   /codon_start=1
FT                   /gene="Gtf2e2"
FT                   /locus_tag="mCG_2433"
FT                   /product="general transcription factor II E, polypeptide 2
FT                   (beta subunit), isoform CRA_b"
FT                   /note="gene_id=mCG2433.2 transcript_id=mCT180441.0
FT                   protein_id=mCP103363.0 isoform=CRA_b"
FT                   /protein_id="EDL35421.1"
FT                   /translation="MKTRHQRGDTHPLTLEEILDETQHLDIGLKQKQWLMTEALVNNPK
FT                   IEVVDGKYAFKPKYNLKDKKALLRLLDNHDQRGLGGILLEDIEEGLPNSQKAVKALGDQ
FT                   ILFVSRPDKKKILFFNDKSCQFSVDEEFQKLWRSVTVESMDEEKIEEYLKRQGISSMQE
FT                   SGPKKVASIQRRKKPASQKKRRFKTHNEHLAGVLKDYSDITPGK"
FT   assembly_gap    731590..731609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(747745..862923)
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /note="gene_id=mCG2440.2"
FT   mRNA            complement(join(747745..749296,760230..760298,
FT                   771805..771938,809107..809257,835494..835556,
FT                   836847..836885,838825..>838902))
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /product="RNA binding protein gene with multiple splicing,
FT                   transcript variant mCT171712"
FT                   /note="gene_id=mCG2440.2 transcript_id=mCT171712.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(747745..749296,754527..754630,
FT                   760230..760298,771805..771938,809107..809257,
FT                   835494..835556,836847..836885,838825..>838902))
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /product="RNA binding protein gene with multiple splicing,
FT                   transcript variant mCT1428"
FT                   /note="gene_id=mCG2440.2 transcript_id=mCT1428.2 created on
FT                   06-AUG-2002"
FT   assembly_gap    753773..753792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(760236..760298,771805..771938,
FT                   809107..809257,835494..835556,836847..836885,
FT                   838825..>838902))
FT                   /codon_start=1
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /product="RNA binding protein gene with multiple splicing,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2440.2 transcript_id=mCT1428.2
FT                   protein_id=mCP23049.2 isoform=CRA_a"
FT                   /protein_id="EDL35423.1"
FT                   /translation="VRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVS
FT                   FDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQ
FT                   FIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAAFTYPASLHAQMRWIPPSE
FT                   ATSQGWKSRQFC"
FT   CDS             complement(join(760236..760298,771805..771938,
FT                   809107..809257,835494..835556,836847..836885,
FT                   838825..>838902))
FT                   /codon_start=1
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /product="RNA binding protein gene with multiple splicing,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG2440.2 transcript_id=mCT171712.0
FT                   protein_id=mCP94632.0 isoform=CRA_a"
FT                   /protein_id="EDL35424.1"
FT                   /translation="VRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVS
FT                   FDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQ
FT                   FIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAAFTYPASLHAQMRWIPPSE
FT                   ATSQGWKSRQFC"
FT   mRNA            complement(join(769031..769276,771805..771938,
FT                   798430..798580,835494..835556,836847..836885,
FT                   838825..838902,862742..862923))
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /product="RNA binding protein gene with multiple splicing,
FT                   transcript variant mCT171713"
FT                   /note="gene_id=mCG2440.2 transcript_id=mCT171713.0 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(769031..769276,771805..771938,
FT                   809107..809257,835494..835556,836847..836885,
FT                   838825..>838902))
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /product="RNA binding protein gene with multiple splicing,
FT                   transcript variant mCT171714"
FT                   /note="gene_id=mCG2440.2 transcript_id=mCT171714.0 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(769145..769276,771805..771938,
FT                   798430..798580,835494..835556,836847..836885,
FT                   838825..838902,862742..862828))
FT                   /codon_start=1
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /product="RNA binding protein gene with multiple splicing,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG2440.2 transcript_id=mCT171713.0
FT                   protein_id=mCP94633.0 isoform=CRA_b"
FT                   /protein_id="EDL35425.1"
FT                   /translation="MLCKLLKCKDEGDLFLSGRGNGKRCCVSMVRTLFVSGLPLDIKPR
FT                   ELYLLFRPFKGYEGSLIKLTSKQPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLE
FT                   FAKANTKMAKNKLVGTPNPSTPLPNTVPQFIAREPYELTVPALYPSSPEVWAPYPLYPA
FT                   ELAPALPPPAAFTYPASLHAQCFSPEAKPNTPVFCPLLQQIRFVSGNVFVTYQPTADQQ
FT                   RELPC"
FT   CDS             complement(join(769145..769276,771805..771938,
FT                   809107..809257,835494..835556,836847..836885,
FT                   838825..>838902))
FT                   /codon_start=1
FT                   /gene="Rbpms"
FT                   /locus_tag="mCG_2440"
FT                   /product="RNA binding protein gene with multiple splicing,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG2440.2 transcript_id=mCT171714.0
FT                   protein_id=mCP94631.0 isoform=CRA_c"
FT                   /protein_id="EDL35426.1"
FT                   /translation="VRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSKQPVGFVS
FT                   FDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPLPNTVPQ
FT                   FIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAAFTYPASLHAQCFSPEAKP
FT                   NTPVFCPLLQQIRFVSGNVFVTYQPTADQQRELPC"
FT   assembly_gap    777166..777185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    790352..790371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    792478..792497
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    796497..796859
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    797890..797977
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    799574..799593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    801261..803768
FT                   /estimated_length=2508
FT                   /gap_type="unknown"
FT   assembly_gap    804848..804867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    808915..808934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    810233..810252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    818783..818991
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    842117..842136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    844732..845101
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    849257..849342
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    867947..868087
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    882178..882347
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    902051..902070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    903406..904310
FT                   /estimated_length=905
FT                   /gap_type="unknown"
FT   assembly_gap    909564..909795
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    922389..922522
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    924543..924709
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    935401..935457
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    938957..939184
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    941354..941693
FT                   /estimated_length=340
FT                   /gap_type="unknown"
FT   assembly_gap    946415..947253
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    949529..950692
FT                   /estimated_length=1164
FT                   /gap_type="unknown"
FT   assembly_gap    957341..957418
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    959891..959910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            961093..962170
FT                   /locus_tag="mCG_1042835"
FT                   /note="gene_id=mCG1042835.1"
FT   mRNA            join(961093..961202,962066..962170)
FT                   /locus_tag="mCG_1042835"
FT                   /product="mCG1042835"
FT                   /note="gene_id=mCG1042835.1 transcript_id=mCT160539.1
FT                   created on 06-AUG-2002"
FT   CDS             join(961116..961202,962066..962095)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042835"
FT                   /product="mCG1042835"
FT                   /note="gene_id=mCG1042835.1 transcript_id=mCT160539.1
FT                   protein_id=mCP59866.1"
FT                   /protein_id="EDL35427.1"
FT                   /translation="MSERRECEKPCFSHAGLLGVHFLRALSQQFPQVFWPQK"
FT   assembly_gap    972360..973668
FT                   /estimated_length=1309
FT                   /gap_type="unknown"
FT   assembly_gap    975312..975331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    980841..997991
FT                   /estimated_length=17151
FT                   /gap_type="unknown"
FT   gene            999321..1000614
FT                   /locus_tag="mCG_141107"
FT                   /note="gene_id=mCG141107.0"
FT   mRNA            join(999321..999457,1000111..1000614)
FT                   /locus_tag="mCG_141107"
FT                   /product="mCG141107"
FT                   /note="gene_id=mCG141107.0 transcript_id=mCT173139.0
FT                   created on 04-SEP-2002"
FT   CDS             1000222..1000410
FT                   /codon_start=1
FT                   /locus_tag="mCG_141107"
FT                   /product="mCG141107"
FT                   /note="gene_id=mCG141107.0 transcript_id=mCT173139.0
FT                   protein_id=mCP96058.0"
FT                   /protein_id="EDL35428.1"
FT                   /translation="MYCVSETHTELRMHIYSHTYTYAYTVTWSLPPSLSLSVCLSVCLS
FT                   VSLARSLSLSHTHTHTH"
FT   assembly_gap    1001763..1001850
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    1015390..1015904
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    1026267..1026286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1033739..1054338)
FT                   /gene="Dctn6"
FT                   /locus_tag="mCG_2435"
FT                   /note="gene_id=mCG2435.2"
FT   mRNA            complement(join(1033739..1034158,1035855..1035997,
FT                   1036974..1037021,1038311..1038399,1040503..1040608,
FT                   1049515..1049579,1054236..1054338))
FT                   /gene="Dctn6"
FT                   /locus_tag="mCG_2435"
FT                   /product="dynactin 6, transcript variant mCT1434"
FT                   /note="gene_id=mCG2435.2 transcript_id=mCT1434.2 created on
FT                   16-JUL-2002"
FT   mRNA            complement(join(1033739..1034158,1035855..1035997,
FT                   1036974..1037021,1038311..1038399,1040503..1040608,
FT                   1049515..1049579,1053390..1053964))
FT                   /gene="Dctn6"
FT                   /locus_tag="mCG_2435"
FT                   /product="dynactin 6, transcript variant mCT170823"
FT                   /note="gene_id=mCG2435.2 transcript_id=mCT170823.0 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(1034060..1034158,1035855..1035997,
FT                   1036974..1037021,1038311..1038399,1040503..1040608,
FT                   1049515..1049579,1054236..1054258))
FT                   /codon_start=1
FT                   /gene="Dctn6"
FT                   /locus_tag="mCG_2435"
FT                   /product="dynactin 6, isoform CRA_a"
FT                   /note="gene_id=mCG2435.2 transcript_id=mCT1434.2
FT                   protein_id=mCP23075.2 isoform=CRA_a"
FT                   /protein_id="EDL35429.1"
FT                   /translation="MAEKTQKSVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEA
FT                   GPIIIGEGNLIEEQALIINAHPDNIIPDTEDTEPKPMIIGTNNVFEVGCHSQAMKMGDN
FT                   NVIESKAYVGRNVILTSGCIIGACCSLNTFEAIPENTVIYGADCLRRVQTERPQPQTLQ
FT                   LDFLMKILPNYHHLKKTMKGSSTPVKN"
FT   CDS             complement(join(1034060..1034158,1035855..1035997,
FT                   1036974..1037021,1038311..1038399,1040503..1040608,
FT                   1049515..1049579,1053390..1053397))
FT                   /codon_start=1
FT                   /gene="Dctn6"
FT                   /locus_tag="mCG_2435"
FT                   /product="dynactin 6, isoform CRA_b"
FT                   /note="gene_id=mCG2435.2 transcript_id=mCT170823.0
FT                   protein_id=mCP93741.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z6H3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR027777"
FT                   /db_xref="MGI:MGI:1343154"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z6H3"
FT                   /protein_id="EDL35430.1"
FT                   /translation="MSGVKIAPGAVVCVESEIRGDVTIGPRTVIHPKARIIAEAGPIII
FT                   GEGNLIEEQALIINAHPDNIIPDTEDTEPKPMIIGTNNVFEVGCHSQAMKMGDNNVIES
FT                   KAYVGRNVILTSGCIIGACCSLNTFEAIPENTVIYGADCLRRVQTERPQPQTLQLDFLM
FT                   KILPNYHHLKKTMKGSSTPVKN"
FT   assembly_gap    1038564..1038583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1039351..1039417
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    1046968..1046987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1050644..1052632
FT                   /estimated_length=1989
FT                   /gap_type="unknown"
FT   gene            1060066..>1070777
FT                   /locus_tag="mCG_63729"
FT                   /note="gene_id=mCG63729.2"
FT   mRNA            join(1060066..1060246,1066079..1066303,1069814..>1070777)
FT                   /locus_tag="mCG_63729"
FT                   /product="mCG63729, transcript variant mCT171715"
FT                   /note="gene_id=mCG63729.2 transcript_id=mCT171715.0 created
FT                   on 06-AUG-2002"
FT   CDS             join(1060128..1060246,1066079..1066303,1069814..1070777)
FT                   /codon_start=1
FT                   /locus_tag="mCG_63729"
FT                   /product="mCG63729, isoform CRA_b"
FT                   /note="gene_id=mCG63729.2 transcript_id=mCT171715.0
FT                   protein_id=mCP94634.0 isoform=CRA_b"
FT                   /protein_id="EDL35432.1"
FT                   /translation="MDWLQLFFLHPLSFYQGAAFPFALLFNYLCVLDTFSTRARYLFLL
FT                   AGGGVLALAAMGPYSLLIFIPALCAVALVSFLSPQEVHRLTFFFQMGWQTLCHLGLHYT
FT                   EYYLGEPPPVRFYITLSSLMLLTQRVTSLSLDICEGKVEAPRRGIRSKSSFSEHLWDAL
FT                   PHFSYLLFFPALLGGSLCSFRRFQACVQRSSSLYPSISFRALTWRGLQILGLECLKVAL
FT                   RSAVSAGAGLDDCQRLECIYLMWSTAWLFKLTYYSHWILDDSLLHAAGFGAEAGQGPGE
FT                   EGYVPDVDIWTLETTHRISLFARQWNRSTALWLRRLVFRKSRRWPLLQTFAFSAWWHGL
FT                   HPGQVFGFLCWSVMVKADYLIHTFANVCIRSWPLRLLYRALTWAHTQLIIAYIMLAVEG
FT                   RSLSSLCQLCCSYNSLFPVMYGLLLFLLAERKDKRN"
FT   assembly_gap    1060469..1060851
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   gene            complement(1062444..>1063372)
FT                   /locus_tag="mCG_1042836"
FT                   /note="gene_id=mCG1042836.0"
FT   mRNA            complement(join(1062444..1063042,1063282..>1063372))
FT                   /locus_tag="mCG_1042836"
FT                   /product="mCG1042836"
FT                   /note="gene_id=mCG1042836.0 transcript_id=mCT160540.0
FT                   created on 06-AUG-2002"
FT   CDS             complement(join(1062918..1063042,1063282..1063372))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042836"
FT                   /product="mCG1042836"
FT                   /note="gene_id=mCG1042836.0 transcript_id=mCT160540.0
FT                   protein_id=mCP59873.1"
FT                   /protein_id="EDL35433.1"
FT                   /translation="MPTWKQQCVPRSSLRSPKEEGVKSLGETIFSPSWFFFMQNLEGFY
FT                   LSCAKLVKLEEGVRIRVRWARLGTAR"
FT   assembly_gap    1064373..1064392
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1065047..1066321)
FT                   /locus_tag="mCG_1042837"
FT                   /note="gene_id=mCG1042837.1"
FT   mRNA            complement(join(1065047..1065744,1066083..1066321))
FT                   /locus_tag="mCG_1042837"
FT                   /product="mCG1042837"
FT                   /note="gene_id=mCG1042837.1 transcript_id=mCT160541.1
FT                   created on 06-AUG-2002"
FT   CDS             complement(1065083..1065322)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042837"
FT                   /product="mCG1042837"
FT                   /note="gene_id=mCG1042837.1 transcript_id=mCT160541.1
FT                   protein_id=mCP59874.1"
FT                   /protein_id="EDL35434.1"
FT                   /translation="MICCFVFKFLWFTNSVMKICNSCGSVTAGSLVLLSSTELVPSLLS
FT                   SLCPQLPYSTTFQSFFISCNPWLPSSLCKPKNHK"
FT   mRNA            <1069803..>1070777
FT                   /locus_tag="mCG_63729"
FT                   /product="mCG63729, transcript variant mCT63912"
FT                   /note="gene_id=mCG63729.2 transcript_id=mCT63912.2 created
FT                   on 06-AUG-2002"
FT   CDS             1069803..1070777
FT                   /codon_start=1
FT                   /locus_tag="mCG_63729"
FT                   /product="mCG63729, isoform CRA_a"
FT                   /note="gene_id=mCG63729.2 transcript_id=mCT63912.2
FT                   protein_id=mCP42791.2 isoform=CRA_a"
FT                   /protein_id="EDL35431.1"
FT                   /translation="MSFRFYITLSSLMLLTQRVTSLSLDICEGKVEAPRRGIRSKSSFS
FT                   EHLWDALPHFSYLLFFPALLGGSLCSFRRFQACVQRSSSLYPSISFRALTWRGLQILGL
FT                   ECLKVALRSAVSAGAGLDDCQRLECIYLMWSTAWLFKLTYYSHWILDDSLLHAAGFGAE
FT                   AGQGPGEEGYVPDVDIWTLETTHRISLFARQWNRSTALWLRRLVFRKSRRWPLLQTFAF
FT                   SAWWHGLHPGQVFGFLCWSVMVKADYLIHTFANVCIRSWPLRLLYRALTWAHTQLIIAY
FT                   IMLAVEGRSLSSLCQLCCSYNSLFPVMYGLLLFLLAERKDKRN"
FT   assembly_gap    1077774..1077793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1081993..1093218)
FT                   /gene="Leprotl1"
FT                   /locus_tag="mCG_2437"
FT                   /note="gene_id=mCG2437.2"
FT   mRNA            complement(join(1081993..1084261,1085282..1085468,
FT                   1087210..1087285,1093128..1093218))
FT                   /gene="Leprotl1"
FT                   /locus_tag="mCG_2437"
FT                   /product="leptin receptor overlapping transcript-like 1"
FT                   /note="gene_id=mCG2437.2 transcript_id=mCT1436.2 created on
FT                   16-JUL-2002"
FT   CDS             complement(join(1084145..1084261,1085282..1085468,
FT                   1087210..1087285,1093128..1093143))
FT                   /codon_start=1
FT                   /gene="Leprotl1"
FT                   /locus_tag="mCG_2437"
FT                   /product="leptin receptor overlapping transcript-like 1"
FT                   /note="gene_id=mCG2437.2 transcript_id=mCT1436.2
FT                   protein_id=mCP23078.2"
FT                   /protein_id="EDL35435.1"
FT                   /translation="MAGIKALISLSFGGAIGLMFLMLGCALPIYNQYWPLFVLFFYILS
FT                   PIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPVVFARAHLIEWGACALVLT
FT                   GNTVIFATILGFFLVFGSNDDFSWQQW"
FT   assembly_gap    1093219..1093767
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   gene            <1093768..1095079
FT                   /locus_tag="mCG_1042838"
FT                   /note="gene_id=mCG1042838.0"
FT   mRNA            join(<1093768..1094125,1094868..1095079)
FT                   /locus_tag="mCG_1042838"
FT                   /product="mCG1042838"
FT                   /note="gene_id=mCG1042838.0 transcript_id=mCT160542.0
FT                   created on 06-AUG-2002"
FT   CDS             <1093769..1093933
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042838"
FT                   /product="mCG1042838"
FT                   /note="gene_id=mCG1042838.0 transcript_id=mCT160542.0
FT                   protein_id=mCP59881.0"
FT                   /protein_id="EDL35436.1"
FT                   /translation="DVFAGSPHFLPREPISPPTTQSVTREMGGLCFSPWVPNTDPMRSP
FT                   PPPQGVNES"
FT   assembly_gap    1098262..1098511
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   gene            1099186..1099493
FT                   /pseudo
FT                   /locus_tag="mCG_1042777"
FT                   /note="gene_id=mCG1042777.1"
FT   mRNA            1099186..1099493
FT                   /pseudo
FT                   /locus_tag="mCG_1042777"
FT                   /note="gene_id=mCG1042777.1 transcript_id=mCT160481.1
FT                   created on 06-AUG-2002"
FT   gene            1101099..1117119
FT                   /gene="Tmem66"
FT                   /locus_tag="mCG_2442"
FT                   /note="gene_id=mCG2442.2"
FT   mRNA            join(1101099..1101367,1107744..1107922,1111316..1111715,
FT                   1113891..1114029,1114630..1114784,1116265..1117119)
FT                   /gene="Tmem66"
FT                   /locus_tag="mCG_2442"
FT                   /product="transmembrane protein 66"
FT                   /note="gene_id=mCG2442.2 transcript_id=mCT1423.2 created on
FT                   14-NOV-2002"
FT   CDS             join(1101175..1101367,1107744..1107922,1111316..1111715,
FT                   1113891..1114029,1114630..1114784,1116265..1116290)
FT                   /codon_start=1
FT                   /gene="Tmem66"
FT                   /locus_tag="mCG_2442"
FT                   /product="transmembrane protein 66"
FT                   /note="gene_id=mCG2442.2 transcript_id=mCT1423.2
FT                   protein_id=mCP23060.1"
FT                   /protein_id="EDL35437.1"
FT                   /translation="MVGSCGRCAAAGRLPQRVSGHRAPSSPSAMAVAAVGRPRAVRCPL
FT                   LLLLSLLLVAGPALGWNDPDRILLRDVKALTLYSDRYTTSRRLDPIPQLKCVGGTAGCE
FT                   AYTPRVIQCQNKGWDGYDVQWECKTDLDIAYKFGKTVVSCEGYESSEDQYVLRGSCGLE
FT                   YNLDYTELGLKKLKESGKHQGFSDYYHKLYSSDSCGFITIAVLFVLAFAVYKLFLSDGQ
FT                   GSPPPYSEHPPYSEHSQRFASAAGAPPPGFKSEFTGPQNTGYGASSGFGSAFGGQGYGS
FT                   SGPGFWSGLGAGGLLGYLFGSNRAATPFSDSWYHPAYPPSHSGAWNSRAYSPLGGGAGS
FT                   YCASSNADSRTRTASGYGGTRRR"
FT   assembly_gap    1109076..1109314
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    1117467..1117701
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    1124097..1124116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1125124..1126013
FT                   /estimated_length=890
FT                   /gap_type="unknown"
FT   assembly_gap    1129815..1135402
FT                   /estimated_length=5588
FT                   /gap_type="unknown"
FT   assembly_gap    1141631..1142047
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    1161378..1161490
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    1174800..1174819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1175429..1180642
FT                   /locus_tag="mCG_1042840"
FT                   /note="gene_id=mCG1042840.0"
FT   mRNA            join(<1175429..1175447,1178346..1178452,1180527..1180642)
FT                   /locus_tag="mCG_1042840"
FT                   /product="mCG1042840"
FT                   /note="gene_id=mCG1042840.0 transcript_id=mCT160544.0
FT                   created on 07-AUG-2002"
FT   CDS             join(<1175430..1175447,1178346..1178452,1180527..1180614)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042840"
FT                   /product="mCG1042840"
FT                   /note="gene_id=mCG1042840.0 transcript_id=mCT160544.0
FT                   protein_id=mCP59890.0"
FT                   /protein_id="EDL35438.1"
FT                   /translation="WHLGLKGDATADGVLIGKQSVCWLLGPLGWLLLLPYLQSGDGDEI
FT                   QGLSRYANEASFLNSNCGIALKNLF"
FT   assembly_gap    1183812..1183831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1212810..1212829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1217346..1217365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1224724..1224831
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    1240829..1240915
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    1246371..1246823
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    1256790..1256923
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   gene            complement(1256924..1257569)
FT                   /locus_tag="mCG_22278"
FT                   /note="gene_id=mCG22278.1"
FT   mRNA            complement(1256924..1257569)
FT                   /locus_tag="mCG_22278"
FT                   /product="mCG22278"
FT                   /note="gene_id=mCG22278.1 transcript_id=mCT21105.1 created
FT                   on 17-JUL-2002"
FT   CDS             complement(1257062..1257535)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22278"
FT                   /product="mCG22278"
FT                   /note="gene_id=mCG22278.1 transcript_id=mCT21105.1
FT                   protein_id=mCP23050.2"
FT                   /protein_id="EDL35439.1"
FT                   /translation="MASLKDLEGKWRLMESHGFEEYAKELGVGLALRKMAAMAKPDSII
FT                   TCDGNNITIKTESTVKTTVFSCTLGEKFDETMADGRKTEMVCTFQDGALVQHQQWEGEH
FT                   DNRKTEGWEVDCGACHEQCHLHSGLREGAMRASSSSWTGVSCQSEYAQFSERT"
FT   assembly_gap    1262617..1263016
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    1268889..1269038
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    1271627..1271938
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   gene            complement(1272244..1272818)
FT                   /pseudo
FT                   /locus_tag="mCG_22283"
FT                   /note="gene_id=mCG22283.2"
FT   mRNA            complement(1272244..1272818)
FT                   /pseudo
FT                   /locus_tag="mCG_22283"
FT                   /note="gene_id=mCG22283.2 transcript_id=mCT21108.2 created
FT                   on 07-AUG-2002"
FT   assembly_gap    1276076..1276133
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            1277706..1278333
FT                   /pseudo
FT                   /locus_tag="mCG_50436"
FT                   /note="gene_id=mCG50436.2"
FT   mRNA            1277706..1278333
FT                   /pseudo
FT                   /locus_tag="mCG_50436"
FT                   /note="gene_id=mCG50436.2 transcript_id=mCT50619.2 created
FT                   on 07-AUG-2002"
FT   assembly_gap    1288008..1288029
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    1290069..1290088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1312784..1312984
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    1333414..1336508
FT                   /estimated_length=3095
FT                   /gap_type="unknown"
FT   assembly_gap    1342939..1342958
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1368719..1368738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1375316..1375434
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    1382314..1382333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1386551..1386812
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    1396371..1397676
FT                   /estimated_length=1306
FT                   /gap_type="unknown"
FT   assembly_gap    1399775..1400122
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    1403299..1403405
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    1421916..1422584
FT                   /estimated_length=669
FT                   /gap_type="unknown"
FT   gene            1423037..1423589
FT                   /locus_tag="mCG_1042841"
FT                   /note="gene_id=mCG1042841.1"
FT   mRNA            1423037..1423589
FT                   /locus_tag="mCG_1042841"
FT                   /product="mCG1042841"
FT                   /note="gene_id=mCG1042841.1 transcript_id=mCT160545.1
FT                   created on 04-FEB-2003"
FT   CDS             1423117..1423200
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042841"
FT                   /product="mCG1042841"
FT                   /note="gene_id=mCG1042841.1 transcript_id=mCT160545.1
FT                   protein_id=mCP59898.1"
FT                   /protein_id="EDL35440.1"
FT                   /translation="MFEDGGLIPCVAGESPMMKLSKIMIAS"
FT   gene            complement(1430475..1459237)
FT                   /locus_tag="mCG_1042842"
FT                   /note="gene_id=mCG1042842.0"
FT   mRNA            complement(join(1430475..1432168,1433363..1433510,
FT                   1459119..1459237))
FT                   /locus_tag="mCG_1042842"
FT                   /product="mCG1042842"
FT                   /note="gene_id=mCG1042842.0 transcript_id=mCT160546.0
FT                   created on 07-AUG-2002"
FT   CDS             complement(1431242..1431493)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042842"
FT                   /product="mCG1042842"
FT                   /note="gene_id=mCG1042842.0 transcript_id=mCT160546.0
FT                   protein_id=mCP59903.1"
FT                   /protein_id="EDL35441.1"
FT                   /translation="MFGSGSLHLFWPAAGWSLSEDSYARLLSVSITECKLVQPPWESIW
FT                   HFLRKLGIVLPLNSAITLLSIYPKMLHHPTRTLAQPCS"
FT   assembly_gap    1440236..1440364
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    1441041..1446457
FT                   /estimated_length=5417
FT                   /gap_type="unknown"
FT   gene            1456393..1456937
FT                   /pseudo
FT                   /locus_tag="mCG_22279"
FT                   /note="gene_id=mCG22279.1"
FT   mRNA            1456393..1456937
FT                   /pseudo
FT                   /locus_tag="mCG_22279"
FT                   /note="gene_id=mCG22279.1 transcript_id=mCT21106.1 created
FT                   on 17-JUL-2002"
FT   assembly_gap    1456974..1457660
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    1462333..1462352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1464706..1464839
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    1471614..1473115
FT                   /estimated_length=1502
FT                   /gap_type="unknown"
FT   gene            1473384..1476685
FT                   /locus_tag="mCG_148212"
FT                   /note="gene_id=mCG148212.0"
FT   mRNA            join(1473384..1473488,1475229..1476685)
FT                   /locus_tag="mCG_148212"
FT                   /product="mCG148212"
FT                   /note="gene_id=mCG148212.0 transcript_id=mCT188475.0
FT                   created on 13-JAN-2004"
FT   CDS             1475469..1475639
FT                   /codon_start=1
FT                   /locus_tag="mCG_148212"
FT                   /product="mCG148212"
FT                   /note="gene_id=mCG148212.0 transcript_id=mCT188475.0
FT                   protein_id=mCP108791.0"
FT                   /protein_id="EDL35442.1"
FT                   /translation="MRIWAGKVCNFSHSSCIWAEGRMWVGGVYLLLCSLTIPQITELLG
FT                   IQNCYYGVPSA"
FT   assembly_gap    1484742..1484761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1492397..1495409
FT                   /estimated_length=3013
FT                   /gap_type="unknown"
FT   assembly_gap    1496005..1496310
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    1519616..1519638
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    1521575..1521594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1539169..1546209)
FT                   /locus_tag="mCG_145760"
FT                   /note="gene_id=mCG145760.0"
FT   mRNA            complement(join(1539169..1540332,1541505..1541681,
FT                   1545739..1546209))
FT                   /locus_tag="mCG_145760"
FT                   /product="mCG145760"
FT                   /note="gene_id=mCG145760.0 transcript_id=mCT185765.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(1539341..1539688)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145760"
FT                   /product="mCG145760"
FT                   /note="gene_id=mCG145760.0 transcript_id=mCT185765.0
FT                   protein_id=mCP107023.0"
FT                   /protein_id="EDL35443.1"
FT                   /translation="MHVYMEVFGSIYNFKKYPRSKPVFHLVSKPFHKYLFPTWRYLGSP
FT                   DLSVSPEHAHSCLPAHACCFSCPLPSFPLLISICSFSRKTSRHFYSALLSLAQQRPGSL
FT                   LSWFELVLSGL"
FT   assembly_gap    1546488..1546507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1547754..1547773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1548342..>1594543)
FT                   /locus_tag="mCG_1042843"
FT                   /note="gene_id=mCG1042843.1"
FT   mRNA            complement(join(1548342..1548629,1573250..1573417,
FT                   1594392..>1594543))
FT                   /locus_tag="mCG_1042843"
FT                   /product="mCG1042843"
FT                   /note="gene_id=mCG1042843.1 transcript_id=mCT160547.1
FT                   created on 07-AUG-2002"
FT   assembly_gap    1548829..1548848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1551019..1551038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1555518..1556169
FT                   /estimated_length=652
FT                   /gap_type="unknown"
FT   assembly_gap    1571635..1571654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1580704..1580723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1584565..1584584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1590932..1591425
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    1592968..1593215
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   CDS             complement(1594395..>1594541)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042843"
FT                   /product="mCG1042843"
FT                   /note="gene_id=mCG1042843.1 transcript_id=mCT160547.1
FT                   protein_id=mCP59906.1"
FT                   /protein_id="EDL35444.1"
FT                   /translation="FSPEALCKARACAYCRHHSLKSSDTSTSCVAQALAGEVVMGLFLA
FT                   IIL"
FT   assembly_gap    1616043..1616062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1617499..1617518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1622020..1622039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1629476..1629785
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    1630665..1630956
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    1639587..1639618
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    1644524..1644543
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1669535..1669658
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    1672692..1672811
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    1677789..1677808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1690044..1690357
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    1706057..1706954
FT                   /estimated_length=898
FT                   /gap_type="unknown"
FT   assembly_gap    1708536..1709414
FT                   /estimated_length=879
FT                   /gap_type="unknown"
FT   assembly_gap    1712557..1712576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1720396..1720415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1722036..1723567
FT                   /estimated_length=1532
FT                   /gap_type="unknown"
FT   assembly_gap    1724916..1724935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1725956..1725975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1727966..1731541
FT                   /estimated_length=3576
FT                   /gap_type="unknown"
FT   assembly_gap    1736490..1742009
FT                   /estimated_length=5520
FT                   /gap_type="unknown"
FT   gene            1750719..1765286
FT                   /gene="Dusp4"
FT                   /locus_tag="mCG_22284"
FT                   /note="gene_id=mCG22284.2"
FT   mRNA            join(1750719..1751555,1759792..1759937,1760480..1760699,
FT                   1761735..1765286)
FT                   /gene="Dusp4"
FT                   /locus_tag="mCG_22284"
FT                   /product="dual specificity phosphatase 4"
FT                   /note="gene_id=mCG22284.2 transcript_id=mCT21109.2 created
FT                   on 07-AUG-2002"
FT   CDS             join(1751114..1751555,1759792..1759937,1760480..1760699,
FT                   1761735..1762120)
FT                   /codon_start=1
FT                   /gene="Dusp4"
FT                   /locus_tag="mCG_22284"
FT                   /product="dual specificity phosphatase 4"
FT                   /note="gene_id=mCG22284.2 transcript_id=mCT21109.2
FT                   protein_id=mCP23061.2"
FT                   /protein_id="EDL35445.1"
FT                   /translation="MVTMEELREMDCSVLKRLMNRDENGGGGAGGNGSGSHGALGLLSG
FT                   GKCLLLDCRPFLAHSAGYIRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGL
FT                   YSAVIVYDERSPRAESLREDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSK
FT                   TKALAAIPPPVPPSTNESLDLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDA
FT                   LGITALLNVSSDCPNHFEGHYQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLV
FT                   HCQAGISRSATICLAYLMMKKRVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLTT
FT                   SCAAEAASPSGPLRERGKATPTPTSQFVFSFPVSVGVHAAPSNLPYLHSPITTSPSC"
FT   gene            complement(1774819..1908643)
FT                   /gene="Tnks"
FT                   /locus_tag="mCG_22286"
FT                   /note="gene_id=mCG22286.2"
FT   mRNA            complement(join(1774819..1775065,1777791..1777947,
FT                   1781805..1781919,1782238..1782343,1783290..1783364,
FT                   1785087..1785184,1786238..1786358,1790632..1790714,
FT                   1791671..1791908,1792243..1792431,1794189..1794298,
FT                   1794705..1794924,1796205..1796370,1798925..1799070,
FT                   1800441..1800520,1804496..1804667,1810237..1810315,
FT                   1810650..1810741,1812276..1812397,1815822..1816008,
FT                   1816383..1816449,1818007..1818101,1832150..1832225,
FT                   1832981..1833017,1860751..1860846,1883027..1883251,
FT                   1907449..1908643))
FT                   /gene="Tnks"
FT                   /locus_tag="mCG_22286"
FT                   /product="tankyrase, TRF1-interacting ankyrin-related
FT                   ADP-ribose polymerase, transcript variant mCT21113"
FT                   /note="gene_id=mCG22286.2 transcript_id=mCT21113.2 created
FT                   on 07-AUG-2002"
FT   mRNA            complement(join(1774913..1775065,1777791..1777947,
FT                   1781733..1781919,1782238..1782343,1783290..1783364,
FT                   1785087..1785184,1786238..1786358,1790632..1790714,
FT                   1791671..1791908,1792243..1792431,1794189..1794298,
FT                   1794705..1794924,1796205..1796370,1798925..1799070,
FT                   1800441..1800520,1804496..1804667,1810237..1810315,
FT                   1810650..1810741,1812276..1812397,1815822..1816008,
FT                   1816383..1816449,1818007..1818101,1832150..1832225,
FT                   1832981..1833017,1860751..1860846,1883027..1883251,
FT                   1907449..>1908106))
FT                   /gene="Tnks"
FT                   /locus_tag="mCG_22286"
FT                   /product="tankyrase, TRF1-interacting ankyrin-related
FT                   ADP-ribose polymerase, transcript variant mCT193312"
FT                   /note="gene_id=mCG22286.2 transcript_id=mCT193312.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1774979..1775065,1777791..1777947,
FT                   1781733..1781919,1782238..1782343,1783290..1783364,
FT                   1785087..1785184,1786238..1786358,1790632..1790714,
FT                   1791671..1791908,1792243..1792431,1794189..1794298,
FT                   1794705..1794924,1796205..1796370,1798925..1799070,
FT                   1800441..1800520,1804496..1804667,1810237..1810315,
FT                   1810650..1810741,1812276..1812397,1815822..1816008,
FT                   1816383..1816449,1818007..1818101,1832150..1832225,
FT                   1832981..1833017,1860751..1860846,1883027..1883251,
FT                   1907449..>1908106))
FT                   /codon_start=1
FT                   /gene="Tnks"
FT                   /locus_tag="mCG_22286"
FT                   /product="tankyrase, TRF1-interacting ankyrin-related
FT                   ADP-ribose polymerase, isoform CRA_a"
FT                   /note="gene_id=mCG22286.2 transcript_id=mCT193312.0
FT                   protein_id=mCP114290.0 isoform=CRA_a"
FT                   /protein_id="EDL35446.1"
FT                   /translation="GKMAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGP
FT                   TPASPTAGGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGAVCTVAAPAAVPAASA
FT                   AVGVAPTPAGGGGGGGNNSASSASSPTSSSSSSPSSPGSSLAESPEAAGVGSTATLGAG
FT                   AAGLGPGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFG
FT                   RKDVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPL
FT                   HEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARS
FT                   GNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLV
FT                   PLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTL
FT                   VNCHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSH
FT                   ETALHCAVASLHPKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHG
FT                   AKMNALDSLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILS
FT                   ESTPMRTSDVDYRLLEASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSV
FT                   VEYLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAA
FT                   AKGKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLA
FT                   RVQKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHN
FT                   AASYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQE
FT                   GQTPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPASTPSCLSAASSIDN
FT                   LTGPLTDLAVGGASNAGDGAAGAERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQIT
FT                   LDVLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLA
FT                   PEDKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSE
FT                   ENHNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGG
FT                   GTGCPTHKDRSCYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAY
FT                   AEYVIYRGEQAYPEYLITYQIMKPEAPSQTATAAEQKT"
FT   CDS             complement(join(1774979..1775065,1777791..1777947,
FT                   1781805..1781919,1782238..1782343,1783290..1783364,
FT                   1785087..1785184,1786238..1786358,1790632..1790714,
FT                   1791671..1791908,1792243..1792431,1794189..1794298,
FT                   1794705..1794924,1796205..1796370,1798925..1799070,
FT                   1800441..1800520,1804496..1804667,1810237..1810315,
FT                   1810650..1810741,1812276..1812397,1815822..1816008,
FT                   1816383..1816449,1818007..1818101,1832150..1832225,
FT                   1832981..1833017,1860751..1860846,1883027..1883251,
FT                   1907449..1908100))
FT                   /codon_start=1
FT                   /gene="Tnks"
FT                   /locus_tag="mCG_22286"
FT                   /product="tankyrase, TRF1-interacting ankyrin-related
FT                   ADP-ribose polymerase, isoform CRA_b"
FT                   /note="gene_id=mCG22286.2 transcript_id=mCT21113.2
FT                   protein_id=mCP23063.2 isoform=CRA_b"
FT                   /protein_id="EDL35447.1"
FT                   /translation="MAASRRSQHHHHHHQQQLQPAPGASAPPPPPPPPLSPGLAPGPTP
FT                   ASPTAGGLAPFASPRHGLALPEGDGSRDPPDRPRSPDPVDGAVCTVAAPAAVPAASAAV
FT                   GVAPTPAGGGGGGGNNSASSASSPTSSSSSSPSSPGSSLAESPEAAGVGSTATLGAGAA
FT                   GLGPGVPAVSGALRELLEACRNGDVSRVKRLVDAANVNAKDMAGRKSSPLHFAAGFGRK
FT                   DVVEHLLQMGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNYTPLHE
FT                   AAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAARSGN
FT                   EEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGLVPL
FT                   HNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTLVN
FT                   CHGKSAVDMAPTPELRERLTYEFKGHSLLQAAREADLAKVKKTLALEIINFKQPQSHET
FT                   ALHCAVASLHPKRKQVAELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAK
FT                   MNALDSLGQTALHRAALAGHLQTCRLLLSYGSDPSIISLQGFTAAQMGNEAVQQILSES
FT                   TPMRTSDVDYRLLEASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVE
FT                   YLLHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAK
FT                   GKYEICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARV
FT                   QKLCTPENINCRDTQGRNSTPLHLAAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAA
FT                   SYGHVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQ
FT                   TPLDLATADDIRALLIDAMPPEALPTCFKPQATVVSASLISPASTPSCLSAASSIDNLT
FT                   GPLTDLAVGGASNAGDGAAGAERKEGEVAGLDMNISQFLKSLGLEHLRDIFETEQITLD
FT                   VLADMGHEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVNQGTILLDLAPE
FT                   DKEYQSVEEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEEN
FT                   HNHHNERMLFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQQMLFCRVTL
FT                   GKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIMKPEA
FT                   PSQTATAAEQKT"
FT   assembly_gap    1791489..1791508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1795177..1795196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1825357..1825376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1826726..1826745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1874990..1875101
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    1916784..1916803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1926703..1926722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1933662..1933685
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    1955768..1955789
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    1957514..1957533
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1981744..1981763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1983180..1983199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1984239..1984258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1993468..1993976
FT                   /estimated_length=509
FT                   /gap_type="unknown"
FT   assembly_gap    1999734..1999986
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   gene            complement(2000146..2001468)
FT                   /pseudo
FT                   /locus_tag="mCG_50435"
FT                   /note="gene_id=mCG50435.2"
FT   mRNA            complement(2000146..2001468)
FT                   /pseudo
FT                   /locus_tag="mCG_50435"
FT                   /note="gene_id=mCG50435.2 transcript_id=mCT50618.2 created
FT                   on 07-AUG-2002"
FT   assembly_gap    2017416..2017554
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    2020270..2020289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2025484..2025503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2028074..2028631
FT                   /estimated_length=558
FT                   /gap_type="unknown"
FT   assembly_gap    2038259..2038278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2041443..2041462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2065327..2065521
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    2079353..2080526
FT                   /estimated_length=1174
FT                   /gap_type="unknown"
FT   assembly_gap    2082721..2082885
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    2096240..2096359
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    2097915..2102212
FT                   /estimated_length=4298
FT                   /gap_type="unknown"
FT   assembly_gap    2106861..2106880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2112743..2115665
FT                   /estimated_length=2923
FT                   /gap_type="unknown"
FT   assembly_gap    2117103..2117281
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    2142049..2142068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2143608..2144858
FT                   /estimated_length=1251
FT                   /gap_type="unknown"
FT   assembly_gap    2148858..2149872
FT                   /estimated_length=1015
FT                   /gap_type="unknown"
FT   assembly_gap    2150727..2151224
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   assembly_gap    2155780..2155799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2157068..2163381
FT                   /estimated_length=6314
FT                   /gap_type="unknown"
FT   assembly_gap    2171640..2171817
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    2182924..2182943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2195316..2195685
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   assembly_gap    2200511..2200530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2208860..2208879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2220524..2220682
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    2223303..2223449
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    2226191..2226210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2227858..2228094
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    2239039..2239058
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2242787..2243045
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    2251470..2251621
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    2267908..2268134
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    2290166..2290185
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2296482..2296705
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap    2301142..2301775
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   assembly_gap    2303958..2304188
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    2305359..2305670
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    2327544..2328194
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    2339581..2339636
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   gene            2340839..>2350229
FT                   /gene="Ppp1r3b"
FT                   /locus_tag="mCG_19219"
FT                   /note="gene_id=mCG19219.2"
FT   mRNA            join(2340839..2341070,2349350..>2350226)
FT                   /gene="Ppp1r3b"
FT                   /locus_tag="mCG_19219"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 3B, transcript variant mCT171801"
FT                   /note="gene_id=mCG19219.2 transcript_id=mCT171801.0 created
FT                   on 08-AUG-2002"
FT   mRNA            join(2340839..2340934,2349350..>2350226)
FT                   /gene="Ppp1r3b"
FT                   /locus_tag="mCG_19219"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 3B, transcript variant mCT171802"
FT                   /note="gene_id=mCG19219.2 transcript_id=mCT171802.0 created
FT                   on 08-AUG-2002"
FT   mRNA            join(2341782..2341880,2349350..>2350229)
FT                   /gene="Ppp1r3b"
FT                   /locus_tag="mCG_19219"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 3B, transcript variant mCT17961"
FT                   /note="gene_id=mCG19219.2 transcript_id=mCT17961.1 created
FT                   on 08-AUG-2002"
FT   assembly_gap    2344723..2345073
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    2348828..2348847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             2349375..2350229
FT                   /codon_start=1
FT                   /gene="Ppp1r3b"
FT                   /locus_tag="mCG_19219"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 3B, isoform CRA_b"
FT                   /note="gene_id=mCG19219.2 transcript_id=mCT17961.1
FT                   protein_id=mCP23067.2 isoform=CRA_b"
FT                   /protein_id="EDL35449.1"
FT                   /translation="MAVDIQYSYSSMAPSLRRERFTFKISPKLSKPLRPCIQLGSKDEA
FT                   SGMVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTA
FT                   ESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRM
FT                   TFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQAYWD
FT                   SNKGKNYRITRAELRSSPGKIEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLG
FT                   PYY"
FT   CDS             2349375..>2350226
FT                   /codon_start=1
FT                   /gene="Ppp1r3b"
FT                   /locus_tag="mCG_19219"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 3B, isoform CRA_a"
FT                   /note="gene_id=mCG19219.2 transcript_id=mCT171801.0
FT                   protein_id=mCP94720.0 isoform=CRA_a"
FT                   /protein_id="EDL35448.1"
FT                   /translation="MAVDIQYSYSSMAPSLRRERFTFKISPKLSKPLRPCIQLGSKDEA
FT                   SGMVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTA
FT                   ESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRM
FT                   TFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQAYWD
FT                   SNKGKNYRITRAELRSSPGKIEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLG
FT                   PYY"
FT   CDS             2349375..>2350226
FT                   /codon_start=1
FT                   /gene="Ppp1r3b"
FT                   /locus_tag="mCG_19219"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 3B, isoform CRA_a"
FT                   /note="gene_id=mCG19219.2 transcript_id=mCT171802.0
FT                   protein_id=mCP94721.0 isoform=CRA_a"
FT                   /protein_id="EDL35450.1"
FT                   /translation="MAVDIQYSYSSMAPSLRRERFTFKISPKLSKPLRPCIQLGSKDEA
FT                   SGMVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTA
FT                   ESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKDKAIAGTVKVQNLAFEKVVKIRM
FT                   TFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQAYWD
FT                   SNKGKNYRITRAELRSSPGKIEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLG
FT                   PYY"
FT   gene            2350388..2353445
FT                   /locus_tag="mCG_1042845"
FT                   /note="gene_id=mCG1042845.1"
FT   mRNA            2350388..2353445
FT                   /locus_tag="mCG_1042845"
FT                   /product="mCG1042845"
FT                   /note="gene_id=mCG1042845.1 transcript_id=mCT160549.1
FT                   created on 08-AUG-2002"
FT   CDS             2352213..2352515
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042845"
FT                   /product="mCG1042845"
FT                   /note="gene_id=mCG1042845.1 transcript_id=mCT160549.1
FT                   protein_id=mCP59957.1"
FT                   /protein_id="EDL35451.1"
FT                   /translation="MLYVPPKADIPSPPFAQICPSFLAHEHCLKAPQPAHLGCTPTAQL
FT                   QGHVVPLPAHQDPSLEAVLGLCLTSLSRLSLRDRRVFLLLSASNTALLLLTQSVP"
FT   assembly_gap    2358668..2358829
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    2367710..2367729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2371680..2371699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2374919..2374938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2395583..2396012
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    2402029..2402367
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    2409328..2409347
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2434007..2457068)
FT                   /gene="Thex1"
FT                   /locus_tag="mCG_19217"
FT                   /note="gene_id=mCG19217.1"
FT   mRNA            complement(join(2434007..2437051,2442045..2442159,
FT                   2444122..2444231,2446224..2446307,2450216..2450426,
FT                   2452718..2452896,2456805..2457068))
FT                   /gene="Thex1"
FT                   /locus_tag="mCG_19217"
FT                   /product="three prime histone mRNA exonuclease 1"
FT                   /note="gene_id=mCG19217.1 transcript_id=mCT17959.1 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(2436809..2437051,2442045..2442159,
FT                   2444122..2444231,2446224..2446307,2450216..2450426,
FT                   2452718..2452896,2456805..2456900))
FT                   /codon_start=1
FT                   /gene="Thex1"
FT                   /locus_tag="mCG_19217"
FT                   /product="three prime histone mRNA exonuclease 1"
FT                   /note="gene_id=mCG19217.1 transcript_id=mCT17959.1
FT                   protein_id=mCP23065.1"
FT                   /protein_id="EDL35452.1"
FT                   /translation="MEDERGRERGGDAAQQKTPRPECEESRPLSVEKKQRCRLDGKETD
FT                   GSKFISSNGSDFSDPVYKEIAMTNGCINRMSKEELRAKLSEFKLETRGVKDVLKKRLKN
FT                   YYKKQKLMLKESSAGDSYYDYICIIDFEATCEEGNPAEFLHEIIEFPVVLLNTHTLEIE
FT                   DTFQQYVRPEVNAQLSEFCIGLTGITQDQVDRADAFPQVLKKVIEWMKSKELGTKYKYC
FT                   ILTDGSWDMSKFLSIQCRLSRLKHPAFAKKWINIRKSYGNFYKVPRSQTKLTIMLEKLG
FT                   MDYDGRPHSGLDDSKNIARIAVRMLQDGCELRINEKILGGQLMSVSSSLPVEGAPAPQM
FT                   PHSRK"
FT   assembly_gap    2462747..2465897
FT                   /estimated_length=3151
FT                   /gap_type="unknown"
FT   assembly_gap    2503187..2503206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2505252..2505271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2507884..2512588
FT                   /estimated_length=4705
FT                   /gap_type="unknown"
FT   assembly_gap    2514718..2515628
FT                   /estimated_length=911
FT                   /gap_type="unknown"
FT   assembly_gap    2548445..2548667
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   gene            complement(2555508..2561891)
FT                   /locus_tag="mCG_1051092"
FT                   /note="gene_id=mCG1051092.0"
FT   mRNA            complement(join(2555508..2556695,2557260..2557544,
FT                   2561755..2561891))
FT                   /locus_tag="mCG_1051092"
FT                   /product="mCG1051092"
FT                   /note="gene_id=mCG1051092.0 transcript_id=mCT194881.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(2555655..2555852)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051092"
FT                   /product="mCG1051092"
FT                   /note="gene_id=mCG1051092.0 transcript_id=mCT194881.0
FT                   protein_id=mCP115910.0"
FT                   /protein_id="EDL35453.1"
FT                   /translation="MLRQLVPELEDLWKVHVTSLGSLGILSQRVVRPGTEENWHWLQGT
FT                   LYWALIDTFKECHAGQAQTS"
FT   assembly_gap    2558930..2558994
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            <2561290..2648695
FT                   /locus_tag="mCG_19212"
FT                   /note="gene_id=mCG19212.2"
FT   mRNA            join(<2561290..2564275,2635996..2636122,2648049..2648695)
FT                   /locus_tag="mCG_19212"
FT                   /product="mCG19212, transcript variant mCT17954"
FT                   /note="gene_id=mCG19212.2 transcript_id=mCT17954.2 created
FT                   on 08-AUG-2002"
FT   CDS             join(2561290..2564275,2635996..2636122,2648049..2648082)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19212"
FT                   /product="mCG19212, isoform CRA_a"
FT                   /note="gene_id=mCG19212.2 transcript_id=mCT17954.2
FT                   protein_id=mCP23068.1 isoform=CRA_a"
FT                   /protein_id="EDL35454.1"
FT                   /translation="MAGQDSGNLKTVRLWRDAALRARKLRSNLRQLTLSCPGAGGDPLE
FT                   SPDAPQLVLPANIGDIEVLNLGNNGLEDVPEGLGSALGSLRVLVLRRNRFARLPPAVAE
FT                   LGHHLTELDVSHNRLTILGAEVVSALRELRKLNLSHNQLPALPAQLGALAHLEELDVSF
FT                   NRLAHLPDSFSCLNHLRTLDVDHNQLTAFPQQLLQLAALEELDVSSNRLRGLPEDISAL
FT                   RALKILWLSGAELGTLPRGFCELASLESLMLDNNGLQALPDEFSRLQRLKMLNLSSNLF
FT                   EEFPAALLPLAGLEELYLSRNQLTSVPSLIAGLGRLLTLWLDNNRIRYLPDSIVELTGL
FT                   EELVLQGNQIAVLPDNFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQ
FT                   PAVQPRLKLLLMGHKAAGKTLLRHCLTEDKVEGGQGGGDKEKSYLPFPPLGSKGIEVTS
FT                   WTADASRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLATYEPRCFPTTVGSFLH
FT                   RVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIALQEKNDAEGLSHLAKVVDEAL
FT                   ARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPLQLQRLR
FT                   DKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTED
FT                   RLQSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDILNVFFQRDASLLLHKLLLGTN
FT                   GEGEGEGESFPTIAVPSPGQDPLRATQLHHYVEGFLLHGLLPAHIIRLLLKPHVQAQQD
FT                   LQLLLELLEKMGLCYCLNKPKGKPLNGSAAWYKFPCYVQNEVPHAEAWINGTNLAGQSF
FT                   VAEQLQIEYSFPFTFPPGLFARYSVQINSHVVHRSDGKFQIFAYRGKVPVVVSYRPAKG
FT                   VLQPDTLSIASHASLPNIWTAWQAITPLVEELNVLLQEWPGLHYTVHILCSKCLKRGSP
FT                   NPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKKNVGEKHRNQ
FT                   "
FT   mRNA            join(<2561290..2564275,2635996..2636122,2643082..2643145)
FT                   /locus_tag="mCG_19212"
FT                   /product="mCG19212, transcript variant mCT171709"
FT                   /note="gene_id=mCG19212.2 transcript_id=mCT171709.0 created
FT                   on 08-AUG-2002"
FT   CDS             join(2561290..2564275,2635996..2636122,2643082..2643109)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19212"
FT                   /product="mCG19212, isoform CRA_b"
FT                   /note="gene_id=mCG19212.2 transcript_id=mCT171709.0
FT                   protein_id=mCP94628.0 isoform=CRA_b"
FT                   /protein_id="EDL35455.1"
FT                   /translation="MAGQDSGNLKTVRLWRDAALRARKLRSNLRQLTLSCPGAGGDPLE
FT                   SPDAPQLVLPANIGDIEVLNLGNNGLEDVPEGLGSALGSLRVLVLRRNRFARLPPAVAE
FT                   LGHHLTELDVSHNRLTILGAEVVSALRELRKLNLSHNQLPALPAQLGALAHLEELDVSF
FT                   NRLAHLPDSFSCLNHLRTLDVDHNQLTAFPQQLLQLAALEELDVSSNRLRGLPEDISAL
FT                   RALKILWLSGAELGTLPRGFCELASLESLMLDNNGLQALPDEFSRLQRLKMLNLSSNLF
FT                   EEFPAALLPLAGLEELYLSRNQLTSVPSLIAGLGRLLTLWLDNNRIRYLPDSIVELTGL
FT                   EELVLQGNQIAVLPDNFGQLSRVGLWKIKDNPLIQPPYEVCMKGIPYIAAYQKELAHSQ
FT                   PAVQPRLKLLLMGHKAAGKTLLRHCLTEDKVEGGQGGGDKEKSYLPFPPLGSKGIEVTS
FT                   WTADASRGLRFIVYDLAGDESYEVIQPFFLSPGALYVLVVNLATYEPRCFPTTVGSFLH
FT                   RVGARVPHAVVCIVGTHADLCGERELEEKCLDIHRQIALQEKNDAEGLSHLAKVVDEAL
FT                   ARDFELRSASPHAAYYGVSDKNLRRRKAHFQYLLNHRLQILSPVLPVSCRDPLQLQRLR
FT                   DKLLSVAEHREIFPNLHRVLPRSWQVLEELHFQPPQAQRLWLSWWDSARLGLQAGLTED
FT                   RLQSALSYLHESGKLLYFEDSPALKEHVFHNLTRLIDILNVFFQRDASLLLHKLLLGTN
FT                   GEGEGEGESFPTIAVPSPGQDPLRATQLHHYVEGFLLHGLLPAHIIRLLLKPHVQAQQD
FT                   LQLLLELLEKMGLCYCLNKPKGKPLNGSAAWYKFPCYVQNEVPHAEAWINGTNLAGQSF
FT                   VAEQLQIEYSFPFTFPPGLFARYSVQINSHVVHRSDGKFQIFAYRGKVPVVVSYRPAKG
FT                   VLQPDTLSIASHASLPNIWTAWQAITPLVEELNVLLQEWPGLHYTVHILCSKCLKRGSP
FT                   NPHAFPGELLSQPRPEGVAEIICPKNGSERVNVALVYPPTPTVISPCSKYLHTFLEN"
FT   assembly_gap    2566364..2566383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2570635..2570738
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    2591740..2592272
FT                   /estimated_length=533
FT                   /gap_type="unknown"
FT   gene            complement(2593995..2596767)
FT                   /locus_tag="mCG_148206"
FT                   /note="gene_id=mCG148206.0"
FT   mRNA            complement(join(2593995..2595323,2595334..2596767))
FT                   /locus_tag="mCG_148206"
FT                   /product="mCG148206"
FT                   /note="gene_id=mCG148206.0 transcript_id=mCT188469.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2595775..2596017)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148206"
FT                   /product="mCG148206"
FT                   /note="gene_id=mCG148206.0 transcript_id=mCT188469.0
FT                   protein_id=mCP108785.0"
FT                   /protein_id="EDL35456.1"
FT                   /translation="MKVRTVDNATKTFLPSTFQSLPQCVGGSLTVEWGRGADYIEDRGP
FT                   DYSQQQLLPESDLSLMSPPAPFTSIKNEVTIIHSC"
FT   assembly_gap    2604935..2604954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2648868..2650755
FT                   /locus_tag="mCG_1042804"
FT                   /note="gene_id=mCG1042804.1"
FT   mRNA            2648868..2650755
FT                   /locus_tag="mCG_1042804"
FT                   /product="mCG1042804"
FT                   /note="gene_id=mCG1042804.1 transcript_id=mCT160508.1
FT                   created on 08-AUG-2002"
FT   CDS             2650582..2650737
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042804"
FT                   /product="mCG1042804"
FT                   /note="gene_id=mCG1042804.1 transcript_id=mCT160508.1
FT                   protein_id=mCP59810.1"
FT                   /protein_id="EDL35457.1"
FT                   /translation="MNKEEGLVGIPVECVFFMLQSVNCNCGFPVHCPNGAEVKKQNKNK
FT                   TKQKKQ"
FT   assembly_gap    2651879..2651898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2666523..2666542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2679778..2679797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2682215..2682873
FT                   /estimated_length=659
FT                   /gap_type="unknown"
FT   assembly_gap    2687700..2687719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2690956..2701716
FT                   /locus_tag="mCG_1042847"
FT                   /note="gene_id=mCG1042847.1"
FT   mRNA            join(2690956..2691122,2691233..2691344,2692096..2692181,
FT                   2697682..2697832,2700871..2701716)
FT                   /locus_tag="mCG_1042847"
FT                   /product="mCG1042847, transcript variant mCT171702"
FT                   /note="gene_id=mCG1042847.1 transcript_id=mCT171702.0
FT                   created on 08-AUG-2002"
FT   mRNA            join(2690956..2691122,2691216..2691344,2692096..2692181,
FT                   2692954..2693164)
FT                   /locus_tag="mCG_1042847"
FT                   /product="mCG1042847, transcript variant mCT160551"
FT                   /note="gene_id=mCG1042847.1 transcript_id=mCT160551.1
FT                   created on 08-AUG-2002"
FT   CDS             join(2691083..2691122,2691216..2691283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042847"
FT                   /product="mCG1042847, isoform CRA_b"
FT                   /note="gene_id=mCG1042847.1 transcript_id=mCT160551.1
FT                   protein_id=mCP59964.1 isoform=CRA_b"
FT                   /protein_id="EDL35459.1"
FT                   /translation="MQRHPDATSMKPAGYVCHQLWEARDSSFTLTVARG"
FT   CDS             join(2691083..2691122,2691233..2691249)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042847"
FT                   /product="mCG1042847, isoform CRA_a"
FT                   /note="gene_id=mCG1042847.1 transcript_id=mCT171702.0
FT                   protein_id=mCP94621.0 isoform=CRA_a"
FT                   /protein_id="EDL35458.1"
FT                   /translation="MQRHPDATSMKPAAMGST"
FT   assembly_gap    2694693..2694799
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    2701875..2701894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2721914..2722045
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   gene            <2738382..2782733
FT                   /locus_tag="mCG_140833"
FT                   /note="gene_id=mCG140833.0"
FT   mRNA            join(<2738382..2738499,2739073..2739312,2740133..2740246,
FT                   2761316..2761477,2761995..2762210,2764701..2764924,
FT                   2767586..2767715,2767933..2768117,2768836..2769022,
FT                   2770488..2770671,2772140..2772341,2772429..2772593,
FT                   2773083..2773127,2780019..2780255,2780613..2781090,
FT                   2782634..2782733)
FT                   /locus_tag="mCG_140833"
FT                   /product="mCG140833"
FT                   /note="gene_id=mCG140833.0 transcript_id=mCT171703.0
FT                   created on 08-AUG-2002"
FT   CDS             join(<2738382..2738499,2739073..2739312,2740133..2740246,
FT                   2761316..2761477,2761995..2762210,2764701..2764924,
FT                   2767586..2767715,2767933..2768117,2768836..2769022,
FT                   2770488..2770671,2772140..2772341,2772429..2772593,
FT                   2773083..2773127,2780019..2780255,2780613..2780618)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140833"
FT                   /product="mCG140833"
FT                   /note="gene_id=mCG140833.0 transcript_id=mCT171703.0
FT                   protein_id=mCP94622.0"
FT                   /protein_id="EDL35460.1"
FT                   /translation="QTCLGHLQAWQCDNGRCIPASWLCDGASDCLDGSDEVNCESLTAC
FT                   PDYKIRCPGKAQCLDAGEPCDAQQSCEDGSIKAHCPHIRCLAGQWQCQNRACIMDSWRC
FT                   DGIDHCGDASDERDCASCPEGTVSCDSGKCIPESLMCDGRADCTDGADEPRTCVPTTPS
FT                   LPPVLCARSSVPCQDGKGCIPRESLCNGEADCQDGSDEKNCFQICHQPGVFQCLDGSRC
FT                   IEERYHCDGAQHCSDGSDELDCWRPADDCSMRCDNKTRCIPKSWRCDGKPDCLDRRDEQ
FT                   GCSPLNFNVRMANAYLLLCVVMGTETAWTIQMRKAALSPGSLQCPEGEMKCPKSGECVL
FT                   AEWICDHDVDCKDGTDEKDCGLKVISCGPRQWACDSGDQCVPDFWHCDGQRDCRDGSDE
FT                   AGCAPQKCQDSEFQCATGACLSFSMVCDGREDCVDGSDEGGECSSSVCSPGLCYHSCYQ
FT                   SPTGPVCVCAPGFELESNGQICQDVNECQQPSGQPCSQTCINTEGSYICACHPGYLLGP
FT                   DGHTCKATGIKPDCIGVDWIGRNLYWTDGRAGQILAIQLTAMGRGKSEYTVVLDDDLIR
FT                   PQSLALDPLNGLMYWSETGEEPRIEQAGMDGSSRKILVNQGLGHPTSIALDQLSWKIFW
FT                   SDEKFHCIGSVNLDGSGISMMQLTQIKSPFSVAVFEDKVFWSDLQTRTIQHAEKMTGKD
FT                   RAVLIKRSGQPFGLKESGFVFLVLPTVLTQVTTAAQETMEDAVISVYRIPRARLAGVPM
FT                   GTAWLMATHAWKLSSALQCHNAVRMVRGAFPRSKFVMVTLTVWMVLMKWTV"
FT   assembly_gap    2763430..2763449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2765624..2766736
FT                   /estimated_length=1113
FT                   /gap_type="unknown"
FT   assembly_gap    2767746..2767774
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            complement(2790089..2791908)
FT                   /gene="Cldn23"
FT                   /locus_tag="mCG_51614"
FT                   /note="gene_id=mCG51614.1"
FT   mRNA            complement(2790089..2791908)
FT                   /gene="Cldn23"
FT                   /locus_tag="mCG_51614"
FT                   /product="claudin 23"
FT                   /note="gene_id=mCG51614.1 transcript_id=mCT51797.1 created
FT                   on 08-AUG-2002"
FT   CDS             complement(2790806..2791696)
FT                   /codon_start=1
FT                   /gene="Cldn23"
FT                   /locus_tag="mCG_51614"
FT                   /product="claudin 23"
FT                   /note="gene_id=mCG51614.1 transcript_id=mCT51797.1
FT                   protein_id=mCP42772.1"
FT                   /protein_id="EDL35461.1"
FT                   /translation="MRTPVVMTLGMVLTPCGLLLNLVSTLAPGWRLVKGFLDQPVDVVL
FT                   YQGLWDICREQSSRERECGQPDEWNYFQTQPVQVARGLMITSLATTALGLLLASLGVRC
FT                   WQDEPHYGLAGLSGVVFFVAGLFSLIPVSWYNHFLSDPDVLAAPSSPVTVQVSYSLVLG
FT                   YLGSCLLLLGGFSLALSFAPWCEERCRRCRKAPPAGPRRSSISTVYVDWPEPALTPAIK
FT                   YYSDGQHRPPPTAEHRDTSKLKVGFPMPRPPPKSYTNPMDVLEGEEKKTATSQGGSSSR
FT                   STRPCQNSLPCDSDL"
FT   assembly_gap    2793778..2794018
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    2799779..2799798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2803479..2803539
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    2812027..2812046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2831439..2850352)
FT                   /locus_tag="mCG_148208"
FT                   /note="gene_id=mCG148208.0"
FT   mRNA            complement(join(2831439..2833663,2838551..2838777,
FT                   2850247..2850352))
FT                   /locus_tag="mCG_148208"
FT                   /product="mCG148208"
FT                   /note="gene_id=mCG148208.0 transcript_id=mCT188471.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2832409..2832681)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148208"
FT                   /product="mCG148208"
FT                   /note="gene_id=mCG148208.0 transcript_id=mCT188471.0
FT                   protein_id=mCP108787.0"
FT                   /protein_id="EDL35462.1"
FT                   /translation="MCEMNSLSEKKVYYYIAASQKTNQVFYSFVSPGKGTLAVPGPFVR
FT                   MTGSRVVWIPTDSGYTEVTSPSNCQNYHLYLGLITALSSLLLSVN"
FT   assembly_gap    2835330..2835354
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    2863808..2864086
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    2889028..2894355
FT                   /estimated_length=5328
FT                   /gap_type="unknown"
FT   assembly_gap    2896020..2896943
FT                   /estimated_length=924
FT                   /gap_type="unknown"
FT   assembly_gap    2929801..2930173
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    2937991..2938010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2944282..2944918
FT                   /estimated_length=637
FT                   /gap_type="unknown"
FT   assembly_gap    2983690..2983771
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            2988966..2989471
FT                   /pseudo
FT                   /locus_tag="mCG_19218"
FT                   /note="gene_id=mCG19218.2"
FT   mRNA            2988966..2989471
FT                   /pseudo
FT                   /locus_tag="mCG_19218"
FT                   /note="gene_id=mCG19218.2 transcript_id=mCT17960.2 created
FT                   on 17-JUL-2002"
FT   assembly_gap    3022903..3022922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3030729..3030798
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            3058173..3115106
FT                   /gene="D8Ertd82e"
FT                   /locus_tag="mCG_122356"
FT                   /note="gene_id=mCG122356.2"
FT   mRNA            join(3058173..3058302,3062890..3063307,3065876..3067674,
FT                   3092517..3092674,3106635..3107395,3113620..3115106)
FT                   /gene="D8Ertd82e"
FT                   /locus_tag="mCG_122356"
FT                   /product="DNA segment, Chr 8, ERATO Doi 82, expressed,
FT                   transcript variant mCT123573"
FT                   /note="gene_id=mCG122356.2 transcript_id=mCT123573.2
FT                   created on 17-JUN-2003"
FT   mRNA            join(3058173..3058302,3062890..3063307,3065876..3069930)
FT                   /gene="D8Ertd82e"
FT                   /locus_tag="mCG_122356"
FT                   /product="DNA segment, Chr 8, ERATO Doi 82, expressed,
FT                   transcript variant mCT123575"
FT                   /note="gene_id=mCG122356.2 transcript_id=mCT123575.2
FT                   created on 17-JUN-2003"
FT   CDS             join(3063017..3063307,3065876..3067674,3092517..3092674,
FT                   3106635..3107395,3113620..3114735)
FT                   /codon_start=1
FT                   /gene="D8Ertd82e"
FT                   /locus_tag="mCG_122356"
FT                   /product="DNA segment, Chr 8, ERATO Doi 82, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG122356.2 transcript_id=mCT123573.2
FT                   protein_id=mCP59782.2 isoform=CRA_a"
FT                   /protein_id="EDL35463.1"
FT                   /translation="MSACSDFVEHIWKPGSCKNCFCLRSDHQPTAGHPKARANSLPAGT
FT                   RLPARPENCRLDDEGVNGLAYSKPTIAVKPTMMTSETSDLWTEASLSAEVPKVNWRRTP
FT                   GKLLLPKQEDEPIVYLGSFRGLQKPASPLACTDGNSRCPPAYTMVGLHNLEARVDRNTA
FT                   FQPVSFQEEKAGREELPSAHESFRQKLAAFAGMTSSCPKGPRPCTSPQPLRESLPSEDD
FT                   SDQRCSPSGDSEGGEYCSILYCCPESKDAVHSTEGSGRCGGDCSPTCREQGPRTRPTEE
FT                   EKQGLSFPRECCGQGSTANPPRLGPKKPSLNSEAASSSDGLSCGSSRSGASSPFAPHLE
FT                   NDYCSLVKEPASGKQQDLSGHFLTSGKCVGQAAELQPASLLRDPVQPEPIYAESAKRKK
FT                   AAPGPPRPEPKKEQVPAGHSQGQVWTGDTWIQKTPPSWSQDREGANPAPQVATTITVIA
FT                   AHPEEDHRTIYLSSPDSAVGVQWPRGPSNQDLQASEEEPLVAQGLISRESHPHNMTENT
FT                   AKEKPAIPPKLSKSSPGGSPVSPAAPPLTDHSDGNTGGSSVGPQLLSRVPANLTSSCHT
FT                   NGVATAGDSAKCPPPATSSSVLDQRRPRYQTGAWSRQCRIEEEEEVGQELSQSWGRELE
FT                   NGTADHSNSSTWHRLHPIDGTSGQNSKTNSGMSKSASFAFEFPKDRGRLEAFSPPPPPP
FT                   KSRHLLKMNKSSSDLEKVSQSSAESLSPSFRGAHVSFTTGSTDSLASDSRPCSDGGPSY
FT                   EPTHSPTISGKKLFAPVPFPSGSTEDVSPGGGPVQPPPLPQKKIVSRAASSPDGFFWTQ
FT                   GSPKPRTASPKLNLSHSETNVCAHDEPPFNCSLNSGNRSHHVFSSSEPLGKAFKGNAPW
FT                   APALGLANSKGGCGSPSLQCRAATSTSSSQLSVSSQASSSSTQLQLHSLLSSISSKEGT
FT                   YAKLGGLYTQSLARLVTKCEDLFMGGQKKELRFNENYWSLFKLTCNKPCCDSGDAIYYC
FT                   ATCSEDPGSIYAVKICKTPEPKSASYCSPSVPVHFNIQQDCGHFVASVPSSMLASPDTS
FT                   SKDTAPAVSPQPPAQEQDCVVVITREVPHQTASDFVRDSMASHRAEPEVYERRVCFLLL
FT                   QLCNGLEHLKEHGIIHRDLCLENLLLAHCNPQISPGPSATPTVPTTTSRCPSAVPAATT
FT                   ACQGGPGEKQLPRLIISNFLKAKQKPGGTTNLQQKKSQARLAPEIVSASQYRKFDEFQT
FT                   GILIYELLHQPNPFEVRAQLRERDYRREDLPPLPTLSLYSPGLQQLAHLLLEADPIKRI
FT                   RIGEAKRVLQCLLWGPRRELVEQPCTSEEVLCNTLHNWIDMKRALMMMKFAEKAVDRRR
FT                   GVELEDWLCCQYLASAEPGALLQSLKLLQLL"
FT   CDS             join(3063017..3063307,3065876..3067678)
FT                   /codon_start=1
FT                   /gene="D8Ertd82e"
FT                   /locus_tag="mCG_122356"
FT                   /product="DNA segment, Chr 8, ERATO Doi 82, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG122356.2 transcript_id=mCT123575.2
FT                   protein_id=mCP59785.2 isoform=CRA_b"
FT                   /protein_id="EDL35464.1"
FT                   /translation="MSACSDFVEHIWKPGSCKNCFCLRSDHQPTAGHPKARANSLPAGT
FT                   RLPARPENCRLDDEGVNGLAYSKPTIAVKPTMMTSETSDLWTEASLSAEVPKVNWRRTP
FT                   GKLLLPKQEDEPIVYLGSFRGLQKPASPLACTDGNSRCPPAYTMVGLHNLEARVDRNTA
FT                   FQPVSFQEEKAGREELPSAHESFRQKLAAFAGMTSSCPKGPRPCTSPQPLRESLPSEDD
FT                   SDQRCSPSGDSEGGEYCSILYCCPESKDAVHSTEGSGRCGGDCSPTCREQGPRTRPTEE
FT                   EKQGLSFPRECCGQGSTANPPRLGPKKPSLNSEAASSSDGLSCGSSRSGASSPFAPHLE
FT                   NDYCSLVKEPASGKQQDLSGHFLTSGKCVGQAAELQPASLLRDPVQPEPIYAESAKRKK
FT                   AAPGPPRPEPKKEQVPAGHSQGQVWTGDTWIQKTPPSWSQDREGANPAPQVATTITVIA
FT                   AHPEEDHRTIYLSSPDSAVGVQWPRGPSNQDLQASEEEPLVAQGLISRESHPHNMTENT
FT                   AKEKPAIPPKLSKSSPGGSPVSPAAPPLTDHSDGNTGGSSVGPQLLSRVPANLTSSCHT
FT                   NGVATAGDSAKCPPPATSSSVLDQRRPRYQTGAWSRQCRIEEEEEVGQELSQSWGRELE
FT                   NGTADHSNSSTWHRLHPIDGTSGQNSKTNSGMSKSASFAFEFPKDRGRLEAFSPPPPPP
FT                   KSR"
FT   assembly_gap    3081132..3081348
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    3097873..3097892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3099117..3100684
FT                   /estimated_length=1568
FT                   /gap_type="unknown"
FT   assembly_gap    3104465..3104484
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3123301..3128349
FT                   /locus_tag="mCG_148205"
FT                   /note="gene_id=mCG148205.0"
FT   mRNA            join(3123301..3123502,3123618..3123699,3127058..3127161,
FT                   3127246..3128349)
FT                   /locus_tag="mCG_148205"
FT                   /product="mCG148205"
FT                   /note="gene_id=mCG148205.0 transcript_id=mCT188468.0
FT                   created on 13-JAN-2004"
FT   CDS             3127869..3128033
FT                   /codon_start=1
FT                   /locus_tag="mCG_148205"
FT                   /product="mCG148205"
FT                   /note="gene_id=mCG148205.0 transcript_id=mCT188468.0
FT                   protein_id=mCP108784.0"
FT                   /protein_id="EDL35465.1"
FT                   /translation="MERTNKQTTNKKSSFVFVCSPSTPEHGVGVPLNVPYISSETPLKK
FT                   MNCCRSLLG"
FT   gene            3143446..3145725
FT                   /locus_tag="mCG_1042848"
FT                   /note="gene_id=mCG1042848.0"
FT   mRNA            join(3143446..3144310,3145035..3145725)
FT                   /locus_tag="mCG_1042848"
FT                   /product="mCG1042848"
FT                   /note="gene_id=mCG1042848.0 transcript_id=mCT160552.0
FT                   created on 08-AUG-2002"
FT   CDS             3143976..3144164
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042848"
FT                   /product="mCG1042848"
FT                   /note="gene_id=mCG1042848.0 transcript_id=mCT160552.0
FT                   protein_id=mCP59969.1"
FT                   /protein_id="EDL35466.1"
FT                   /translation="MGNKLIFRIPCKSLSVKYINQFYVYFFLKQIGRLGSEVTLFAIVC
FT                   SIQDSVLLCLVRSEHSR"
FT   assembly_gap    3151010..3151463
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   assembly_gap    3155838..3155857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3175332..3175880
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   gene            complement(<3184683..>3215629)
FT                   /locus_tag="mCG_122352"
FT                   /note="gene_id=mCG122352.1"
FT   mRNA            complement(join(<3184683..3184841,3187078..3187230,
FT                   3189868..3190030,3190116..3190274,3192703..3192824,
FT                   3196243..3196357,3197189..3197285,3197391..3197631,
FT                   3198147..3198296,3201005..3201127,3203088..3203206,
FT                   3215293..>3215629))
FT                   /locus_tag="mCG_122352"
FT                   /product="mCG122352"
FT                   /note="gene_id=mCG122352.1 transcript_id=mCT123570.1
FT                   created on 09-AUG-2002"
FT   CDS             complement(join(3184683..3184841,3187078..3187230,
FT                   3189868..3190030,3190116..3190274,3192703..3192824,
FT                   3196243..3196357,3197189..3197285,3197391..3197631,
FT                   3198147..3198296,3201005..3201127,3203088..3203206,
FT                   3215293..>3215629))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122352"
FT                   /product="mCG122352"
FT                   /note="gene_id=mCG122352.1 transcript_id=mCT123570.1
FT                   protein_id=mCP59776.1"
FT                   /protein_id="EDL35467.1"
FT                   /translation="CLSCRGFLSEPVTVPCGHSYCRRCLRRELRARCRLCRDRLPPAAA
FT                   ASEGTPRPPPLAAAIADFRTSVVLNHLAEKWFPGQRERARAAGRLGELLHEGRYREALA
FT                   AACDALRAEPSDLTLKIYRAESYAGLQEFKAALEDLNAVLFQLPNWPEVYFRKGKVLQD
FT                   AGFLGDALQLFLQCLALDEDFAPAKLQVEKILCDLLSPENVREGLKESSWSSLPCIKSK
FT                   PLGFPSVMEQPPSPAELGLKQTEERVEDAPEPVKGSLSRAQSAQAISAAAVPAREDGLK
FT                   RVCSEPLLSAQGKGVLLKRKLSLLEQDVLINEDGRSKLKKQSESPSEDCMFSIAYGDIP
FT                   EELIDVSDFECSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADR
FT                   RYCVTQLLEELIVKYLPDELSERKKIYDEETAELSHLTKNVPIFVCTMAYPTVPCPLHV
FT                   FEPRYRLMIRRSIQTGTKQFGMCVSDTQNSFADYGCMLQIRNVHFLPDGRSVVDTVGGK
FT                   RFRVLKRGMKDGYCTADIEYLEDVKIENGDEIRSLRELHDSVYSQACSWFQNLRDRFRS
FT                   QILQHFGSMPEREENLQATPNGPAWCWWLLAVLPVDPRYQLSVLSMKSLEERLTKIQHI
FT                   LTYFSRDQSK"
FT   assembly_gap    3207901..3207920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3215732..3215866
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    3236469..3236488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3238327..3238501
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    3245965..3245984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3268922..3269001
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    3280914..3280984
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            <3283141..3285090
FT                   /locus_tag="mCG_49108"
FT                   /note="gene_id=mCG49108.1"
FT   mRNA            <3283141..3285090
FT                   /locus_tag="mCG_49108"
FT                   /product="mCG49108"
FT                   /note="gene_id=mCG49108.1 transcript_id=mCT49291.1 created
FT                   on 09-AUG-2002"
FT   CDS             3283141..3284928
FT                   /codon_start=1
FT                   /locus_tag="mCG_49108"
FT                   /product="mCG49108"
FT                   /note="gene_id=mCG49108.1 transcript_id=mCT49291.1
FT                   protein_id=mCP42778.0"
FT                   /protein_id="EDL35468.1"
FT                   /translation="MATLQESEVKVDGEQKLSKNELKRRLKAEKKLAEKEAKQKELSEK
FT                   QLNQTASAPNHTADNGVGAEEETLDPNQYYKIRSQAVQQLKVTGEDPYPHKFHVDISLT
FT                   QFIQEYSHLQPGDHLTDVTLKVAGRIQAKRASGGKLIFYDLRGEGVKLQVMANSRNYKS
FT                   EEEFVHINNKLRRGDIIGVEGNPGKTKKGELSIIPQEITLLSPCLHMLPHLHFGLKDKE
FT                   TRYRQRYLDLILNDFVRQKLIVRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPF
FT                   ITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYM
FT                   AYADYHDLMEITEKMLSGMVKSITGSYKITYHPDGPEGQAYEVDFTPPFRRISMVEELE
FT                   KALGVKLPETSLFETEETRKILDDICVAKAVECPPPLTTARLLDKLVGEFLEVTCISPT
FT                   FICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPVRQRQLFEEQAKAK
FT                   AAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRLTMFLTDSNNIKEVLLFPAMKPEDK
FT                   KETAATTETPESTEASPSV"
FT   assembly_gap    3285580..3285621
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    3292658..3293130
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    3294853..3295573
FT                   /estimated_length=721
FT                   /gap_type="unknown"
FT   assembly_gap    3313380..3313399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3315516..3315535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3329260..3330374)
FT                   /pseudo
FT                   /locus_tag="mCG_13845"
FT                   /note="gene_id=mCG13845.2"
FT   mRNA            complement(3329260..3330374)
FT                   /pseudo
FT                   /locus_tag="mCG_13845"
FT                   /note="gene_id=mCG13845.2 transcript_id=mCT17853.2 created
FT                   on 17-JUL-2002"
FT   assembly_gap    3334361..3334641
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    3338534..3338553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3339664..3353928
FT                   /estimated_length=14265
FT                   /gap_type="unknown"
FT   assembly_gap    3355865..3356021
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    3356883..3356931
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3377793..3378012
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   assembly_gap    3405898..3405917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3411298..3469505
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /note="gene_id=mCG13848.2"
FT   mRNA            join(3411298..3411627,3411933..3412158,3445241..3445442,
FT                   3454664..3454818,3461644..3461817,3468071..3469505)
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, transcript variant
FT                   mCT17856"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT17856.2 created
FT                   on 13-FEB-2003"
FT   mRNA            join(3411298..3411389,3411933..3412158,3445241..3445442,
FT                   3454664..3454818,3461644..3461817,3468071..3469505)
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, transcript variant
FT                   mCT171705"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT171705.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(3411298..3411627,3411925..3412158,3445241..3445442,
FT                   3454664..3454818,3461644..3461817,3464285..3464372,
FT                   3468071..3469454)
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, transcript variant
FT                   mCT180421"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT180421.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(<3411323..3411389,3411933..3412158,3445241..3445442,
FT                   3454664..3454818,3461644..>3461817)
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, transcript variant
FT                   mCT193321"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT193321.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    3411632..3411731
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   mRNA            join(3411933..3412158,3445241..3445442,3454664..3454818,
FT                   3461644..3461817,3466688..3466824,3468071..3469505)
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, transcript variant
FT                   mCT171707"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT171707.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(3411933..3412158,3445241..3445442,3454664..3454818,
FT                   3461644..3461817,3468071..3468235,3468893..3469505)
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, transcript variant
FT                   mCT171706"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT171706.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(3411933..3412158,3445241..3445442,3454664..3454818,
FT                   3461644..3461753,3468071..3469454)
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, transcript variant
FT                   mCT180420"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT180420.0 created
FT                   on 13-FEB-2003"
FT   assembly_gap    3420551..3420570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3421675..3421694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<3445438..3445442,3454664..3454818,3461644..>3461817)
FT                   /codon_start=1
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, isoform CRA_f"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT193321.0
FT                   protein_id=mCP114285.0 isoform=CRA_f"
FT                   /protein_id="EDL35475.1"
FT                   /translation="VRMDPEAVELERRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQK
FT                   PGSLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGF
FT                   DAIISIG"
FT   assembly_gap    3448418..3448714
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    3449840..3449912
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   CDS             join(3454665..3454818,3461644..3461817,3468071..3469086)
FT                   /codon_start=1
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, isoform CRA_a"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT171705.0
FT                   protein_id=mCP94625.0 isoform=CRA_a"
FT                   /protein_id="EDL35469.1"
FT                   /translation="MDPEAVELERRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPG
FT                   SLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGFDA
FT                   IISIGVIHHFSTKERRIRAIKEMARVLAPGGQLMIYVWAMEQKNRRFEKQDVLVPWNRA
FT                   LCSRLLSESHQSWGHHCEHPTSRGFQGPGSVCGCAVCFKGRCDSKRSHSMDYGSAVART
FT                   CCEAISKEGERENGLYSNFGKSFRSWFFSRSLDESTLRKQIERVRPMKIPEGWANSTVS
FT                   QQPSRHPSLDLHAPEPFSTKGPNLDEVFVDTSSQRHLGWLRTPGTSDNFSGHKGGESRR
FT                   KEGGNFLDITDTGDSVAASNSSDPSARKILRRVSAFDSNDSNSEDSSFLEAQRDATDSK
FT                   AFMRYYHVFREGELSSLLQESVSELQVLSSGNDHGNWCIIAEKKRSWD"
FT   CDS             join(3454665..3454818,3461644..3461817,3468071..3469086)
FT                   /codon_start=1
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, isoform CRA_a"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT17856.2
FT                   protein_id=mCP23048.2 isoform=CRA_a"
FT                   /protein_id="EDL35472.1"
FT                   /translation="MDPEAVELERRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPG
FT                   SLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGFDA
FT                   IISIGVIHHFSTKERRIRAIKEMARVLAPGGQLMIYVWAMEQKNRRFEKQDVLVPWNRA
FT                   LCSRLLSESHQSWGHHCEHPTSRGFQGPGSVCGCAVCFKGRCDSKRSHSMDYGSAVART
FT                   CCEAISKEGERENGLYSNFGKSFRSWFFSRSLDESTLRKQIERVRPMKIPEGWANSTVS
FT                   QQPSRHPSLDLHAPEPFSTKGPNLDEVFVDTSSQRHLGWLRTPGTSDNFSGHKGGESRR
FT                   KEGGNFLDITDTGDSVAASNSSDPSARKILRRVSAFDSNDSNSEDSSFLEAQRDATDSK
FT                   AFMRYYHVFREGELSSLLQESVSELQVLSSGNDHGNWCIIAEKKRSWD"
FT   CDS             join(3454665..3454818,3461644..3461817,3468071..3468235,
FT                   3468893..3468894)
FT                   /codon_start=1
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, isoform CRA_b"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT171706.0
FT                   protein_id=mCP94624.0 isoform=CRA_b"
FT                   /protein_id="EDL35470.1"
FT                   /translation="MDPEAVELERRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPG
FT                   SLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGFDA
FT                   IISIGVIHHFSTKERRIRAIKEMARVLAPGGQLMIYVWAMEQKNRRFEKQDVLVPWNRA
FT                   L"
FT   CDS             join(3454665..3454818,3461644..3461753,3468071..3468115)
FT                   /codon_start=1
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, isoform CRA_d"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT180420.0
FT                   protein_id=mCP103343.0 isoform=CRA_d"
FT                   /protein_id="EDL35473.1"
FT                   /translation="MDPEAVELERRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPG
FT                   SLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNRGCEVMSYIIFLQKKEELEQ"
FT   CDS             join(3454665..3454818,3461644..3461817,3466688..3466692)
FT                   /codon_start=1
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, isoform CRA_c"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT171707.0
FT                   protein_id=mCP94626.1 isoform=CRA_c"
FT                   /protein_id="EDL35471.1"
FT                   /translation="MDPEAVELERRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPG
FT                   SLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGFDA
FT                   IISIGG"
FT   CDS             join(3454665..3454818,3461644..3461817,3464285..3464337)
FT                   /codon_start=1
FT                   /gene="6430573F11Rik"
FT                   /locus_tag="mCG_13848"
FT                   /product="RIKEN cDNA 6430573F11, isoform CRA_e"
FT                   /note="gene_id=mCG13848.2 transcript_id=mCT180421.0
FT                   protein_id=mCP103342.0 isoform=CRA_e"
FT                   /protein_id="EDL35474.1"
FT                   /translation="MDPEAVELERRHVHSVYENTAPYFTDLQSKAWPRVRQFLQDQKPG
FT                   SLVADIGCGTGKYLKVNSQVHTLGCDYCGPLVEIARNRGCEVMVCDNLNLPFRDQGFDA
FT                   IISIGAISGGSLKVLTYADPLF"
FT   assembly_gap    3465374..3465393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3470947..3470966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3470967..3471723
FT                   /locus_tag="mCG_64458"
FT                   /note="gene_id=mCG64458.2"
FT   mRNA            3470967..3471723
FT                   /locus_tag="mCG_64458"
FT                   /product="mCG64458"
FT                   /note="gene_id=mCG64458.2 transcript_id=mCT64641.2 created
FT                   on 09-AUG-2002"
FT   CDS             3471284..3471553
FT                   /codon_start=1
FT                   /locus_tag="mCG_64458"
FT                   /product="mCG64458"
FT                   /note="gene_id=mCG64458.2 transcript_id=mCT64641.2
FT                   protein_id=mCP42786.1"
FT                   /protein_id="EDL35476.1"
FT                   /translation="MKIDTGVKYKLKSTVPFTFPSEDIKLYVQWLPGRNGDSELVSSDD
FT                   LFIMVSPFSEIYATFTWLCCQTSEPDITLIGMCYLKLVIWNPVH"
FT   assembly_gap    3476182..3476201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3479043..3479256
FT                   /pseudo
FT                   /locus_tag="mCG_1042805"
FT                   /note="gene_id=mCG1042805.1"
FT   mRNA            3479043..3479256
FT                   /pseudo
FT                   /locus_tag="mCG_1042805"
FT                   /note="gene_id=mCG1042805.1 transcript_id=mCT160509.1
FT                   created on 09-AUG-2002"
FT   assembly_gap    3479725..3479744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3480883..3480902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3508050..3509901)
FT                   /locus_tag="mCG_148207"
FT                   /note="gene_id=mCG148207.0"
FT   mRNA            complement(join(3508050..3509361,3509384..3509901))
FT                   /locus_tag="mCG_148207"
FT                   /product="mCG148207"
FT                   /note="gene_id=mCG148207.0 transcript_id=mCT188470.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(3509322..3509361,3509384..3509544))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148207"
FT                   /product="mCG148207"
FT                   /note="gene_id=mCG148207.0 transcript_id=mCT188470.0
FT                   protein_id=mCP108786.0"
FT                   /protein_id="EDL35477.1"
FT                   /translation="MAQERDPPSCMSSGSRAWGPVLSNCWPFCLRRFSRASYSSPVSLN
FT                   DPSEKFILRHGQVMPGESFLQ"
FT   assembly_gap    3512350..3513801
FT                   /estimated_length=1452
FT                   /gap_type="unknown"
FT   assembly_gap    3515410..3515537
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    3520077..3520147
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            complement(3523521..3570552)
FT                   /locus_tag="mCG_13846"
FT                   /note="gene_id=mCG13846.2"
FT   mRNA            complement(join(3523521..3526170,3527038..3527211,
FT                   3528441..3528658,3529739..3529957,3530573..3530687,
FT                   3532655..3532868,3534785..3534983,3535108..3535267,
FT                   3538252..3538428,3539092..3540518,3542203..3542266,
FT                   3548859..3548940,3556001..3556072,3570209..3570552))
FT                   /locus_tag="mCG_13846"
FT                   /product="mCG13846"
FT                   /note="gene_id=mCG13846.2 transcript_id=mCT17854.2 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(3526050..3526170,3527038..3527211,
FT                   3528441..3528658,3529739..3529957,3530573..3530687,
FT                   3532655..3532868,3534785..3534983,3535108..3535267,
FT                   3538252..3538428,3539092..3540518,3542203..3542266,
FT                   3548859..3548940,3556001..3556072,3570209..3570245))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13846"
FT                   /product="mCG13846"
FT                   /note="gene_id=mCG13846.2 transcript_id=mCT17854.2
FT                   protein_id=mCP23081.2"
FT                   /protein_id="EDL35478.1"
FT                   /translation="MCRDEPDTMILTQIEAKEACDWLRVTGFPQYAQLYEDLLFPIDIA
FT                   LVKREHDFLDRDAIEALCRRLNTLNKCAVMKLEISPHRKRSEDSDEDEPCAISGKWTFQ
FT                   RDSKRWSRLEEFDVFFPKQDPIPGSPDNSRLQSATSHESMLTDLSEHQEVASVRSLSST
FT                   SSSVPTHAAHSGDATTPRTNSVISVCSSGHFVGNDDSFSSLPSPKELSSFSFSMKGHHE
FT                   KNTKSKTRSLLKRMESLKLKGSHHSKHKAPSKLGLIISAPILQEGMDEAKLKQLNCVEI
FT                   SALNGNHINVPMVRKRSVSNSTQTSSSSSQSETSSAVSTPSPVTRTRSLSTCNKRVGMY
FT                   LEGFDPFSQSTLNNVTEQNYKNRESYPEDTVFYIPEDHKPGTFPKALSHGSFCPSGNSS
FT                   VNWRTGSFHGPGHLSLRRENSHDSPKELKRRNSSSSLSSRLSIYDNVPGSILYSSSGEL
FT                   ADLENEDIFPELDDILYHVKGMQRIVNQWSEKFSDEGDSDSALDSVSPCPSSPKQIHLD
FT                   VDHDRRTPSDLDSTGNSLNEPEEPTDIPERRDSGVGASLTRCNRHRLRWHSFQSSHRPS
FT                   LNSVSLQINCQSVAQMNLLQKYSLLKLTALLEKYTPSNKHGFSWAVPKFMKRIKVPDYK
FT                   DRSVFGVPLTVNVQRSGQPLPQSIQQAMRYLRNHCLDQVGLFRKSGVKSRIQALRQMNE
FT                   SAEDNVNYEGQSAYDVADMLKQYFRDLPEPLMTNKLSETFLQIYQYVPKDQRLQAIKAA
FT                   IMLLPDENREVLQTLLYFLSDVTAAVKENQMTPTNLAVCLAPSLFHLNTLKRENSSPRV
FT                   MQRKQSLGKPDQKDLNENLAATQGLAHMIAECKKLFQVPEEMSRCRNSYTEQELKPLTL
FT                   EALGHLNSDQPADYRHFLQDCVDGLFKEVKEKFKGWVSYPTSEQADLSYKKVSEGPPLR
FT                   LWRSTIEVPAAPEEILKRLLKEQHLWDVDLLDSKVIEILDSQTEIYQYVQNSMAPHPAR
FT                   DYVVLRTWRTNLPRGACALLLTSVDHDRAPVAGVRVNVLLSRYLIEPCGSGKSKLTYMC
FT                   RADLRGHMPEWYSKSFGHLCAAEVVKIRDSFSNQNTESKDTRSR"
FT   assembly_gap    3547656..3547675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3551332..3551351
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3557420..3557522
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    3564428..3564504
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    3573801..3573888
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    3580411..3580448
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    3582012..3582272
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    3585023..3585042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3591587..3596998
FT                   /estimated_length=5412
FT                   /gap_type="unknown"
FT   assembly_gap    3614081..3614100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3616173..3616441
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    3628844..3628863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3629973..3630160
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    3655573..3655592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3678911..3678930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3681692..3681711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3683966..3684011
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    3696842..3697011
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    3700599..3700618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3701739..3701758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3721212..3721231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3722300..3722319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3722647..3723295
FT                   /locus_tag="mCG_1042852"
FT                   /note="gene_id=mCG1042852.1"
FT   mRNA            3722647..3723295
FT                   /locus_tag="mCG_1042852"
FT                   /product="mCG1042852"
FT                   /note="gene_id=mCG1042852.1 transcript_id=mCT160556.1
FT                   created on 09-AUG-2002"
FT   CDS             3723060..3723248
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042852"
FT                   /product="mCG1042852"
FT                   /note="gene_id=mCG1042852.1 transcript_id=mCT160556.1
FT                   protein_id=mCP59985.1"
FT                   /protein_id="EDL35479.1"
FT                   /translation="MGWVHRIMFQVLALEGWPSGEGRARVEMLGKPNSTDGNRGWLTPP
FT                   RTTKARVRVHGTTSNFV"
FT   assembly_gap    3723474..3723493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3724595..3724614
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3727602..3727621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3755466..3756094)
FT                   /locus_tag="mCG_1042853"
FT                   /note="gene_id=mCG1042853.0"
FT   mRNA            complement(3755466..3756094)
FT                   /locus_tag="mCG_1042853"
FT                   /product="mCG1042853"
FT                   /note="gene_id=mCG1042853.0 transcript_id=mCT160557.0
FT                   created on 09-AUG-2002"
FT   CDS             complement(3755529..3755705)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042853"
FT                   /product="mCG1042853"
FT                   /note="gene_id=mCG1042853.0 transcript_id=mCT160557.0
FT                   protein_id=mCP59991.1"
FT                   /protein_id="EDL35480.1"
FT                   /translation="MGRNKKGPVSTRWKVKTQSQKLSSSLYLWAIKYMCVRTHAHTHAC
FT                   TPREGGDLSFSKK"
FT   assembly_gap    3760090..3760109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3804455..3805108
FT                   /estimated_length=654
FT                   /gap_type="unknown"
FT   assembly_gap    3808315..3808673
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   gene            complement(3816940..3920041)
FT                   /gene="A730069N07Rik"
FT                   /locus_tag="mCG_13847"
FT                   /note="gene_id=mCG13847.3"
FT   mRNA            complement(join(3816940..3818109,3825605..3825678,
FT                   3905215..3906414,3919805..3920041))
FT                   /gene="A730069N07Rik"
FT                   /locus_tag="mCG_13847"
FT                   /product="RIKEN cDNA A730069N07"
FT                   /note="gene_id=mCG13847.3 transcript_id=mCT17855.3 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(3817924..3818109,3825605..3825678,
FT                   3905215..3906289))
FT                   /codon_start=1
FT                   /gene="A730069N07Rik"
FT                   /locus_tag="mCG_13847"
FT                   /product="RIKEN cDNA A730069N07"
FT                   /note="gene_id=mCG13847.3 transcript_id=mCT17855.3
FT                   protein_id=mCP23054.3"
FT                   /protein_id="EDL35481.1"
FT                   /translation="MSVAIRKRSWEEHVTQQTEQPFISDEYDIACHHGLASDSLEGRME
FT                   KDATLNVDHKEKCASPPDRCCGSETRDFPGRPMGHIAQEVDESDSQEGEERFLSLEAST
FT                   ETLVHISDEDTDSDLNLINDSQILTPQRHERDSQDSVKGAGSFMKTLSTMQSSQDSHNT
FT                   WRMAGKADMSPAEGSGERKDVEAISKSLELCKNTSADETKDVPIGNTFQSLNTEDDVTP
FT                   KTLLLDSSVLIEDVTPETQLLDSAVITQQCRKSDFPKDDQENNRHHVLEEDVLAAPYVD
FT                   RGLPLLKADCGSSLLQPPSCPSGMSAENDLEKSGFSEYQNKSTLGVSREDGMQCLHLRG
FT                   PVTTQETVDNQVRLRKRKGHRECSQHCLPLHPAPQTNLRRHVPDLESGSESRTDSMAVN
FT                   QTQVNLSSESTDPSSTPGSNSGTKPKAMVSCTQSQTQQSLLPNMR"
FT   assembly_gap    3822613..3822692
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    3825679..3825993
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    3826989..3827052
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    3843581..3843600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3857169..3857188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3858077..3858229
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    3860980..3861065
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    3880942..3881123
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    3936258..3936354
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   gene            complement(3947031..3991861)
FT                   /locus_tag="mCG_148209"
FT                   /note="gene_id=mCG148209.0"
FT   mRNA            complement(join(3947031..3948830,3953537..3954702,
FT                   3978460..3978555,3991802..3991861))
FT                   /locus_tag="mCG_148209"
FT                   /product="mCG148209"
FT                   /note="gene_id=mCG148209.0 transcript_id=mCT188472.1
FT                   created on 19-MAR-2004"
FT   CDS             complement(3954109..3954321)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148209"
FT                   /product="mCG148209"
FT                   /note="gene_id=mCG148209.0 transcript_id=mCT188472.1
FT                   protein_id=mCP108788.1"
FT                   /protein_id="EDL35482.1"
FT                   /translation="MSNIFTIILKSSKINRLGCHNMRSKWVTASERLRATGTEGLLFEA
FT                   GPPSIQNRLLGSSTEMSQFWQLRNS"
FT   gene            3961098..3963019
FT                   /locus_tag="mCG_67192"
FT                   /note="gene_id=mCG67192.1"
FT   mRNA            3961098..3963019
FT                   /locus_tag="mCG_67192"
FT                   /product="mCG67192"
FT                   /note="gene_id=mCG67192.1 transcript_id=mCT67375.1 created
FT                   on 12-AUG-2002"
FT   CDS             3961217..3962098
FT                   /codon_start=1
FT                   /locus_tag="mCG_67192"
FT                   /product="mCG67192"
FT                   /note="gene_id=mCG67192.1 transcript_id=mCT67375.1
FT                   protein_id=mCP42793.0"
FT                   /db_xref="GOA:B9EKF7"
FT                   /db_xref="InterPro:IPR027932"
FT                   /db_xref="MGI:MGI:2142538"
FT                   /db_xref="UniProtKB/TrEMBL:B9EKF7"
FT                   /protein_id="EDL35483.1"
FT                   /translation="MGWPPAQKPEDSKEEHGGPAQTDVCATQVSEEFPGSCADEVLSSG
FT                   SISFSGELQSYSHTSESPVETKTPTTSSEEQDEQSELSLLQKDENKLSEMWINHLKSKE
FT                   IHSERSQPDRRLPPEIPKESAEELDALQSFCTKKVNLIHQRQDSRAKKSNRPKRLQLRW
FT                   IAETSEVDAFNCTIPDELCNRIYLENTRATLAYIGAITQHISSQCPSCNSKRAELAQSD
FT                   FLRRRKTLLQSLLLQEKIEEHLHTTDFLTRVGEAHQGFPRLSDDPRIIWKRLTEKMQKG
FT                   SSGFGRAYSKQV"
FT   assembly_gap    3997878..4003347
FT                   /estimated_length=5470
FT                   /gap_type="unknown"
FT   assembly_gap    4029839..4029858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4041686..4041705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4049727..4049746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4050983..4051589
FT                   /estimated_length=607
FT                   /gap_type="unknown"
FT   gene            4053326..4054434
FT                   /pseudo
FT                   /locus_tag="mCG_140883"
FT                   /note="gene_id=mCG140883.0"
FT   mRNA            4053326..4054434
FT                   /pseudo
FT                   /locus_tag="mCG_140883"
FT                   /note="gene_id=mCG140883.0 transcript_id=mCT171986.0
FT                   created on 12-AUG-2002"
FT   assembly_gap    4055815..4055834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4060601..4060716
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    4061771..4062619
FT                   /estimated_length=849
FT                   /gap_type="unknown"
FT   gene            4063907..4064995
FT                   /pseudo
FT                   /locus_tag="mCG_140884"
FT                   /note="gene_id=mCG140884.0"
FT   mRNA            4063907..4064995
FT                   /pseudo
FT                   /locus_tag="mCG_140884"
FT                   /note="gene_id=mCG140884.0 transcript_id=mCT171985.0
FT                   created on 12-AUG-2002"
FT   assembly_gap    4072440..4073970
FT                   /estimated_length=1531
FT                   /gap_type="unknown"
FT   gene            <4074457..4075146
FT                   /locus_tag="mCG_1042808"
FT                   /note="gene_id=mCG1042808.1"
FT   mRNA            <4074457..4075146
FT                   /locus_tag="mCG_1042808"
FT                   /product="mCG1042808"
FT                   /note="gene_id=mCG1042808.1 transcript_id=mCT160512.1
FT                   created on 12-AUG-2002"
FT   CDS             <4074457..4075053
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042808"
FT                   /product="mCG1042808"
FT                   /note="gene_id=mCG1042808.1 transcript_id=mCT160512.1
FT                   protein_id=mCP59829.1"
FT                   /protein_id="EDL35484.1"
FT                   /translation="RPAPEARVYFQVTQFIMEAGVKLGMQSIPIATACTIYYKFFCKIN
FT                   LDAYDLYLVAMSSIYLACKVEEQQLRPRDIIIVLHRFFNLGSEPLELDSCFWELRDSIL
FT                   QCELLMLRVLCFQVSFQYPHKYPLHYLISPKNWLNRYSYQCTSISVTAWALLRDSYHGG
FT                   LCLCFQAQHLAVAVLYLALQVYGVEVPAEGEAEKP"
FT   assembly_gap    4103116..4103135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4110628..4110647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4111716..4111735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4124151..4125259
FT                   /pseudo
FT                   /locus_tag="mCG_114917"
FT                   /note="gene_id=mCG114917.1"
FT   mRNA            join(4124151..4124788,4125078..4125259)
FT                   /pseudo
FT                   /locus_tag="mCG_114917"
FT                   /note="gene_id=mCG114917.1 transcript_id=mCT116015.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    4145682..4147796
FT                   /estimated_length=2115
FT                   /gap_type="unknown"
FT   gene            complement(4151552..4151978)
FT                   /pseudo
FT                   /locus_tag="mCG_1042809"
FT                   /note="gene_id=mCG1042809.1"
FT   mRNA            complement(4151552..4151978)
FT                   /pseudo
FT                   /locus_tag="mCG_1042809"
FT                   /note="gene_id=mCG1042809.1 transcript_id=mCT160513.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    4187734..4187753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4189457..4189476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4194956..4194975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4201255..4201274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4202471..4202490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4205634..4205798
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    4209173..4209192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4231093..4231112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4234724..4234743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4280989..4281032
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    4296741..4296760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4299829..4299848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4312748..4312834
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    4326370..4330619
FT                   /estimated_length=4250
FT                   /gap_type="unknown"
FT   assembly_gap    4335729..4335748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4339963..4341302)
FT                   /pseudo
FT                   /locus_tag="mCG_114916"
FT                   /note="gene_id=mCG114916.1"
FT   mRNA            complement(4339963..4341302)
FT                   /pseudo
FT                   /locus_tag="mCG_114916"
FT                   /note="gene_id=mCG114916.1 transcript_id=mCT116014.1
FT                   created on 12-AUG-2002"
FT   assembly_gap    4371498..4371517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4373263..4374256
FT                   /estimated_length=994
FT                   /gap_type="unknown"
FT   assembly_gap    4375736..4377306
FT                   /estimated_length=1571
FT                   /gap_type="unknown"
FT   assembly_gap    4378271..4378547
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    4379905..4379924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4385687..4386189
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    4390612..4390631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4392285..4392304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4393725..4393744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4439885..4439904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4457678..4460751
FT                   /estimated_length=3074
FT                   /gap_type="unknown"
FT   assembly_gap    4479271..4479469
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            complement(4491964..>4492114)
FT                   /locus_tag="mCG_1042810"
FT                   /note="gene_id=mCG1042810.1"
FT   mRNA            complement(4491964..>4492114)
FT                   /locus_tag="mCG_1042810"
FT                   /product="mCG1042810"
FT                   /note="gene_id=mCG1042810.1 transcript_id=mCT160514.1
FT                   created on 12-AUG-2002"
FT   CDS             complement(4492008..>4492112)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042810"
FT                   /product="mCG1042810"
FT                   /note="gene_id=mCG1042810.1 transcript_id=mCT160514.1
FT                   protein_id=mCP59835.1"
FT                   /protein_id="EDL35485.1"
FT                   /translation="CKQSKILAVGILFSEACNKPISFKNSLVILVFLS"
FT   gene            complement(4496427..>4696875)
FT                   /gene="Sgcz"
FT                   /locus_tag="mCG_114915"
FT                   /note="gene_id=mCG114915.0"
FT   mRNA            complement(join(4496427..4497582,4500307..4500430,
FT                   4513930..4514002,4530931..4531053,4614776..4614863,
FT                   4696774..>4696875))
FT                   /gene="Sgcz"
FT                   /locus_tag="mCG_114915"
FT                   /product="sarcoglycan zeta"
FT                   /note="gene_id=mCG114915.0 transcript_id=mCT116013.0
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(4497391..4497582,4500307..4500430,
FT                   4513930..4514002,4530931..4531053,4614776..4614863,
FT                   4696774..>4696875))
FT                   /codon_start=1
FT                   /gene="Sgcz"
FT                   /locus_tag="mCG_114915"
FT                   /product="sarcoglycan zeta"
FT                   /note="gene_id=mCG114915.0 transcript_id=mCT116013.0
FT                   protein_id=mCP59934.0"
FT                   /protein_id="EDL35486.1"
FT                   /translation="DGMGNLRVTKKGIRLEGISEFLLPLYVKEIHSRKDSPLVLQSDRN
FT                   VTVNARNHMGQLTGQLTVGAEAVEAQCKRFEVRASEDGRVLFSADEDEITIGAEKLKVT
FT                   GTEGAVFGHSVETPHIRAEPSQDLRLESPTRSLKMEAPRGVQVSAAAGDFKATCRKELH
FT                   LQSTEGEIFLNADSIRLGNLPIGSFSSSTSSSNSRQTVYELCVCPNGKLYLSPAGVGST
FT                   CQSSSSICLWN"
FT   assembly_gap    4540981..4541194
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    4570309..4570328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4577748..4582084
FT                   /estimated_length=4337
FT                   /gap_type="unknown"
FT   assembly_gap    4584741..4584760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4586051..4586070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4588794..4594749
FT                   /estimated_length=5956
FT                   /gap_type="unknown"
FT   assembly_gap    4598976..4599005
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    4607767..4607786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4611014..4611033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4612065..4612084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4613722..4613741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4635048..4635067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4642869..4642888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4644730..4644749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4652616..4652719
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    4657696..4657715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4661536..4661555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4662754..4662773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4679155..4679384
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   gene            complement(4755091..4756522)
FT                   /pseudo
FT                   /locus_tag="mCG_58618"
FT                   /note="gene_id=mCG58618.1"
FT   mRNA            complement(join(4755091..4755980,4756105..4756522))
FT                   /pseudo
FT                   /locus_tag="mCG_58618"
FT                   /note="gene_id=mCG58618.1 transcript_id=mCT58801.2 created
FT                   on 12-AUG-2002"
FT   assembly_gap    4755991..4756104
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    4789477..4789496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4807502..4807813
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    4815789..4815887
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    4827644..4827663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4834127..4834146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4842203..4845406
FT                   /estimated_length=3204
FT                   /gap_type="unknown"
FT   assembly_gap    4861669..4861688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4871470..4871680
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    4885574..4885593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4886667..4886686
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4889083..4891229
FT                   /estimated_length=2147
FT                   /gap_type="unknown"
FT   assembly_gap    4892967..4892986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4895822..4896830
FT                   /estimated_length=1009
FT                   /gap_type="unknown"
FT   assembly_gap    4899539..4899558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4906346..4906365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4907428..4907447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4908761..4908780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4910139..4910158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4911367..4911386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4913160..4914788
FT                   /estimated_length=1629
FT                   /gap_type="unknown"
FT   assembly_gap    4921635..4921654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4922678..4922697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4927812..4927831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4943057..4947900
FT                   /estimated_length=4844
FT                   /gap_type="unknown"
FT   assembly_gap    4952798..4952817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4958165..4958184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4959955..4960609
FT                   /estimated_length=655
FT                   /gap_type="unknown"
FT   assembly_gap    4962437..4963693
FT                   /estimated_length=1257
FT                   /gap_type="unknown"
FT   assembly_gap    4994958..4995145
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    5000883..5000902
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5006212..5006625
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    5014382..5015007
FT                   /estimated_length=626
FT                   /gap_type="unknown"
FT   assembly_gap    5016221..5016240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5022303..5022322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5024294..5025105
FT                   /estimated_length=812
FT                   /gap_type="unknown"
FT   assembly_gap    5033472..5033491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5038435..5038515
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    5050034..5050053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5051086..5051105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5055800..5055819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5058687..5058706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5066327..5066346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5068246..5068265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5069400..5069419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5071096..5071115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5071116..5072369
FT                   /pseudo
FT                   /locus_tag="mCG_54171"
FT                   /note="gene_id=mCG54171.2"
FT   mRNA            join(5071116..5071893,5072226..5072369)
FT                   /pseudo
FT                   /locus_tag="mCG_54171"
FT                   /note="gene_id=mCG54171.2 transcript_id=mCT54354.2 created
FT                   on 14-AUG-2002"
FT   assembly_gap    5073881..5073900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5074036..5075202
FT                   /pseudo
FT                   /locus_tag="mCG_1042781"
FT                   /note="gene_id=mCG1042781.1"
FT   mRNA            5074036..5075202
FT                   /pseudo
FT                   /locus_tag="mCG_1042781"
FT                   /note="gene_id=mCG1042781.1 transcript_id=mCT160485.1
FT                   created on 14-AUG-2002"
FT   assembly_gap    5075207..5075226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5078765..5078784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5087160..5088215
FT                   /estimated_length=1056
FT                   /gap_type="unknown"
FT   assembly_gap    5090083..5090102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5091538..5091557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5093627..5093646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5094686..5094705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5102347..5102366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5138134..5138153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5139771..5140025
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    5154716..5155239
FT                   /estimated_length=524
FT                   /gap_type="unknown"
FT   assembly_gap    5164576..5164595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5166363..5166382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5167671..5167690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5169636..5170574
FT                   /estimated_length=939
FT                   /gap_type="unknown"
FT   assembly_gap    5175681..5175700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5177231..5177250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5179140..5179159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5180768..5180787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5183731..5183750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5185751..5188509
FT                   /estimated_length=2759
FT                   /gap_type="unknown"
FT   assembly_gap    5208129..5208314
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    5217240..5218039
FT                   /estimated_length=800
FT                   /gap_type="unknown"
FT   assembly_gap    5220307..5220326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5221940..5221959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5223071..5223090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5225625..5225644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5228603..5228622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5254447..5254466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5274940..5275367
FT                   /estimated_length=428
FT                   /gap_type="unknown"
FT   assembly_gap    5340844..5340863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5342340..5342359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5343878..5343897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5344996..5345015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5378593..5378819
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    5399385..5399509
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    5418549..5418663
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    5421057..5423546
FT                   /estimated_length=2490
FT                   /gap_type="unknown"
FT   assembly_gap    5426349..5426368
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5427810..5427829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5429701..5429815
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    5450910..5453322
FT                   /estimated_length=2413
FT                   /gap_type="unknown"
FT   assembly_gap    5454746..5460316
FT                   /estimated_length=5571
FT                   /gap_type="unknown"
FT   assembly_gap    5461875..5461894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5480336..5482143
FT                   /estimated_length=1808
FT                   /gap_type="unknown"
FT   assembly_gap    5483288..5483307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5484368..5484387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5485447..5485466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5486512..5486531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5488517..5489846
FT                   /estimated_length=1330
FT                   /gap_type="unknown"
FT   assembly_gap    5492654..5492928
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    5499951..5499970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5507297..5507316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5534674..5534816
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            5556011..5556362
FT                   /pseudo
FT                   /locus_tag="mCG_1042814"
FT                   /note="gene_id=mCG1042814.1"
FT   mRNA            5556011..5556362
FT                   /pseudo
FT                   /locus_tag="mCG_1042814"
FT                   /note="gene_id=mCG1042814.1 transcript_id=mCT160518.1
FT                   created on 14-AUG-2002"
FT   assembly_gap    5594678..5594886
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    5651805..5651824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5653153..5653172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5656900..5656919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5663914..5664145
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    5678147..5678251
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    5690653..5690672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5701974..5702231
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    5719704..5720249
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    5725596..5725615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5727216..5728239
FT                   /estimated_length=1024
FT                   /gap_type="unknown"
FT   assembly_gap    5729436..5730797
FT                   /estimated_length=1362
FT                   /gap_type="unknown"
FT   assembly_gap    5737127..5738591
FT                   /estimated_length=1465
FT                   /gap_type="unknown"
FT   assembly_gap    5758591..5758866
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    5764476..5764495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5766358..5766377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5767618..5767637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5769048..5769067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5769908..5770240
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    5772426..5774468
FT                   /estimated_length=2043
FT                   /gap_type="unknown"
FT   assembly_gap    5776031..5776050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5780498..5781602
FT                   /estimated_length=1105
FT                   /gap_type="unknown"
FT   assembly_gap    5784161..5784180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5810097..5810116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5812958..5813250
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    5814837..5814856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5824280..5824299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5825900..5825919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5832909..5833113
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    5852114..5852652
FT                   /estimated_length=539
FT                   /gap_type="unknown"
FT   assembly_gap    5855926..5856936
FT                   /estimated_length=1011
FT                   /gap_type="unknown"
FT   assembly_gap    5874214..5874233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5876528..5876547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5891587..5891698
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    5921927..5921946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5940238..5940257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5943730..5944301
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    5945374..5946807
FT                   /estimated_length=1434
FT                   /gap_type="unknown"
FT   assembly_gap    5948522..5949939
FT                   /estimated_length=1418
FT                   /gap_type="unknown"
FT   assembly_gap    5950813..5950832
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5977393..5978369
FT                   /estimated_length=977
FT                   /gap_type="unknown"
FT   assembly_gap    5999259..6002136
FT                   /estimated_length=2878
FT                   /gap_type="unknown"
FT   assembly_gap    6002925..6005755
FT                   /estimated_length=2831
FT                   /gap_type="unknown"
FT   assembly_gap    6007142..6007161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6008424..6010617
FT                   /estimated_length=2194
FT                   /gap_type="unknown"
FT   assembly_gap    6026850..6026926
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    6027841..6028480
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    6033756..6033869
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            6046783..6182873
FT                   /gene="Tusc3"
FT                   /locus_tag="mCG_22289"
FT                   /note="gene_id=mCG22289.1"
FT   mRNA            join(6046783..6047075,6085552..6085721,6102276..6102393,
FT                   6106705..6106845,6110483..6110623,6135865..6135954,
FT                   6164914..6164977,6169492..6169529,6175008..6175098,
FT                   6182587..6182873)
FT                   /gene="Tusc3"
FT                   /locus_tag="mCG_22289"
FT                   /product="tumor suppressor candidate 3"
FT                   /note="gene_id=mCG22289.1 transcript_id=mCT20649.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(6046938..6047075,6085552..6085721,6102276..6102393,
FT                   6106705..6106845,6110483..6110623,6135865..6135954,
FT                   6164914..6164977,6169492..6169523)
FT                   /codon_start=1
FT                   /gene="Tusc3"
FT                   /locus_tag="mCG_22289"
FT                   /product="tumor suppressor candidate 3"
FT                   /note="gene_id=mCG22289.1 transcript_id=mCT20649.2
FT                   protein_id=mCP7011.2"
FT                   /protein_id="EDL35487.1"
FT                   /translation="MSARAAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKK
FT                   ENLLAEKVEQLMEWSSRRSIFRMNGDKFRKFVKAPPRNYSMIVMFTALQPQRQCSVCRQ
FT                   ANEEYQILANSWRYSSAFCNKLFFGMVDYDEGTDVFQQLNMNSAPTFMHFPSKGRPKRA
FT                   DTFDLQRIGFAAEQLAKWIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNL
FT                   EFIYNKTGWAMVSLCIVFAMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAES
FT                   HIILVLNAAITWGWFF"
FT   assembly_gap    6048270..6048289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6084749..6084871
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    6112186..6112447
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    6121137..6123781
FT                   /estimated_length=2645
FT                   /gap_type="unknown"
FT   assembly_gap    6124784..6124803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6126357..6126628
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    6169530..6170116
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    6188510..6188529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6190191..6190210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6217318..6217711
FT                   /pseudo
FT                   /locus_tag="mCG_49709"
FT                   /note="gene_id=mCG49709.2"
FT   mRNA            6217318..6217711
FT                   /pseudo
FT                   /locus_tag="mCG_49709"
FT                   /note="gene_id=mCG49709.2 transcript_id=mCT49892.2 created
FT                   on 14-AUG-2002"
FT   assembly_gap    6227650..6228606
FT                   /estimated_length=957
FT                   /gap_type="unknown"
FT   assembly_gap    6229726..6229745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6231212..6231231
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6237078..6237097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6249368..6249560
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    6256410..6256429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6265738..6265757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6266759..6266778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6267850..6267869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6284379..6284798
FT                   /estimated_length=420
FT                   /gap_type="unknown"
FT   assembly_gap    6289364..6289674
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   gene            6294956..6297711
FT                   /pseudo
FT                   /locus_tag="mCG_140945"
FT                   /note="gene_id=mCG140945.0"
FT   mRNA            join(6294956..6296606,6296713..6296791,6296889..6297711)
FT                   /pseudo
FT                   /locus_tag="mCG_140945"
FT                   /note="gene_id=mCG140945.0 transcript_id=mCT172384.0
FT                   created on 21-AUG-2002"
FT   assembly_gap    6299810..6299829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6302222..6302605
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    6310409..6310428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6310479..6381656
FT                   /locus_tag="mCG_140943"
FT                   /note="gene_id=mCG140943.0"
FT   mRNA            join(6310479..6310721,6318934..6319019,6356331..6356431,
FT                   6381491..6381656)
FT                   /locus_tag="mCG_140943"
FT                   /product="mCG140943"
FT                   /note="gene_id=mCG140943.0 transcript_id=mCT172380.0
FT                   created on 21-AUG-2002"
FT   CDS             join(6310698..6310721,6318934..6319019,6356331..6356431,
FT                   6381491..6381519)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140943"
FT                   /product="mCG140943"
FT                   /note="gene_id=mCG140943.0 transcript_id=mCT172380.0
FT                   protein_id=mCP95299.0"
FT                   /protein_id="EDL35488.1"
FT                   /translation="MRTQAPKPGVNLDLCLLCGLWSSSSAACDFNCQPLRRKKLLPDSL
FT                   LPLGAQLSDAQPLGDQHLLIRQRTNGTNFLMLFS"
FT   assembly_gap    6313091..6313202
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    6345160..6345363
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    6371641..6371824
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    6380733..6380752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6382245..6383047
FT                   /estimated_length=803
FT                   /gap_type="unknown"
FT   assembly_gap    6406917..6406936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6418680..6418833
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    6425213..6425451
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    6448515..6448534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6456537..6459232
FT                   /pseudo
FT                   /locus_tag="mCG_140944"
FT                   /note="gene_id=mCG140944.0"
FT   mRNA            6456537..6459232
FT                   /pseudo
FT                   /locus_tag="mCG_140944"
FT                   /note="gene_id=mCG140944.0 transcript_id=mCT172379.0
FT                   created on 21-AUG-2002"
FT   assembly_gap    6457026..6457045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6476730..6476749
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6477825..6478741
FT                   /estimated_length=917
FT                   /gap_type="unknown"
FT   assembly_gap    6480486..6481411
FT                   /estimated_length=926
FT                   /gap_type="unknown"
FT   assembly_gap    6484268..6484287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6485575..6485594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6486677..6486696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6521180..6521199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6522687..6522706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6524395..6524414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6526786..6526805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6532425..6532444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6533475..6533494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6534723..6537026
FT                   /estimated_length=2304
FT                   /gap_type="unknown"
FT   assembly_gap    6542875..6542894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6546163..6546664
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   assembly_gap    6559420..6559439
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6589312..6589793
FT                   /estimated_length=482
FT                   /gap_type="unknown"
FT   gene            complement(6603462..6642870)
FT                   /gene="Msr1"
FT                   /locus_tag="mCG_18344"
FT                   /note="gene_id=mCG18344.2"
FT   mRNA            complement(join(6603462..6606003,6608127..6608180,
FT                   6611674..6611763,6615782..6615862,6620077..6620263,
FT                   6624066..6624475,6631420..6631533,6632859..6632964,
FT                   6642830..6642870))
FT                   /gene="Msr1"
FT                   /locus_tag="mCG_18344"
FT                   /product="macrophage scavenger receptor 1"
FT                   /note="gene_id=mCG18344.2 transcript_id=mCT13984.2 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(6605993..6606003,6608127..6608180,
FT                   6611674..6611763,6615782..6615862,6620077..6620263,
FT                   6624066..6624475,6631420..6631533,6632859..6632964,
FT                   6642830..6642841))
FT                   /codon_start=1
FT                   /gene="Msr1"
FT                   /locus_tag="mCG_18344"
FT                   /product="macrophage scavenger receptor 1"
FT                   /note="gene_id=mCG18344.2 transcript_id=mCT13984.2
FT                   protein_id=mCP7010.2"
FT                   /protein_id="EDL35489.1"
FT                   /translation="MTKEMTENQRLCPHEREDADCSSESVKFDARSMTASLPHSTKNGP
FT                   SVQEKLKSFKAALIALYLLVFAVLIPVVGIVTAQLLNWEMKNCLVCSLNTSDTSQGPME
FT                   KENTSKVEMRFTIIMEHMKDMEERIESISNSKADLIDTERFQNFSMATDQRLNDILLQL
FT                   NSLISSVQEHGNSLDAISKSLQSLNMTLLDVQLHTETLNVRVRESTAKQQEDISKLEER
FT                   VYKVSAEVQSVKEEQAHVEQEVKQEVRVLNNITNDLRLKDWEHSQTLKNITFIQGPPGP
FT                   QGEKGDRGLTGQTGPPGAPGIRGIPGVKGDRGQIGFPGGRGNPGAPGKPGRSGSPGPKG
FT                   QKGEKGSVGGSRSV"
FT   assembly_gap    6618234..6618386
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    6635251..6635953
FT                   /estimated_length=703
FT                   /gap_type="unknown"
FT   assembly_gap    6637004..6637109
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    6654632..6654651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6656537..6656556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6683607..6683626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6691350..6691392
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    6697187..6697206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6720572..6722757)
FT                   /pseudo
FT                   /locus_tag="mCG_49792"
FT                   /note="gene_id=mCG49792.2"
FT   mRNA            complement(join(6720572..6721781,6722037..6722757))
FT                   /pseudo
FT                   /locus_tag="mCG_49792"
FT                   /note="gene_id=mCG49792.2 transcript_id=mCT49975.2 created
FT                   on 21-AUG-2002"
FT   assembly_gap    6751584..6751697
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    6777511..6777530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6780716..6780735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6794587..6794606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6815245..6815264
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6816409..6817518
FT                   /estimated_length=1110
FT                   /gap_type="unknown"
FT   assembly_gap    6818749..6818768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6824405..6824871
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    6850224..6850358
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    6878124..6878238
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    6880980..6883266
FT                   /estimated_length=2287
FT                   /gap_type="unknown"
FT   assembly_gap    6908867..6909013
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   gene            6931107..6933397
FT                   /pseudo
FT                   /locus_tag="mCG_49557"
FT                   /note="gene_id=mCG49557.2"
FT   mRNA            join(6931107..6931243,6932763..6933397)
FT                   /pseudo
FT                   /locus_tag="mCG_49557"
FT                   /note="gene_id=mCG49557.2 transcript_id=mCT49740.2 created
FT                   on 21-AUG-2002"
FT   assembly_gap    6941962..6941981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6954527..6955360
FT                   /estimated_length=834
FT                   /gap_type="unknown"
FT   assembly_gap    6961468..6961689
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    6968606..6968981
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    7007957..7008239
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   gene            7009694..7010357
FT                   /pseudo
FT                   /locus_tag="mCG_57146"
FT                   /note="gene_id=mCG57146.2"
FT   mRNA            7009694..7010357
FT                   /pseudo
FT                   /locus_tag="mCG_57146"
FT                   /note="gene_id=mCG57146.2 transcript_id=mCT57329.1 created
FT                   on 21-AUG-2002"
FT   assembly_gap    7010360..7010379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7017802..7018057
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    7034447..7034466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7036018..7036037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7037064..7037083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7038825..7038844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7040578..7041504
FT                   /estimated_length=927
FT                   /gap_type="unknown"
FT   assembly_gap    7045502..7045521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7046968..7046987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7056001..7056020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7057862..7057881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7091361..7091431
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    7164817..7164836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7165960..7165979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7167485..7167504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7199341..7199360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7212661..7212680
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7238181..7238377
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    7256123..7256760
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   gene            complement(7257251..7264992)
FT                   /gene="Fgf20"
FT                   /locus_tag="mCG_4613"
FT                   /note="gene_id=mCG4613.2"
FT   mRNA            complement(join(7257251..7258068,7259197..7259300,
FT                   7264463..7264992))
FT                   /gene="Fgf20"
FT                   /locus_tag="mCG_4613"
FT                   /product="fibroblast growth factor 20"
FT                   /note="gene_id=mCG4613.2 transcript_id=mCT3361.1 created on
FT                   17-JUL-2002"
FT   CDS             complement(join(7257823..7258068,7259197..7259300,
FT                   7264463..7264748))
FT                   /codon_start=1
FT                   /gene="Fgf20"
FT                   /locus_tag="mCG_4613"
FT                   /product="fibroblast growth factor 20"
FT                   /note="gene_id=mCG4613.2 transcript_id=mCT3361.1
FT                   protein_id=mCP7014.0"
FT                   /db_xref="GOA:Q059W0"
FT                   /db_xref="InterPro:IPR002209"
FT                   /db_xref="InterPro:IPR008996"
FT                   /db_xref="InterPro:IPR028142"
FT                   /db_xref="InterPro:IPR028291"
FT                   /db_xref="MGI:MGI:1891346"
FT                   /db_xref="UniProtKB/TrEMBL:Q059W0"
FT                   /protein_id="EDL35490.1"
FT                   /translation="MAPLTEVGAFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGALE
FT                   RGARGGPGSVELAHLHGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVA
FT                   VGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGR
FT                   RYFVALNKDGTPRDGARSKRHQKFTHFLPRPVDPERVPELYKDLLMYT"
FT   assembly_gap    7269343..7269477
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    7279188..7279207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7280406..7280425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7285539..7285961
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    7288175..7288196
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            7292425..>7359715
FT                   /locus_tag="mCG_116006"
FT                   /note="gene_id=mCG116006.0"
FT   mRNA            join(7292425..7292936,7293295..7293405,7321413..7321566,
FT                   7325901..7325932,7334546..7334624,7337682..7337729,
FT                   7339953..7340023,7342497..7342568,7345050..7345088,
FT                   7351526..7351621,7354424..7354524,7354983..7355154,
FT                   7357719..7357827,7359558..>7359715)
FT                   /locus_tag="mCG_116006"
FT                   /product="mCG116006"
FT                   /note="gene_id=mCG116006.0 transcript_id=mCT117121.1
FT                   created on 21-AUG-2002"
FT   CDS             join(7292595..7292936,7293295..7293405,7321413..7321566,
FT                   7325901..7325932,7334546..7334624,7337682..7337729,
FT                   7339953..7340023,7342497..7342568,7345050..7345088,
FT                   7351526..7351621,7354424..7354524,7354983..7355154,
FT                   7357719..7357827,7359558..>7359715)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116006"
FT                   /product="mCG116006"
FT                   /note="gene_id=mCG116006.0 transcript_id=mCT117121.1
FT                   protein_id=mCP59820.1"
FT                   /protein_id="EDL35491.1"
FT                   /translation="MIEATVCTQPQSARSIREFGTEQGTQSSAACLGGAPGHPAARLLE
FT                   FRLPAVPQGWGSLAHSRGYGRRPLPRRGWAEEAGRRTAWTWEALELLSPVRCIPRRLSG
FT                   KHRPGYGGPRLYGDPRADPSELAAPELEDPPRGRGLLPIPVAAAKETVATGRAITEDLD
FT                   LYATSRERRFRLFASIECEGQLFMTPYDFILAVTTDEPKFAKTWKSLSKQELSQMLSET
FT                   PPVWKGSSKLFRNLKERGVISYTEYLFLLCILTSFRIAFNMFDTDGNEMVDKKEFLVLQ
FT                   EIFRKKNEKRETKGDEEKRAMLRLQLYGYHSPTNSVLKTDAGELVSRSYWDTLRRSTSQ
FT                   ALFSDLAERADDITSLVADTTLLVHFFGKKGKAELNFEDFYRFMDNLQTEVLEIEFLSY
FT                   SNGMNTISEEDFAHILLRYTNVENTSVFLENVRYSISEEKGITFDEFRSFFQFLNNLED
FT                   FAIALNMYNFASRSIGQDEFKRAVYVATGLKLSPHLVNTVFKIFDVDKDDQLSYKEFIG
FT                   IMKDRLHRGFR"
FT   gene            complement(7364238..7365242)
FT                   /locus_tag="mCG_1042815"
FT                   /note="gene_id=mCG1042815.1"
FT   mRNA            complement(7364238..7365242)
FT                   /locus_tag="mCG_1042815"
FT                   /product="mCG1042815"
FT                   /note="gene_id=mCG1042815.1 transcript_id=mCT160519.1
FT                   created on 21-AUG-2002"
FT   CDS             complement(7364721..7364930)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042815"
FT                   /product="mCG1042815"
FT                   /note="gene_id=mCG1042815.1 transcript_id=mCT160519.1
FT                   protein_id=mCP59965.1"
FT                   /protein_id="EDL35492.1"
FT                   /translation="MQYIDVLNSLQYFIVPLYKPILSGSQSSIKYSKIIFQHKNLGVLF
FT                   FFFYFFLSLLFPSLAFPFFFRVGN"
FT   assembly_gap    7371257..7371750
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    7375118..7376514
FT                   /estimated_length=1397
FT                   /gap_type="unknown"
FT   assembly_gap    7380746..7380765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7383531..7383550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7387684..7388287
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    7391397..7391416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7397046..7397065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7405971..7487527
FT                   /gene="Zdhhc2"
FT                   /locus_tag="mCG_4616"
FT                   /note="gene_id=mCG4616.2"
FT   mRNA            join(<7405971..7406368,7427554..7427580,7428824..7428918,
FT                   7436180..7436300,7437713..7437782,7438345..7438377,
FT                   7443731..7443851,7445795..7445927,7449109..7449235,
FT                   7449595..7449687,7454431..7454543,7456215..7456287,
FT                   7487337..7487527)
FT                   /gene="Zdhhc2"
FT                   /locus_tag="mCG_4616"
FT                   /product="zinc finger, DHHC domain containing 2"
FT                   /note="gene_id=mCG4616.2 transcript_id=mCT3359.2 created on
FT                   21-AUG-2002"
FT   assembly_gap    7406266..7406285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<7406287..7406368,7427554..7427580,7428824..7428918,
FT                   7436180..7436300,7437713..7437782,7438345..7438377,
FT                   7443731..7443851,7445795..7445927,7449109..7449235,
FT                   7449595..7449687,7454431..7454543,7456215..7456255)
FT                   /codon_start=1
FT                   /gene="Zdhhc2"
FT                   /locus_tag="mCG_4616"
FT                   /product="zinc finger, DHHC domain containing 2"
FT                   /note="gene_id=mCG4616.2 transcript_id=mCT3359.2
FT                   protein_id=mCP7004.2 partial"
FT                   /protein_id="EDL35493.1"
FT                   /translation="VLYWIPVVFISLLLGWSYYAYAIQLCIVSMENIGEQVVCLMAYHL
FT                   LFAMFVWSYWKTIFTLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAAKDLPIYTR
FT                   TMSGAIRYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLAYS
FT                   LLYCLFIAATDLQYFIRFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSSLFGYHCWLVSK
FT                   NKSTLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKYWLLPVFSSQGDGCSFPTCL
FT                   VNQDPEQPSTPAGLNSTVKNPENHQFPAKPLRESQSHLLKDSQTWTESIANAGKGKAGM
FT                   SNPALTMENET"
FT   assembly_gap    7430854..7431262
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   gene            complement(7469967..7489009)
FT                   /gene="Cnot7"
FT                   /locus_tag="mCG_4614"
FT                   /note="gene_id=mCG4614.2"
FT   mRNA            complement(join(7469967..7471541,7473265..7473375,
FT                   7476665..7476809,7478046..7478207,7484743..7484936,
FT                   7487277..7487488,7488802..7489009))
FT                   /gene="Cnot7"
FT                   /locus_tag="mCG_4614"
FT                   /product="CCR4-NOT transcription complex, subunit 7,
FT                   transcript variant mCT3357"
FT                   /note="gene_id=mCG4614.2 transcript_id=mCT3357.1 created on
FT                   17-JUL-2002"
FT   mRNA            complement(join(7470462..7471541,7473265..7473375,
FT                   7476665..7476809,7478046..7478207,7484743..7484936,
FT                   7487277..>7488567))
FT                   /gene="Cnot7"
FT                   /locus_tag="mCG_4614"
FT                   /product="CCR4-NOT transcription complex, subunit 7,
FT                   transcript variant mCT193315"
FT                   /note="gene_id=mCG4614.2 transcript_id=mCT193315.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(7471413..7471541,7473265..7473375,
FT                   7476665..7476809,7478046..7478207,7484743..7484936,
FT                   7487277..>7487411))
FT                   /codon_start=1
FT                   /gene="Cnot7"
FT                   /locus_tag="mCG_4614"
FT                   /product="CCR4-NOT transcription complex, subunit 7,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG4614.2 transcript_id=mCT193315.0
FT                   protein_id=mCP114291.0 isoform=CRA_a"
FT                   /protein_id="EDL35494.1"
FT                   /translation="TPCAVTMPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAM
FT                   DTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFN
FT                   FKFNLTEDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFH
FT                   SGYDFGYLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQL
FT                   ELERIGPQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGN
FT                   AYEEEASKQS"
FT   CDS             complement(join(7471413..7471541,7473265..7473375,
FT                   7476665..7476809,7478046..7478207,7484743..7484936,
FT                   7487277..7487393))
FT                   /codon_start=1
FT                   /gene="Cnot7"
FT                   /locus_tag="mCG_4614"
FT                   /product="CCR4-NOT transcription complex, subunit 7,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG4614.2 transcript_id=mCT3357.1
FT                   protein_id=mCP7015.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q543X5"
FT                   /db_xref="InterPro:IPR006941"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="MGI:MGI:1298230"
FT                   /db_xref="UniProtKB/TrEMBL:Q543X5"
FT                   /protein_id="EDL35495.1"
FT                   /translation="MPAATVDHSQRICEVWACNLDEEMKKIRQVIRKYNYVAMDTEFPG
FT                   VVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLT
FT                   EDMYAQDSIELLTTSGIQFKKHEEEGIETQYFAELLMTSGVVLCEGVKWLSFHSGYDFG
FT                   YLIKILTNSNLPEEELDFFEILRLFFPVIYDVKYLMKSCKNLKGGLQEVAEQLELERIG
FT                   PQHQAGSDSLLTGMAFFKMREMFFEDHIDDAKYCGHLYGLGSGSSYVQNGTGNAYEEEA
FT                   SKQS"
FT   gene            7489062..7523416
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /note="gene_id=mCG4617.2"
FT   mRNA            join(7489062..7489521,7504111..7504185,7505495..7505600,
FT                   7506287..7506387,7513684..7513909,7516132..7516202,
FT                   7517502..7517629,7517712..7517770,7517848..7517916,
FT                   7520630..7520773,7521763..7521843,7523093..7523416)
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), transcript
FT                   variant mCT3360"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT3360.2 created on
FT                   13-FEB-2003"
FT   mRNA            join(7489064..7489495,7504111..7504185,7505495..7505609,
FT                   7506287..7506387,7513684..7513909,7516132..7516202,
FT                   7517502..7517629,7517712..7517770,7517848..7517916,
FT                   7520630..7520773,7521763..7521843,7523093..7523361)
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), transcript
FT                   variant mCT180444"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT180444.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(7489064..7489495,7504111..7504185,7505495..7505609,
FT                   7506287..7506387,7513684..7513909,7516132..7516202,
FT                   7517502..7517770,7517848..7518963)
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), transcript
FT                   variant mCT180446"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT180446.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(7489064..7489495,7504111..7504185,7505495..7505609,
FT                   7506287..7506387,7513684..7513909,7516132..7516202,
FT                   7517502..7517629,7517712..7518838)
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), transcript
FT                   variant mCT180445"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT180445.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(7489371..7489495,7504111..7504185,7505495..7505609,
FT                   7506287..7506387,7513684..7513909,7516132..7516202,
FT                   7517502..7517629,7517712..7517770,7517848..7517916,
FT                   7520630..7520773,7521763..7521843)
FT                   /codon_start=1
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT180444.0
FT                   protein_id=mCP103366.0 isoform=CRA_b"
FT                   /protein_id="EDL35497.1"
FT                   /translation="MSWLFPLAKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAE
FT                   IQKDVEYRLPFTVNNLTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVS
FT                   NFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFPFLPPYPP
FT                   PEANRNITSLSVADTVSSSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASVNQNGFGY
FT                   KMPDIPDAFPELSELSVSQLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKNIEELAR
FT                   KNLLLEHSLEGKRQTVLDKYELLLQMKSTFEKKMQRQHELSESCSASALQARLKVAAHE
FT                   AEEESDNIAEDFLEGKTEIDDFLNSFKEKRTICHCRRAKEEKLHQVIAMHSQFHAPL"
FT   CDS             join(7489371..7489495,7504111..7504185,7505495..7505609,
FT                   7506287..7506387,7513684..7513909,7516132..7516202,
FT                   7517502..7517629,7517712..7517782)
FT                   /codon_start=1
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT180445.0
FT                   protein_id=mCP103368.0 isoform=CRA_c"
FT                   /protein_id="EDL35498.1"
FT                   /translation="MSWLFPLAKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAE
FT                   IQKDVEYRLPFTVNNLTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVS
FT                   NFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFPFLPPYPP
FT                   PEANRNITSLSVADTVSSSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASVNQNGFGY
FT                   KMPDIPDAFPELSELSVSQLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKNIEELAR
FT                   KNLLLEHSLEGKRQTVLDKVSS"
FT   CDS             join(7489371..7489495,7504111..7504185,7505495..7505609,
FT                   7506287..7506387,7513684..7513909,7516132..7516202,
FT                   7517502..7517664)
FT                   /codon_start=1
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT180446.0
FT                   protein_id=mCP103367.0 isoform=CRA_d"
FT                   /protein_id="EDL35499.1"
FT                   /translation="MSWLFPLAKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAE
FT                   IQKDVEYRLPFTVNNLTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVS
FT                   NFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFPFLPPYPP
FT                   PEANRNITSLSVADTVSSSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASVNQNGFGY
FT                   KMPDIPDAFPELSELSVSQLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKNIEELAS
FT                   MSPFALIHNS"
FT   assembly_gap    7491577..7493859
FT                   /estimated_length=2283
FT                   /gap_type="unknown"
FT   mRNA            join(7496026..7496055,7504116..7504185,7505495..7505609,
FT                   7506287..7506387,7513684..7513909,7516132..7516202,
FT                   7517502..7517629,7517712..7517770,7517848..7517916,
FT                   7520630..7520773,7521763..7521843,7523093..7523416)
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), transcript
FT                   variant mCT172383"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT172383.0 created
FT                   on 13-FEB-2003"
FT   CDS             join(7505565..7505609,7506287..7506387,7513684..7513909,
FT                   7516132..7516202,7517502..7517629,7517712..7517770,
FT                   7517848..7517916,7520630..7520773,7521763..7521843)
FT                   /codon_start=1
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT172383.0
FT                   protein_id=mCP95302.0 isoform=CRA_a"
FT                   /protein_id="EDL35496.1"
FT                   /translation="MDSQGLYVTSPLVSNFTMHSDLGKIIQSLLDEFWKNPPVLAPTST
FT                   TFPYLYSNPGGMPPYPSQGFPFLPPYPPPEANRNITSLSVADTVSSSTTSYTAAKPVAP
FT                   SFGILSSLPLPVPTTESSASVNQNGFGYKMPDIPDAFPELSELSVSQLTDMNEQEEVLL
FT                   EQFLMLPQLKQIITDKEDLVKNIEELARKNLLLEHSLEGKRQTVLDKYELLLQMKSTFE
FT                   KKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDFLNSFKEKRT
FT                   ICHCRRAKEEKLHQVIAMHSQFHAPL"
FT   CDS             join(7505565..7505600,7506287..7506387,7513684..7513909,
FT                   7516132..7516202,7517502..7517629,7517712..7517770,
FT                   7517848..7517916,7520630..7520773,7521763..7521843)
FT                   /codon_start=1
FT                   /gene="Vps37a"
FT                   /locus_tag="mCG_4617"
FT                   /product="vacuolar protein sorting 37A (yeast), isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG4617.2 transcript_id=mCT3360.2
FT                   protein_id=mCP7005.1 isoform=CRA_e"
FT                   /protein_id="EDL35500.1"
FT                   /translation="MDSQGLYVTSPLFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTTFP
FT                   YLYSNPGGMPPYPSQGFPFLPPYPPPEANRNITSLSVADTVSSSTTSYTAAKPVAPSFG
FT                   ILSSLPLPVPTTESSASVNQNGFGYKMPDIPDAFPELSELSVSQLTDMNEQEEVLLEQF
FT                   LMLPQLKQIITDKEDLVKNIEELARKNLLLEHSLEGKRQTVLDKYELLLQMKSTFEKKM
FT                   QRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDFLNSFKEKRTICH
FT                   CRRAKEEKLHQVIAMHSQFHAPL"
FT   gene            complement(7524553..7527608)
FT                   /locus_tag="mCG_116000"
FT                   /note="gene_id=mCG116000.1"
FT   mRNA            complement(join(7524553..7525219,7525241..7527608))
FT                   /locus_tag="mCG_116000"
FT                   /product="mCG116000"
FT                   /note="gene_id=mCG116000.1 transcript_id=mCT117115.1
FT                   created on 17-JUL-2002"
FT   CDS             complement(7526199..7526429)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116000"
FT                   /product="mCG116000"
FT                   /note="gene_id=mCG116000.1 transcript_id=mCT117115.1
FT                   protein_id=mCP59796.1"
FT                   /protein_id="EDL35501.1"
FT                   /translation="MPNCTTYLEKQAVCMYLKFLLFNVTPLLASEPRAFCSLHPFTRHN
FT                   LGMFMESFLFFLQVNTEATNAHCSLPFRVPG"
FT   gene            complement(7527949..7607910)
FT                   /locus_tag="mCG_4612"
FT                   /note="gene_id=mCG4612.2"
FT   mRNA            complement(join(7527949..7528765,7531143..7531477,
FT                   7532648..7532788,7533317..7533404,7535004..7535204,
FT                   7537720..7537769,7539441..7539567,7540840..7540949,
FT                   7553046..7553178,7558593..7558727,7562121..7562249,
FT                   7568980..7569137,7578724..7578886,7580850..7580972,
FT                   7607814..7607910))
FT                   /locus_tag="mCG_4612"
FT                   /product="mCG4612, transcript variant mCT172381"
FT                   /note="gene_id=mCG4612.2 transcript_id=mCT172381.0 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(7527951..7528765,7531143..7531269,
FT                   7532648..7532788,7535004..7535204,7537720..7537769,
FT                   7539441..7539567,7540840..7540949,7553046..7553178,
FT                   7558593..7558727,7562121..7562249,7568980..7569137,
FT                   7578724..7578886,7580850..7580972,7607814..7607910))
FT                   /locus_tag="mCG_4612"
FT                   /product="mCG4612, transcript variant mCT3367"
FT                   /note="gene_id=mCG4612.2 transcript_id=mCT3367.2 created on
FT                   21-AUG-2002"
FT   mRNA            complement(join(7531798..7532788,7535004..7535204,
FT                   7537720..7537769,7539441..7539567,7540840..7540949,
FT                   7553046..7553178,7558593..7558727,7562121..7562249,
FT                   7568980..7569137,7578724..7578886,7580850..7580972,
FT                   7607814..7607910))
FT                   /locus_tag="mCG_4612"
FT                   /product="mCG4612, transcript variant mCT172382"
FT                   /note="gene_id=mCG4612.2 transcript_id=mCT172382.0 created
FT                   on 21-AUG-2002"
FT   CDS             complement(join(7539484..7539567,7540840..7540949,
FT                   7553046..7553178,7558593..7558727,7562121..7562249,
FT                   7568980..7569137,7578724..7578886,7580850..7580972,
FT                   7607814..7607837))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4612"
FT                   /product="mCG4612, isoform CRA_a"
FT                   /note="gene_id=mCG4612.2 transcript_id=mCT172381.0
FT                   protein_id=mCP95300.0 isoform=CRA_a"
FT                   /protein_id="EDL35502.1"
FT                   /translation="MEHIRTPKVENVRLVDRVSCKKAALGTLYLTATHVIFVENAPDTR
FT                   KETWILHSQISTIEKQATTATGCPLLIRCKNFQIVQLVIPQERDCHDVYISLIRLARPV
FT                   KYEELYCFSFNPKLDKEEREQGWLLVDLSEEYKRMGLPDNYWQLSDVNRDYRVCDSYPT
FT                   ELYVPRSATAHIIVGSSKFRSRRRFPALSYYCKDSHASICRSSQPLSGFSARCLEDEQM
FT                   LQAIRKANPGSDFIYVVDTRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRN
FT                   SLQKMLEVCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSD
FT                   GWDRTAPGVLGG"
FT   CDS             complement(join(7539484..7539567,7540840..7540949,
FT                   7553046..7553178,7558593..7558727,7562121..7562249,
FT                   7568980..7569137,7578724..7578886,7580850..7580972,
FT                   7607814..7607837))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4612"
FT                   /product="mCG4612, isoform CRA_a"
FT                   /note="gene_id=mCG4612.2 transcript_id=mCT172382.0
FT                   protein_id=mCP95301.0 isoform=CRA_a"
FT                   /protein_id="EDL35503.1"
FT                   /translation="MEHIRTPKVENVRLVDRVSCKKAALGTLYLTATHVIFVENAPDTR
FT                   KETWILHSQISTIEKQATTATGCPLLIRCKNFQIVQLVIPQERDCHDVYISLIRLARPV
FT                   KYEELYCFSFNPKLDKEEREQGWLLVDLSEEYKRMGLPDNYWQLSDVNRDYRVCDSYPT
FT                   ELYVPRSATAHIIVGSSKFRSRRRFPALSYYCKDSHASICRSSQPLSGFSARCLEDEQM
FT                   LQAIRKANPGSDFIYVVDTRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRN
FT                   SLQKMLEVCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSD
FT                   GWDRTAPGVLGG"
FT   CDS             complement(join(7539484..7539567,7540840..7540949,
FT                   7553046..7553178,7558593..7558727,7562121..7562249,
FT                   7568980..7569137,7578724..7578886,7580850..7580972,
FT                   7607814..7607837))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4612"
FT                   /product="mCG4612, isoform CRA_a"
FT                   /note="gene_id=mCG4612.2 transcript_id=mCT3367.2
FT                   protein_id=mCP7007.2 isoform=CRA_a"
FT                   /protein_id="EDL35504.1"
FT                   /translation="MEHIRTPKVENVRLVDRVSCKKAALGTLYLTATHVIFVENAPDTR
FT                   KETWILHSQISTIEKQATTATGCPLLIRCKNFQIVQLVIPQERDCHDVYISLIRLARPV
FT                   KYEELYCFSFNPKLDKEEREQGWLLVDLSEEYKRMGLPDNYWQLSDVNRDYRVCDSYPT
FT                   ELYVPRSATAHIIVGSSKFRSRRRFPALSYYCKDSHASICRSSQPLSGFSARCLEDEQM
FT                   LQAIRKANPGSDFIYVVDTRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRN
FT                   SLQKMLEVCELKSPSMSDFLWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSD
FT                   GWDRTAPGVLGG"
FT   assembly_gap    7549165..7549184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7557764..7557783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7573188..7573207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7576750..7577118
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    7581191..7581210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7582265..7582284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7589284..7589303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7624020..7633784
FT                   /locus_tag="mCG_1042868"
FT                   /note="gene_id=mCG1042868.1"
FT   mRNA            join(7624020..7624288,7633697..7633784)
FT                   /locus_tag="mCG_1042868"
FT                   /product="mCG1042868, transcript variant mCT172375"
FT                   /note="gene_id=mCG1042868.1 transcript_id=mCT172375.0
FT                   created on 22-AUG-2002"
FT   mRNA            join(7624020..7624284,7633687..7633784)
FT                   /locus_tag="mCG_1042868"
FT                   /product="mCG1042868, transcript variant mCT160572"
FT                   /note="gene_id=mCG1042868.1 transcript_id=mCT160572.1
FT                   created on 22-AUG-2002"
FT   CDS             join(7624150..7624288,7633697..7633761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042868"
FT                   /product="mCG1042868, isoform CRA_b"
FT                   /note="gene_id=mCG1042868.1 transcript_id=mCT172375.0
FT                   protein_id=mCP95294.0 isoform=CRA_b"
FT                   /protein_id="EDL35506.1"
FT                   /translation="MNCLELLWSRRFISAIVALRHHLPYNRTNRETSRHSGRKLNEAYT
FT                   VIYLVKCFRLRRVQQQLTERPE"
FT   CDS             join(7624150..7624284,7633687..7633761)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042868"
FT                   /product="mCG1042868, isoform CRA_a"
FT                   /note="gene_id=mCG1042868.1 transcript_id=mCT160572.1
FT                   protein_id=mCP59857.1 isoform=CRA_a"
FT                   /protein_id="EDL35505.1"
FT                   /translation="MNCLELLWSRRFISAIVALRHHLPYNRTNRETSRHSGRKLNEAYT
FT                   VPRVYLVKCFRLRRVQQQLTERPE"
FT   assembly_gap    7635982..7636056
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   gene            7653146..7655922
FT                   /locus_tag="mCG_4615"
FT                   /note="gene_id=mCG4615.1"
FT   mRNA            7653146..7655922
FT                   /locus_tag="mCG_4615"
FT                   /product="mCG4615"
FT                   /note="gene_id=mCG4615.1 transcript_id=mCT3358.1 created on
FT                   18-JUL-2002"
FT   CDS             7653291..7655576
FT                   /codon_start=1
FT                   /locus_tag="mCG_4615"
FT                   /product="mCG4615"
FT                   /note="gene_id=mCG4615.1 transcript_id=mCT3358.1
FT                   protein_id=mCP7016.2"
FT                   /protein_id="EDL35507.1"
FT                   /translation="MVAMSEALVHARITLLQAWLRMLLFSSVWPPTWCAEYKGPPETVK
FT                   PLRVIVSSKDMSLAGWMSYSLYFGGQRHIISMKSKNFLESRQLPVFTYNDQGVLFEDRP
FT                   FVQNDCYYLGFVDGDLESMAALTTCFGGFQGILQINDTAYEIKPKSPSSTFEHLLYKID
FT                   SEKTQLRPMRCGLTDEEIAGQVRLQENGKSTRMQSIYGSWWSHGLYIKLALVIDHEQYL
FT                   YRKKNTSLVIRDVLSIMQGINLFLLSVDINVVLLGLTIWTNGNPIPVQDIYALLPAFCT
FT                   WKGTNLDSQIPYDIAHLFVNYTFSNYFGIAYVGTVCDKTFGCGIDSIAEDDFLTIGHIV
FT                   AHEIGHNLGMSHDGILCTCGEESCLMSATMDSSQKLSNCSYEVLWAHMINKSCIHREPR
FT                   PSDIFQLKVCGNGIVEEGEQCDCGSSENCRRNRCCMPSCTLRSKAKCDTGLCCNRKCQI
FT                   QPSGTLCRARENECDLPEWCNGTSHECPEDLFVQDGTSCPGDGYCYEKRCNSHDVHCQR
FT                   VFGQLAMKASDSCYKELNTRGDRFGNCGFINNEYVRCEISDILCGRIQCDKVGTLPILQ
FT                   NHYTIHWTHFNSVSCWSTDYHLGMKITDLGDIKDGTNCGPQHVCIDRKCVNKPSWVNDC
FT                   TPETCNMKGVCNNKQHCHCDVGWSPPNCQETGTGGSIDSGSPGNEVYEDEVVSKKDAPE
FT                   KPNVIIWLLPIICVAVVLSVLFCLSGATKKSREAAASQPAGETVKPPYEGAEPSYETVK
FT                   PPDEWANP"
FT   assembly_gap    7659184..7667206
FT                   /estimated_length=8023
FT                   /gap_type="unknown"
FT   assembly_gap    7673872..7675072
FT                   /estimated_length=1201
FT                   /gap_type="unknown"
FT   assembly_gap    7680060..7680079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7681980..7709577
FT                   /estimated_length=27598
FT                   /gap_type="unknown"
FT   gene            complement(7713792..7714927)
FT                   /pseudo
FT                   /locus_tag="mCG_140941"
FT                   /note="gene_id=mCG140941.0"
FT   mRNA            complement(7713792..7714927)
FT                   /pseudo
FT                   /locus_tag="mCG_140941"
FT                   /note="gene_id=mCG140941.0 transcript_id=mCT172376.0
FT                   created on 22-AUG-2002"
FT   assembly_gap    7715779..7715798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7718072..7722077
FT                   /locus_tag="mCG_17733"
FT                   /note="gene_id=mCG17733.1"
FT   mRNA            join(7718072..7718155,7719542..7722077)
FT                   /locus_tag="mCG_17733"
FT                   /product="mCG17733"
FT                   /note="gene_id=mCG17733.1 transcript_id=mCT15658.1 created
FT                   on 18-JUL-2002"
FT   CDS             7719601..7721883
FT                   /codon_start=1
FT                   /locus_tag="mCG_17733"
FT                   /product="mCG17733"
FT                   /note="gene_id=mCG17733.1 transcript_id=mCT15658.1
FT                   protein_id=mCP3775.2 partial"
FT                   /protein_id="EDL35508.1"
FT                   /translation="MQTTQRASSFAAAEDNIAMDKAVVYTRIPHLYLWLEILNILSSRP
FT                   LTGYAQHTSLPEVVIPLRVTGNRPMWAMGWLTYSLHFGGQKHFIHIKAKKFLVSRLFSV
FT                   FTYXXXXXXXKDQPYVQNDCYYHGHMDGDPESMVAITTCYGGFQGILQINGTVYEIKPK
FT                   NLSSTFEHLVHKMDSEETELLPMRCALTEEIARQMKLQQNENPTLMQSHYEGWWTHKSF
FT                   LDLALVVERERIRYHNNNTSRVLVEVFTIINIINNIYETLDVELVLLGVEMWNERNHVQ
FT                   VRSIEELLDEFCMWKARSLNFRIPNDIAHIFVNHEFGIYLGLAYIGSVCVPSHNCGVDR
FT                   LLGGNLFYFGRIIAHEMGHNLGMEHDSSSCTCGTKICLMAPADNGIPKFSNCSYSYYWA
FT                   TYATAKCMRKEKKSKGILRGKLCGDGVVDDGEQCDCGSAKSCADDPCCKPSCTLKDGAA
FT                   CAFGLCCLYCQIMPAGTVCRQEVNECDLPEWCNGHSHKCPNDVYLLDGSPCRDGGYCYE
FT                   KRCNNRDEQCKQIFGKEARSADHSCYRELNTQGDRFGNCGVIRDAYLRCHDPDILCGRV
FT                   QCENVAHIPFLRDHSTVHWTHLNGVTCWGTDYHFGMTIPDIGIVKDGTDCGPEHVCINK
FT                   KCVSKSIWRSQCSPKTCNMKGVCNNLHHCHCNLGWDPPHCLKSGLGGSIDSGPPNYTEN
FT                   YTEKKHKKSIGLVILFWILFACFSVLFIVFLFFLRSYVELPMSEEPKVPTPENKEDTNE
FT                   VMNTETE"
FT   assembly_gap    7719923..7719942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7723046..7723743
FT                   /estimated_length=698
FT                   /gap_type="unknown"
FT   gene            7731304..7732762
FT                   /pseudo
FT                   /locus_tag="mCG_1042869"
FT                   /note="gene_id=mCG1042869.1"
FT   mRNA            7731304..7732762
FT                   /pseudo
FT                   /locus_tag="mCG_1042869"
FT                   /note="gene_id=mCG1042869.1 transcript_id=mCT160573.1
FT                   created on 22-AUG-2002"
FT   assembly_gap    7733132..7733151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7734557..7734576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7735906..7735925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7739388..7740099
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   gene            complement(7749999..7751078)
FT                   /pseudo
FT                   /locus_tag="mCG_140940"
FT                   /note="gene_id=mCG140940.0"
FT   mRNA            complement(7749999..7751078)
FT                   /pseudo
FT                   /locus_tag="mCG_140940"
FT                   /note="gene_id=mCG140940.0 transcript_id=mCT172377.0
FT                   created on 22-AUG-2002"
FT   gene            7754200..7758251
FT                   /locus_tag="mCG_63082"
FT                   /note="gene_id=mCG63082.2"
FT   mRNA            join(7754200..7754297,7755749..7758251)
FT                   /locus_tag="mCG_63082"
FT                   /product="mCG63082"
FT                   /note="gene_id=mCG63082.2 transcript_id=mCT63265.2 created
FT                   on 22-AUG-2002"
FT   CDS             7755808..7758090
FT                   /codon_start=1
FT                   /locus_tag="mCG_63082"
FT                   /product="mCG63082"
FT                   /note="gene_id=mCG63082.2 transcript_id=mCT63265.2
FT                   protein_id=mCP26864.2"
FT                   /protein_id="EDL35509.1"
FT                   /translation="MQTTQRASSFAATEDNIAMDKAVVYTRIPHLYLWLEILNILSSWL
FT                   LTGYAQHTSLPEVVIPLRVTGNRPMWAMGWLTYSLHFGGQKHFIHIKAKKFLVSRLFSV
FT                   FTYTKQGALHKDQPYVQNDCYYHGHMDGDPESMVAITTCYGGFQGILQINGTVYEIKPK
FT                   NLSSTFEHLVHKMDSEETELLPMRCALTEEIAKQMKRQQNENPTLMQNHYEEWWTHRSF
FT                   LDLALVVDCERIRYHNNNKSHVLVEVFLIISLINKIYFALDIEVVLIGLELWNEGNLVP
FT                   VDRMQILLEEFCVWKTLSLNIRIPNDIAHLFVNHSFGKFLGLAYVGTVCLPSHNCGVDR
FT                   LLGPNLFQFAHIIAHEMGHNLGMEHDSSSCTCGGINYCLMSSTYSFNPEFSNCSYSNFW
FT                   TTYATTNCLRKEKMSIGNLQIQFCGNGVVDDGEQCDCGDRHMCERDQCCNSRCALNDGA
FT                   ACAFGLCCLYCQIMPAGTVCRQEVNECDLPEWCNGHSHKCPNDVYLLDGSPCRDGGYCY
FT                   EKRCNNRDEQCKQIFGKEARSADHSCYRELNTQGDRFGNCGMIRDAYLRCHDPDILCGR
FT                   VQCENVTRIPFLRDHSTVHWTHLNGVTCWGTDYHFGMTIPDIGIVKDGTDCGPEHVCIN
FT                   KKCVSKPIWLEQCSSKTCTMKGVCNNLHHCHCNRGWDPPHCLESGFGGSVDSGPPPGEE
FT                   ESQQHMDLVLITPILSIVSLVFLLPWLLNRYIRTSSKFEEPTVSTSKEEEESHVASNES
FT                   EAQQVET"
FT   assembly_gap    7773040..7773059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7788796..7789020
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   assembly_gap    7800279..7800356
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            complement(7812977..7817297)
FT                   /pseudo
FT                   /locus_tag="mCG_17735"
FT                   /note="gene_id=mCG17735.2"
FT   mRNA            complement(join(7812977..7813299,7813489..7813884,
FT                   7816850..7817297))
FT                   /pseudo
FT                   /locus_tag="mCG_17735"
FT                   /note="gene_id=mCG17735.2 transcript_id=mCT15657.1 created
FT                   on 22-AUG-2002"
FT   gene            7817452..7818617
FT                   /pseudo
FT                   /locus_tag="mCG_52109"
FT                   /note="gene_id=mCG52109.2"
FT   mRNA            7817452..7818617
FT                   /pseudo
FT                   /locus_tag="mCG_52109"
FT                   /note="gene_id=mCG52109.2 transcript_id=mCT52292.2 created
FT                   on 22-AUG-2002"
FT   gene            7835330..7878410
FT                   /gene="Slc7a2"
FT                   /locus_tag="mCG_17734"
FT                   /note="gene_id=mCG17734.2"
FT   mRNA            join(7835330..7835432,7859592..7859983,7860686..7860841,
FT                   7863123..7863288,7864968..7865101,7866029..7866251,
FT                   7868592..7868731,7871670..7871772,7873168..7873373,
FT                   7874651..7874817,7875608..7875716,7877025..7878410)
FT                   /gene="Slc7a2"
FT                   /locus_tag="mCG_17734"
FT                   /product="solute carrier family 7 (cationic amino acid
FT                   transporter, y+ system), member 2, transcript variant
FT                   mCT170817"
FT                   /note="gene_id=mCG17734.2 transcript_id=mCT170817.0 created
FT                   on 19-JUL-2002"
FT   assembly_gap    7852881..7853217
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    7854865..7854884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(7858904..7859351,7859544..7859983,7860686..7860841,
FT                   7863123..7863288,7864968..7865101,7866029..7866251,
FT                   7868934..7869070,7871670..7871772,7873168..7873373,
FT                   7874651..7874817,7875608..7875716,7877025..7878410)
FT                   /gene="Slc7a2"
FT                   /locus_tag="mCG_17734"
FT                   /product="solute carrier family 7 (cationic amino acid
FT                   transporter, y+ system), member 2, transcript variant
FT                   mCT15659"
FT                   /note="gene_id=mCG17734.2 transcript_id=mCT15659.1 created
FT                   on 19-JUL-2002"
FT   assembly_gap    7859352..7859543
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   CDS             join(7859608..7859983,7860686..7860841,7863123..7863288,
FT                   7864968..7865101,7866029..7866251,7868592..7868731,
FT                   7871670..7871772,7873168..7873373,7874651..7874817,
FT                   7875608..7875716,7877025..7877221)
FT                   /codon_start=1
FT                   /gene="Slc7a2"
FT                   /locus_tag="mCG_17734"
FT                   /product="solute carrier family 7 (cationic amino acid
FT                   transporter, y+ system), member 2, isoform CRA_b"
FT                   /note="gene_id=mCG17734.2 transcript_id=mCT170817.0
FT                   protein_id=mCP93735.0 isoform=CRA_b"
FT                   /protein_id="EDL35511.1"
FT                   /translation="MIPCRAVLTFARCLIRRKIVTLDSLEDSKLCRCLTTVDLIALGVG
FT                   STLGAGVYVLAGEVAKADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTY
FT                   VTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLNKQIGQFFKTYFKMNYTGLAE
FT                   YPDFFAVCLVLLLAGLLSFGVKESAWVNKFFTAINILVLLFVMVAGFVKGNVANWKISE
FT                   EFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEV
FT                   RNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVRWGPAKYV
FT                   VAAGSLCALSTSLLGSIFPMPRVIYAMAEDGLLFKCLAQINSKTKTPVIATLSSGAVAA
FT                   VMAFLFDLKALVDMMSIGTLMAYSLVAACVLILRYQPGLCYEQPKYTPEKETLESCTNA
FT                   TLKSESQVTMLQGQGFSLRTLFSPSALPTRQSASLVSFLVGFLAFLILGLSILTTYGVQ
FT                   AIARLEAWSLALLALFLVLCVAVILTIWRQPQNQQKVAFMVPFLPFLPAFSILVNIYLM
FT                   VQLSADTWIRFSIWMALGFLIYFAYGIRHSLEGNPRDEEDDEDAFSENINVATEEKSVM
FT                   QANDHHQRNLSLPFILHEKTSEC"
FT   CDS             join(7859608..7859983,7860686..7860841,7863123..7863288,
FT                   7864968..7865101,7866029..7866251,7868934..7869070,
FT                   7871670..7871772,7873168..7873373,7874651..7874817,
FT                   7875608..7875716,7877025..7877221)
FT                   /codon_start=1
FT                   /gene="Slc7a2"
FT                   /locus_tag="mCG_17734"
FT                   /product="solute carrier family 7 (cationic amino acid
FT                   transporter, y+ system), member 2, isoform CRA_a"
FT                   /note="gene_id=mCG17734.2 transcript_id=mCT15659.1
FT                   protein_id=mCP3776.2 isoform=CRA_a"
FT                   /protein_id="EDL35510.1"
FT                   /translation="MIPCRAVLTFARCLIRRKIVTLDSLEDSKLCRCLTTVDLIALGVG
FT                   STLGAGVYVLAGEVAKADSGPSIVVSFLIAALASVMAGLCYAEFGARVPKTGSAYLYTY
FT                   VTVGELWAFITGWNLILSYVIGTSSVARAWSGTFDELLNKQIGQFFKTYFKMNYTGLAE
FT                   YPDFFAVCLVLLLAGLLSFGVKESAWVNKFFTAINILVLLFVMVAGFVKGNVANWKISE
FT                   EFLKNISASAREPPSENGTSIYGAGGFMPYGFTGTLAGAATCFYAFVGFDCIATTGEEV
FT                   RNPQKAIPIGIVTSLLVCFMAYFGVSAALTLMMPYYLLDEKSPLPVAFEYVRWGPAKYV
FT                   VAAGSLCALSTSLLGSMFPLPRILFAMARDGLLFRFLARVSKRQSPVAATMTAGVISAV
FT                   MAFLFDLKALVDMMSIGTLMAYSLVAACVLILRYQPGLCYEQPKYTPEKETLESCTNAT
FT                   LKSESQVTMLQGQGFSLRTLFSPSALPTRQSASLVSFLVGFLAFLILGLSILTTYGVQA
FT                   IARLEAWSLALLALFLVLCVAVILTIWRQPQNQQKVAFMVPFLPFLPAFSILVNIYLMV
FT                   QLSADTWIRFSIWMALGFLIYFAYGIRHSLEGNPRDEEDDEDAFSENINVATEEKSVMQ
FT                   ANDHHQRNLSLPFILHEKTSEC"
FT   assembly_gap    7863319..7863348
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7881255..7881312
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            7889338..7947796
FT                   /gene="Pdgfrl"
FT                   /locus_tag="mCG_17726"
FT                   /note="gene_id=mCG17726.3"
FT   mRNA            join(7889338..7889540,7901213..7901510,7935889..7936040,
FT                   7942559..7942852,7945834..7945973,7947344..7947796)
FT                   /gene="Pdgfrl"
FT                   /locus_tag="mCG_17726"
FT                   /product="platelet-derived growth factor receptor-like"
FT                   /note="gene_id=mCG17726.3 transcript_id=mCT15461.3 created
FT                   on 13-JUN-2003"
FT   CDS             join(7889486..7889540,7901213..7901510,7935889..7936040,
FT                   7942559..7942852,7945834..7945973,7947344..7947532)
FT                   /codon_start=1
FT                   /gene="Pdgfrl"
FT                   /locus_tag="mCG_17726"
FT                   /product="platelet-derived growth factor receptor-like"
FT                   /note="gene_id=mCG17726.3 transcript_id=mCT15461.3
FT                   protein_id=mCP3768.1"
FT                   /protein_id="EDL35512.1"
FT                   /translation="MKFWLLLGLLLLHEALEDVAGQHSPKNKRPKEQGENRIKPTNKKA
FT                   KPKIPKVKDRDSTDSTAKSQSIMMQAMGNGRFQRPAATVSLLAGQTLELRCKGSKVEWS
FT                   YPAYLDTFKDSRLTVKQSERYGQLTLVNSTAADTGEFSCWEQLCNGYICRRDEAKTGST
FT                   YIFFTEKGELFVPSPSYFDVVYLNPDRQAVVPCRVTAPSAKVTLHREFPAKEIPANGTD
FT                   IVYDMKRGFVYLQPHSDHQGVVYCKAEAGGKSQISVKYQLLYVEVPSGPPSTTILASSN
FT                   KVRGGDDISVLCTVLGEPDVEVEFRWLFPGQKDERPVTIQDTWRLIHRGLGHTTRISQS
FT                   VIIVEDFETIDAGYYICTAQNLRGQTTVATTVEFS"
FT   assembly_gap    7897573..7897940
FT                   /estimated_length=368
FT                   /gap_type="unknown"
FT   assembly_gap    7904329..7904478
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    7931576..7931595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7932852..7932871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7940484..7941863
FT                   /estimated_length=1380
FT                   /gap_type="unknown"
FT   gene            complement(7947939..8095569)
FT                   /gene="Mtus1"
FT                   /locus_tag="mCG_140942"
FT                   /note="gene_id=mCG140942.0"
FT   mRNA            complement(join(7947939..7950655,7951557..7951654,
FT                   7955349..7955465,7956439..7956534,7956646..7956719,
FT                   7957764..7957869,7959316..7959530,7973745..7973811,
FT                   7980712..7980926,8006427..8006465,8008504..8008635,
FT                   8015366..8015443,8035178..8035373,8041480..8043706,
FT                   8095337..8095569))
FT                   /gene="Mtus1"
FT                   /locus_tag="mCG_140942"
FT                   /product="mitochondrial tumor suppressor 1"
FT                   /note="gene_id=mCG140942.0 transcript_id=mCT172378.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(7950442..7950655,7951557..7951654,
FT                   7955349..7955465,7956439..7956534,7956646..7956719,
FT                   7957764..7957869,7959316..7959530,7973745..7973811,
FT                   7980712..7980926,8006427..8006465,8008504..8008635,
FT                   8015366..8015443,8035178..8035373,8041480..8043543))
FT                   /codon_start=1
FT                   /gene="Mtus1"
FT                   /locus_tag="mCG_140942"
FT                   /product="mitochondrial tumor suppressor 1"
FT                   /note="gene_id=mCG140942.0 transcript_id=mCT172378.0
FT                   protein_id=mCP95297.0"
FT                   /protein_id="EDL35513.1"
FT                   /translation="MNDDNSDRTEDGSRYVFIRDKNSNPSEYYQTSPSAQCPSVSHGDW
FT                   NSDNPDAMVVDYEMDPAVDSSESVSLSHQCVEELAYPEPSTDFMGKHEFTMYSELTCQS
FT                   PALVNTGKPQDLHSNCDSLEAIQDEKSDPLKPCECGSDDDYASGDHPEVLELKQTYGMK
FT                   VDTANCTFIARHAIEQGQPLHAPGGLQTTVRDRNALSSSGRTPPHSSKMCVRGVNYNRE
FT                   NFENLQATPSKTLNTTFTVISDVLMQTDSPDVGVQGQNSLRNVTKEYTDGTRRGLIGEK
FT                   EVQAVTLVSDGMEVPNGSASQEFYCVSEDDPNSETHSHGPYAQQEMGQNLRGTLPNCHV
FT                   DGECPVLVPAFEKSKTRVLGSECKVTVTEDPHIDSHDNDSDIQSSTEELTLRSVSGQRG
FT                   SPYEMGWGENGGAICTDKAGCMSTPVKQPPNLSFRLEPAEVKKYNNVENGPRDAKSAPN
FT                   LKGEPTNMPKPNLGKSATKTNTTVGSKVRKTEIISYPTPNFKNIKAKVISRSVLQPKDT
FT                   SVMKDTPNPQVTGGSSPSPGPSKQLTMMNKAPRSDFKAGKKAEIPINKTHKQQFNKLIT
FT                   SQAAQVTTHSKNASLGVPRTTSATKSNQENVDKTGSPHAGSETGSVAAFFQKIKGILPV
FT                   KMKSSECLEVTYVSHIDQISPEKGEQDGEAPMEKQELGKQATNEIFESKSLLVGSAPKT
FT                   STTPGRSSSKPDSRSLRKTPGLKAKVGPTAACLRRKSESRTLGSDRALSPQRIRRVSGS
FT                   ASLICRAGSTRSVASTHSDLSAYSSDCGHAAINKYEEKPPKQAFQNGSGPLYLKPLVPR
FT                   AHSHLLKTSPKGPSRKSLFTAFNSVEKGRQKNPRSLCIQTQTAPDVLSSERTLELAQYK
FT                   TKCESQSGFILHLRQLLSRGNTKFEALTVVIQHLLSEREEALKQHKTLSQELVSLRGEL
FT                   VAASSACEKLEKARADLQTAYQEFVQKLNQQHQTDRTELENRLKDLYTAECEKLQSIYI
FT                   EEAEKYKTQLQEQFDNLNAAHETTKLEIEASHSEKVELLKKTYETSLSEIKKSHEMEKK
FT                   SLEDLLNEKQESLEKQINDLKSENDALNERLKSEEQKQLSREKANSKNPQVMYLEQELE
FT                   SLKAVLEIKNEKLHQQDMKLMKMEKLVDNNTALVDKLKRFQQENEELKARMDKHMAISR
FT                   QLSTEQAALQESLEKESKVNKRLSMENEELLWKLHNGDLCSPKRSPTSSAIPFQSPRNS
FT                   GSFSSPSISPR"
FT   assembly_gap    7962072..7962091
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7963187..7963206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7966948..7967088
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    7968106..7968125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7975834..>7978942
FT                   /locus_tag="mCG_144912"
FT                   /note="gene_id=mCG144912.0"
FT   mRNA            join(7975834..7976186,7977831..>7978942)
FT                   /locus_tag="mCG_144912"
FT                   /product="mCG144912"
FT                   /note="gene_id=mCG144912.0 transcript_id=mCT184336.0
FT                   created on 20-JUN-2003"
FT   CDS             7978628..7978942
FT                   /codon_start=1
FT                   /locus_tag="mCG_144912"
FT                   /product="mCG144912"
FT                   /note="gene_id=mCG144912.0 transcript_id=mCT184336.0
FT                   protein_id=mCP106290.0"
FT                   /protein_id="EDL35514.1"
FT                   /translation="MIGSGVLKGTVCVWPLPFSFSFSLCLFVCLSVSLCLFRFLSVLLS
FT                   CCFSLSLSLSLSLSHSCSLSLVYNGVSHYLHHLFPVRMFCLTQKQWTQKKKTWILQKGS
FT                   "
FT   assembly_gap    7995430..7995449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8007388..8007407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8014822..8014841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8037168..8037220
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    8052964..8052983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8054984..8055003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8056085..8056104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8070406..8070425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8084103..8084238
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    8116292..8116311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8126471..8126853
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    8128436..8128455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8147617..8147636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8148471..8171158)
FT                   /gene="Fgl1"
FT                   /locus_tag="mCG_17732"
FT                   /note="gene_id=mCG17732.2"
FT   mRNA            complement(join(8148471..8148716,8153864..8154051,
FT                   8154220..8154308,8156524..8156621,8157317..8157476,
FT                   8166267..8166453,8166995..8167074,8171094..8171158))
FT                   /gene="Fgl1"
FT                   /locus_tag="mCG_17732"
FT                   /product="fibrinogen-like protein 1"
FT                   /note="gene_id=mCG17732.2 transcript_id=mCT15656.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(8148557..8148716,8153864..8154051,
FT                   8154220..8154308,8156524..8156621,8157317..8157476,
FT                   8166267..8166453,8166995..8167057))
FT                   /codon_start=1
FT                   /gene="Fgl1"
FT                   /locus_tag="mCG_17732"
FT                   /product="fibrinogen-like protein 1"
FT                   /note="gene_id=mCG17732.2 transcript_id=mCT15656.2
FT                   protein_id=mCP3771.2"
FT                   /protein_id="EDL35515.1"
FT                   /translation="MGKIYSFVLVAIALMMGREGWALESENCLREQVRLRAQVHQLETR
FT                   VKQQQTMIAQLLHEKEVQFLDKGSENSFIDLGGKKQYADCSEIYNDGFKQSGFYKIKPL
FT                   QSLAEFSVYCDMSDGGGWTVIQRRSDGSENFNRGWNDYENGFGNFVQNNGEYWLGNKNI
FT                   NLLTIQGDYTLKIDLTDFEKNSSFAQYQSFKVGDKKSFYELNIGEYSGTAGDSLSGTFH
FT                   PEVQWWASHQRMKFSTWDRDNDNYQGNCAEEEQSGWWFNRCHSANLNGVYYRGSYRAET
FT                   DNGVVWYTWHGWWYSLKSVVMKIRPSDFIPNII"
FT   assembly_gap    8148727..8149268
FT                   /estimated_length=542
FT                   /gap_type="unknown"
FT   assembly_gap    8186343..8187276
FT                   /estimated_length=934
FT                   /gap_type="unknown"
FT   gene            8188924..8284798
FT                   /gene="Pcm1"
FT                   /locus_tag="mCG_17738"
FT                   /note="gene_id=mCG17738.2"
FT   mRNA            join(8188924..8189115,8206851..8206965,8208650..8208895,
FT                   8209896..8210165,8211867..8212037,8212216..8212332,
FT                   8218054..8218231,8221315..8221424,8223278..8223494,
FT                   8225131..8225329,8226025..8226198,8226683..8226837,
FT                   8226956..8227182,8230780..8230922,8231051..8231180,
FT                   8233608..8233748,8234582..8234772,8236995..8237192,
FT                   8238716..8238935,8239043..8239188,8239642..8239832,
FT                   8241733..8241904,8244472..8244830,8254959..8255123,
FT                   8260264..8260436,8260753..8260884,8262864..8262984,
FT                   8264012..8264170,8264555..8264691,8266643..8266777,
FT                   8272598..8272795,8275698..8275760,8276007..8276142,
FT                   8276570..8276730,8278297..8278369,8279540..8279796,
FT                   8281397..8281489,8281570..8281684,8282757..8284798)
FT                   /gene="Pcm1"
FT                   /locus_tag="mCG_17738"
FT                   /product="pericentriolar material 1, transcript variant
FT                   mCT170818"
FT                   /note="gene_id=mCG17738.2 transcript_id=mCT170818.0 created
FT                   on 19-JUL-2002"
FT   mRNA            join(8188924..8189115,8206851..8206965,8208650..8208895,
FT                   8209896..8210165,8211867..8212037,8218054..8218231,
FT                   8221315..8221424,8223278..8223494,8225131..8225329,
FT                   8226025..8226198,8226683..8226837,8226956..8227182,
FT                   8230780..8230922,8231051..8231180,8233608..8233748,
FT                   8234582..8234772,8236995..8237192,8238716..8238935,
FT                   8239043..8239188,8239642..8239832,8241733..8241904,
FT                   8244472..8244830,8254959..8255123,8260264..8260436,
FT                   8260753..8260884,8262864..8262984,8264012..8264170,
FT                   8264555..8264691,8266643..8266777,8272598..8272795,
FT                   8275698..8275760,8276007..8276142,8276570..8276730,
FT                   8278297..8278369,8279540..8279796,8281397..8281489,
FT                   8281570..8281684,8282757..8284798)
FT                   /gene="Pcm1"
FT                   /locus_tag="mCG_17738"
FT                   /product="pericentriolar material 1, transcript variant
FT                   mCT15660"
FT                   /note="gene_id=mCG17738.2 transcript_id=mCT15660.2 created
FT                   on 19-JUL-2002"
FT   assembly_gap    8189549..8189568
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8191410..>8193964)
FT                   /locus_tag="mCG_145545"
FT                   /note="gene_id=mCG145545.0"
FT   mRNA            complement(join(8191410..8191703,8193092..8193567,
FT                   8193803..>8193964))
FT                   /locus_tag="mCG_145545"
FT                   /product="mCG145545"
FT                   /note="gene_id=mCG145545.0 transcript_id=mCT184969.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(8191501..8191703,8193092..>8193191))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145545"
FT                   /product="mCG145545"
FT                   /note="gene_id=mCG145545.0 transcript_id=mCT184969.0
FT                   protein_id=mCP106296.0"
FT                   /protein_id="EDL35518.1"
FT                   /translation="HPHLNSAGTRQRNSAHTYMQTKHTINVCVCVCVFFFFKTVSGSIG
FT                   QASPKFLILLSQLPNSWDYRYMSLAWLFLKQHGRSNFRFLLKRDACMMHTYIHTH"
FT   assembly_gap    8193037..8193056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(8206870..8206965,8208650..8208895,8209896..8210165,
FT                   8211867..8212037,8212216..8212332,8218054..8218231,
FT                   8221315..8221424,8223278..8223494,8225131..8225329,
FT                   8226025..8226198,8226683..8226837,8226956..8227182,
FT                   8230780..8230922,8231051..8231180,8233608..8233748,
FT                   8234582..8234772,8236995..8237192,8238716..8238935,
FT                   8239043..8239188,8239642..8239832,8241733..8241904,
FT                   8244472..8244830,8254959..8255123,8260264..8260436,
FT                   8260753..8260884,8262864..8262984,8264012..8264170,
FT                   8264555..8264691,8266643..8266777,8272598..8272795,
FT                   8275698..8275760,8276007..8276142,8276570..8276730,
FT                   8278297..8278369,8279540..8279796,8281397..8281489,
FT                   8281570..8281684,8282757..8282782)
FT                   /codon_start=1
FT                   /gene="Pcm1"
FT                   /locus_tag="mCG_17738"
FT                   /product="pericentriolar material 1, isoform CRA_a"
FT                   /note="gene_id=mCG17738.2 transcript_id=mCT170818.0
FT                   protein_id=mCP93736.0 isoform=CRA_a"
FT                   /protein_id="EDL35516.1"
FT                   /translation="MATGGGPFEEVMHDQDLPNWSNDSVDDRLNNMEWGGQQKKANRSS
FT                   EKNKKKFGVASDKRVTNAISPESSPGVGRRRTKIPHTFPHSRYMTQMSVPEQAELEKLK
FT                   QRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQINTNKSKDATASLPKR
FT                   EMTTSAQCKELFASALSNDLLQNCQVSEEDGRGEPAMESSQIVSRLVQIRDYITKASSM
FT                   REDLVEKNERSANVERLTHLIEHLKEQEKSYMKFLQKILARENEEEDVRTVDSAVGSGS
FT                   VAESTSLNADVQSEASDTTARDPQQEPMEETENLKKQHDLLKRMLQQQEQLRALQGRQA
FT                   ALLALQHKAEQAIAVMDDSVVTETTGSLSGVSITSELNEELNDLIQRFHNQLRDSQPPA
FT                   VPDNRRQAESLSLTREISQSRNPSVSEHLPDEKVQLFSKMRVLQEKKQKMDKLLGELHN
FT                   LRDQHLNNSSFVPSTSLQRSGDKRSSTVALSAPVGFASAVNGEANSLISSVPCPATSLV
FT                   SQNESENEGHLNPAEKLQKLNEVQKRLNELRELVHYYEQTSDMMTDAVNENTKDEETEE
FT                   SEYDSEHENSEPVTNIRNPQVASTWNEVNTNSNTQCGSNNRDGRPVNSNCEINNRSAAN
FT                   IRALNMPPLDCRYNREGEQRLHVAHGEDEEEEVEEEGVSGASLSSRRSSLVDEAPEDEE
FT                   FEQKISRLMAAKEKLKQLQDLVAMVQDDDATQVVVPAASNLDDFYAAEEDIKQNSNNAR
FT                   ENSNKIDTGVNEKTREKFYEAKLQQQQRELKQLQEERKKLIEIQEKIQAVQKACPDLQL
FT                   SATSISSGPTKKYLPAITSTPTVNENDSSTSKCVIDPEDSSVVDNELWSDMRRHEMLRE
FT                   ELRQRRKQLEALMAEHQRRQGLAETSSPVAISLRSDGSENLCTPQQSRTEKTMATWGGS
FT                   TQCALDEEGDEDGYLSEGIVRTDEEEEEEQDASSNDNFPIYPPSMNQNSYNVKETKTRW
FT                   KSNRPVSADGNYRPLAKTRQQNISMQRQENLRWVSELSYIEEKEQWQEQINQLKKQLDF
FT                   SVNICQTLMQDQQTLSCLLQTLLTGPYSVLPSNVASPQVHLIMHQLNQCYTQLTWQQNN
FT                   VQRLKQMLTELMRQQNQHPEKPRSKERGSSASHPSSPNLFCPFSFPTQPVNLFNLPGFT
FT                   NFPSFAPGMNFSPLFPSNFGDFSQNVSTPTEQQQPLAQNPSGKTEYMAFPKPFESSSSL
FT                   GAEKQRNQKQPEEEAENTKTPWLYDQEGGVEKPFFKTGFTESVEKATNSNRKNQPDTSR
FT                   RRRQFDEESLESFSSMPDPIDPTTVTKTFKTRKASAQASLASKDKTPKSKSKKRNSTQL
FT                   KSRVKNIGYESASVSSTCEPCKNRNRHSAQTEEPVQAKLFSRKNHEQLEKIIKYSRSAE
FT                   ISSETGSDFSMFEALRDTIYSEVATLISQNESRPHFLIELFHELQLLNTDYLRQRALYA
FT                   LQDIVSRHISESDEREGENVKPVNSGTWVASNSELTPSESLVTTDDETFEKNFERETHK
FT                   VSEQNDADNVSVMSVSSNFEPFATDDLGNTVIHLDQALARMREYERMKTETESHSNMRC
FT                   TCRVIEDEDGAAAAATVSNSEETPIIENHNSPQPISDVSAVPCPRIDTQQLDRQIKAIM
FT                   KEVIPFLKEHMDEVCSSQLLTSVRRMVLTLTQQNDESKEFVKFFHKQLGSILQDSLAKF
FT                   AGRKLKDCGEDLLVEISEVLFNELAFFKLMQDLDNNSIAVKQRCKRKIEAAGVRQSYAK
FT                   EAKRILEGDHGSPAGEIDDEDKDKDETETVKQTQTSEVYDAKGPKNVRSDVSDQEEDEE
FT                   SERCPVSINLSKAESQALTNYGSGEDENEDEEMEDFEESPVDVQTSLQANTETTEENEH
FT                   DSQILQHDLEKTPESTNVPSDQEPTSKNDQDSSPVKPCYLNILENEQQLNSATHKDSLT
FT                   TTDSSKQPEPLPLPLAASETLVPRVKEVKSAQETPESSLAGSPDTESPVLVNDYEAESG
FT                   NISQKSDEEDFVKVEDLPLKLTVYSEEELRKKMIEEEQKNHLSGEICEMQTEELAGNSQ
FT                   ILKEPETVGAQSI"
FT   CDS             join(8206870..8206965,8208650..8208895,8209896..8210165,
FT                   8211867..8212037,8218054..8218231,8221315..8221424,
FT                   8223278..8223494,8225131..8225329,8226025..8226198,
FT                   8226683..8226837,8226956..8227182,8230780..8230922,
FT                   8231051..8231180,8233608..8233748,8234582..8234772,
FT                   8236995..8237192,8238716..8238935,8239043..8239188,
FT                   8239642..8239832,8241733..8241904,8244472..8244830,
FT                   8254959..8255123,8260264..8260436,8260753..8260884,
FT                   8262864..8262984,8264012..8264170,8264555..8264691,
FT                   8266643..8266777,8272598..8272795,8275698..8275760,
FT                   8276007..8276142,8276570..8276730,8278297..8278369,
FT                   8279540..8279796,8281397..8281489,8281570..8281684,
FT                   8282757..8282782)
FT                   /codon_start=1
FT                   /gene="Pcm1"
FT                   /locus_tag="mCG_17738"
FT                   /product="pericentriolar material 1, isoform CRA_b"
FT                   /note="gene_id=mCG17738.2 transcript_id=mCT15660.2
FT                   protein_id=mCP3779.1 isoform=CRA_b"
FT                   /db_xref="GOA:B2RSW8"
FT                   /db_xref="InterPro:IPR024138"
FT                   /db_xref="MGI:MGI:1277958"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSW8"
FT                   /protein_id="EDL35517.1"
FT                   /translation="MATGGGPFEEVMHDQDLPNWSNDSVDDRLNNMEWGGQQKKANRSS
FT                   EKNKKKFGVASDKRVTNAISPESSPGVGRRRTKIPHTFPHSRYMTQMSVPEQAELEKLK
FT                   QRINFSDLDQRSIGSDSQGRATAANNKRQLSENRKPFNFLPMQINTNKSKDATASLPKR
FT                   EMTTSAQCKELFASALSNDLLQNCQVSEEDGRGEPAMESSQIVSRLVQIRDYITKASSM
FT                   REDLVEKNERSANVERLTHLIEHLKEQEKSYMKFLQKILARDPQQEPMEETENLKKQHD
FT                   LLKRMLQQQEQLRALQGRQAALLALQHKAEQAIAVMDDSVVTETTGSLSGVSITSELNE
FT                   ELNDLIQRFHNQLRDSQPPAVPDNRRQAESLSLTREISQSRNPSVSEHLPDEKVQLFSK
FT                   MRVLQEKKQKMDKLLGELHNLRDQHLNNSSFVPSTSLQRSGDKRSSTVALSAPVGFASA
FT                   VNGEANSLISSVPCPATSLVSQNESENEGHLNPAEKLQKLNEVQKRLNELRELVHYYEQ
FT                   TSDMMTDAVNENTKDEETEESEYDSEHENSEPVTNIRNPQVASTWNEVNTNSNTQCGSN
FT                   NRDGRPVNSNCEINNRSAANIRALNMPPLDCRYNREGEQRLHVAHGEDEEEEVEEEGVS
FT                   GASLSSRRSSLVDEAPEDEEFEQKISRLMAAKEKLKQLQDLVAMVQDDDATQVVVPAAS
FT                   NLDDFYAAEEDIKQNSNNARENSNKIDTGVNEKTREKFYEAKLQQQQRELKQLQEERKK
FT                   LIEIQEKIQAVQKACPDLQLSATSISSGPTKKYLPAITSTPTVNENDSSTSKCVIDPED
FT                   SSVVDNELWSDMRRHEMLREELRQRRKQLEALMAEHQRRQGLAETSSPVAISLRSDGSE
FT                   NLCTPQQSRTEKTMATWGGSTQCALDEEGDEDGYLSEGIVRTDEEEEEEQDASSNDNFP
FT                   IYPPSMNQNSYNVKETKTRWKSNRPVSADGNYRPLAKTRQQNISMQRQENLRWVSELSY
FT                   IEEKEQWQEQINQLKKQLDFSVNICQTLMQDQQTLSCLLQTLLTGPYSVLPSNVASPQV
FT                   HLIMHQLNQCYTQLTWQQNNVQRLKQMLTELMRQQNQHPEKPRSKERGSSASHPSSPNL
FT                   FCPFSFPTQPVNLFNLPGFTNFPSFAPGMNFSPLFPSNFGDFSQNVSTPTEQQQPLAQN
FT                   PSGKTEYMAFPKPFESSSSLGAEKQRNQKQPEEEAENTKTPWLYDQEGGVEKPFFKTGF
FT                   TESVEKATNSNRKNQPDTSRRRRQFDEESLESFSSMPDPIDPTTVTKTFKTRKASAQAS
FT                   LASKDKTPKSKSKKRNSTQLKSRVKNIGYESASVSSTCEPCKNRNRHSAQTEEPVQAKL
FT                   FSRKNHEQLEKIIKYSRSAEISSETGSDFSMFEALRDTIYSEVATLISQNESRPHFLIE
FT                   LFHELQLLNTDYLRQRALYALQDIVSRHISESDEREGENVKPVNSGTWVASNSELTPSE
FT                   SLVTTDDETFEKNFERETHKVSEQNDADNVSVMSVSSNFEPFATDDLGNTVIHLDQALA
FT                   RMREYERMKTETESHSNMRCTCRVIEDEDGAAAAATVSNSEETPIIENHNSPQPISDVS
FT                   AVPCPRIDTQQLDRQIKAIMKEVIPFLKEHMDEVCSSQLLTSVRRMVLTLTQQNDESKE
FT                   FVKFFHKQLGSILQDSLAKFAGRKLKDCGEDLLVEISEVLFNELAFFKLMQDLDNNSIA
FT                   VKQRCKRKIEAAGVRQSYAKEAKRILEGDHGSPAGEIDDEDKDKDETETVKQTQTSEVY
FT                   DAKGPKNVRSDVSDQEEDEESERCPVSINLSKAESQALTNYGSGEDENEDEEMEDFEES
FT                   PVDVQTSLQANTETTEENEHDSQILQHDLEKTPESTNVPSDQEPTSKNDQDSSPVKPCY
FT                   LNILENEQQLNSATHKDSLTTTDSSKQPEPLPLPLAASETLVPRVKEVKSAQETPESSL
FT                   AGSPDTESPVLVNDYEAESGNISQKSDEEDFVKVEDLPLKLTVYSEEELRKKMIEEEQK
FT                   NHLSGEICEMQTEELAGNSQILKEPETVGAQSI"
FT   gene            complement(8291443..8324496)
FT                   /gene="Asah1"
FT                   /locus_tag="mCG_17727"
FT                   /note="gene_id=mCG17727.2"
FT   mRNA            complement(join(8291443..8292480,8293685..8293741,
FT                   8294315..8294438,8294526..8294657,8296904..8296985,
FT                   8297093..8297147,8297728..8297872,8298885..8298930,
FT                   8300352..8300426,8302683..8302761,8304792..8304878,
FT                   8305607..8305697,8310806..8310852,8324281..8324496))
FT                   /gene="Asah1"
FT                   /locus_tag="mCG_17727"
FT                   /product="N-acylsphingosine amidohydrolase 1, transcript
FT                   variant mCT15462"
FT                   /note="gene_id=mCG17727.2 transcript_id=mCT15462.1 created
FT                   on 19-JUL-2002"
FT   CDS             complement(join(8292391..8292480,8293685..8293741,
FT                   8294315..8294438,8294526..8294657,8296904..8296985,
FT                   8297093..8297147,8297728..8297872,8298885..8298930,
FT                   8300352..8300426,8302683..8302761,8304792..8304878,
FT                   8305607..8305697,8310806..8310852,8324281..8324355))
FT                   /codon_start=1
FT                   /gene="Asah1"
FT                   /locus_tag="mCG_17727"
FT                   /product="N-acylsphingosine amidohydrolase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17727.2 transcript_id=mCT15462.1
FT                   protein_id=mCP3772.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q78P93"
FT                   /db_xref="InterPro:IPR016699"
FT                   /db_xref="InterPro:IPR029130"
FT                   /db_xref="InterPro:IPR029132"
FT                   /db_xref="MGI:MGI:1277124"
FT                   /db_xref="UniProtKB/TrEMBL:Q78P93"
FT                   /protein_id="EDL35519.1"
FT                   /translation="MRGQSLLTWVLAAAVTCAQAQDVPPWTEDCRKSTYPPSGPTYRGP
FT                   VPWHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMI
FT                   GSLPDPFGEEMRGIADVTGIPLGEIISFNIFYELFTMCTSIITEDEKGHLLHGRNMDFG
FT                   IFLGWNINNNTWVVTEELKPLTVNLDFQRNNKTVFKATSFVGYVGMLTGFKPGLFSLSL
FT                   NERFSINGGYLGILEWMFGRKDAQWVGFITRSVLENTTSYEEAKNTLTKTKIMAPVYFI
FT                   LGGKKSGEGCVITRERKESLDVYELDPKHGRWYVVQTNYDRWKNTLFIDDRRTPAKKCL
FT                   NHTTQKNLSFATIYDVLSTKPVLNKLTVFTTLMDVTKGQFESHLRDCPDPCIGW"
FT   mRNA            complement(join(<8297119..8297147,8297728..8297872,
FT                   8298885..8298930,8302683..8302761,8304792..8304878,
FT                   8305607..8305697,8310806..8310852,8324281..>8324351))
FT                   /gene="Asah1"
FT                   /locus_tag="mCG_17727"
FT                   /product="N-acylsphingosine amidohydrolase 1, transcript
FT                   variant mCT193318"
FT                   /note="gene_id=mCG17727.2 transcript_id=mCT193318.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<8297119..8297147,8297728..8297872,
FT                   8298885..8298930,8302683..8302761,8304792..8304878,
FT                   8305607..8305697,8310806..8310852,8324281..>8324349))
FT                   /codon_start=1
FT                   /gene="Asah1"
FT                   /locus_tag="mCG_17727"
FT                   /product="N-acylsphingosine amidohydrolase 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG17727.2 transcript_id=mCT193318.0
FT                   protein_id=mCP114288.0 isoform=CRA_c"
FT                   /protein_id="EDL35521.1"
FT                   /translation="GQSLLTWVLAAAVTCAQAQDVPPWTEDCRKSTYPPSGPTYRGPVP
FT                   WHTINLDLPPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGS
FT                   LPDPFGEEMRGIADVTGIPLGHLLHGRNMDFGIFLGWNINNNTWVVTEELKPLTVNLDF
FT                   QRNNKTVFKATSFVGYVGMLTGFKPGLFSLSLNER"
FT   mRNA            complement(join(<8297774..8297872,8298885..8298930,
FT                   8300352..8300426,8302683..8302761,8304792..8304878,
FT                   8305607..8305697,8310806..8310852,8324277..>8324381))
FT                   /gene="Asah1"
FT                   /locus_tag="mCG_17727"
FT                   /product="N-acylsphingosine amidohydrolase 1, transcript
FT                   variant mCT193317"
FT                   /note="gene_id=mCG17727.2 transcript_id=mCT193317.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<8297774..8297872,8298885..8298930,
FT                   8300352..8300426,8302683..8302761,8304792..8304878,
FT                   8305607..8305697,8310806..8310852,8324277..>8324321))
FT                   /codon_start=1
FT                   /gene="Asah1"
FT                   /locus_tag="mCG_17727"
FT                   /product="N-acylsphingosine amidohydrolase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17727.2 transcript_id=mCT193317.0
FT                   protein_id=mCP114287.0 isoform=CRA_b"
FT                   /protein_id="EDL35520.1"
FT                   /translation="PRQSPAPRHRMCRRWWTEDCRKSTYPPSGPTYRGPVPWHTINLDL
FT                   PPYKRWHELLAQKAPALRILVNSITSLVNTFVPSGKLMKMVDQKLPGMIGSLPDPFGEE
FT                   MRGIADVTGIPLGEIISFNIFYELFTMCTSIITEDEKGHLLHGRNMDFGIFLGWNINNN
FT                   TWVVTEELKPLTVNLDFQRNNKTVFKA"
FT   gene            complement(8347080..8366871)
FT                   /gene="Frg1"
FT                   /locus_tag="mCG_17728"
FT                   /note="gene_id=mCG17728.2"
FT   mRNA            complement(join(8347080..8347248,8348716..8348826,
FT                   8349324..8349415,8350544..8350648,8357406..8357520,
FT                   8360027..8360084,8360982..8361107,8364518..8364588,
FT                   8366625..8366871))
FT                   /gene="Frg1"
FT                   /locus_tag="mCG_17728"
FT                   /product="FSHD region gene 1"
FT                   /note="gene_id=mCG17728.2 transcript_id=mCT15652.1 created
FT                   on 19-JUL-2002"
FT   CDS             complement(join(8347212..8347248,8348716..8348826,
FT                   8349324..8349415,8350544..8350648,8357406..8357520,
FT                   8360027..8360084,8360982..8361107,8364518..8364588,
FT                   8366625..8366686))
FT                   /codon_start=1
FT                   /gene="Frg1"
FT                   /locus_tag="mCG_17728"
FT                   /product="FSHD region gene 1"
FT                   /note="gene_id=mCG17728.2 transcript_id=mCT15652.1
FT                   protein_id=mCP3774.1"
FT                   /db_xref="GOA:Q78P92"
FT                   /db_xref="InterPro:IPR008999"
FT                   /db_xref="InterPro:IPR010414"
FT                   /db_xref="MGI:MGI:893597"
FT                   /db_xref="UniProtKB/TrEMBL:Q78P92"
FT                   /protein_id="EDL35522.1"
FT                   /translation="MAEYSYVKSTKLVLKGTKAKSKKKKSKDKKRKREEDEETQLDIVG
FT                   IWWTVSNFGEISGTIAIEMDKGAYIHALDNGLFTLGAPHREVDEGPSPPEQFTAVKLSD
FT                   SRIALKSGYGKYLGINSDGLVVGRSDAIGPREQWEPVFQDGKMALLASNSCFIRCNEAG
FT                   DIEAKNKTAGEEEMIKIRSCAERETKKKDDIPEEDKGSVKQCEINYVKKFQSFQDHKLK
FT                   ISKEDSKILKKARKDGFLHETLLDRRAKLKADRYCK"
FT   assembly_gap    8380171..8380190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8382658..8382677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8383779..8383798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8392660..8392679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8395381..8395400
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8412172..8412191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8426559..8426578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8443091..8443110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8444248..8447023
FT                   /estimated_length=2776
FT                   /gap_type="unknown"
FT   assembly_gap    8450403..8450422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8453470..8453489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8455261..8459554
FT                   /estimated_length=4294
FT                   /gap_type="unknown"
FT   assembly_gap    8461548..8461567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8462969..8465871
FT                   /estimated_length=2903
FT                   /gap_type="unknown"
FT   assembly_gap    8467120..8467139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8468624..8468643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8469740..8469759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8487316..8487335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8515038..8515057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8541949..8541968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8551356..8552600)
FT                   /pseudo
FT                   /locus_tag="mCG_17729"
FT                   /note="gene_id=mCG17729.1"
FT   mRNA            complement(8551356..8552600)
FT                   /pseudo
FT                   /locus_tag="mCG_17729"
FT                   /note="gene_id=mCG17729.1 transcript_id=mCT15653.2 created
FT                   on 19-JUL-2002"
FT   assembly_gap    8553468..8553779
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    8558151..8558170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8558916..8558935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8561086..8562802
FT                   /estimated_length=1717
FT                   /gap_type="unknown"
FT   assembly_gap    8583972..8585611
FT                   /estimated_length=1640
FT                   /gap_type="unknown"
FT   assembly_gap    8593298..8593860
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    8595054..8595144
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    8602184..8606652
FT                   /estimated_length=4469
FT                   /gap_type="unknown"
FT   assembly_gap    8620383..8620421
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    8623217..8624128
FT                   /estimated_length=912
FT                   /gap_type="unknown"
FT   assembly_gap    8625107..8626361
FT                   /estimated_length=1255
FT                   /gap_type="unknown"
FT   assembly_gap    8627804..8627823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8649967..8649986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8670620..8670639
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8673129..8674227
FT                   /estimated_length=1099
FT                   /gap_type="unknown"
FT   assembly_gap    8682196..8682215
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8686456..8686475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8690546..8691075
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    8694329..8694594
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    8699258..8699309
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    8712577..8712596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8713854..8713873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8715170..8715610
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   assembly_gap    8721488..8721507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8730386..8730405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8742744..8742763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8762739..8762758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8763979..8763998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8765070..8765089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8766198..8766618
FT                   /estimated_length=421
FT                   /gap_type="unknown"
FT   assembly_gap    8769706..8769725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8770783..8777101
FT                   /estimated_length=6319
FT                   /gap_type="unknown"
FT   assembly_gap    8780326..8780345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8781620..8783387
FT                   /estimated_length=1768
FT                   /gap_type="unknown"
FT   gene            8792785..9014273
FT                   /locus_tag="mCG_1042816"
FT                   /note="gene_id=mCG1042816.1"
FT   mRNA            join(8792785..8792988,8844580..8844647,8846560..8846634,
FT                   9001229..9001318,9012693..9012927,9013675..9014273)
FT                   /locus_tag="mCG_1042816"
FT                   /product="mCG1042816"
FT                   /note="gene_id=mCG1042816.1 transcript_id=mCT160520.1
FT                   created on 11-SEP-2002"
FT   assembly_gap    8794193..8794237
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    8812600..8812619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8813727..8813746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8816161..8816180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8820936..8820955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8832524..8838785
FT                   /estimated_length=6262
FT                   /gap_type="unknown"
FT   assembly_gap    8875999..8879222
FT                   /estimated_length=3224
FT                   /gap_type="unknown"
FT   gene            8888714..8892277
FT                   /pseudo
FT                   /locus_tag="mCG_1042789"
FT                   /note="gene_id=mCG1042789.0"
FT   mRNA            join(8888714..8889153,8891121..8892277)
FT                   /pseudo
FT                   /locus_tag="mCG_1042789"
FT                   /note="gene_id=mCG1042789.0 transcript_id=mCT160493.1
FT                   created on 22-AUG-2002"
FT   assembly_gap    8901870..8901889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8902950..8902969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8904921..8904940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8915306..8947214
FT                   /estimated_length=31909
FT                   /gap_type="unknown"
FT   assembly_gap    8949770..8949789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8952569..8959644
FT                   /estimated_length=7076
FT                   /gap_type="unknown"
FT   assembly_gap    8961858..8961877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8966117..8966886
FT                   /estimated_length=770
FT                   /gap_type="unknown"
FT   assembly_gap    8970176..8970195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8972903..8972922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8973959..8973978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8979259..8979278
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8986251..8986419
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    8995997..8996016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8997800..8997819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(9001265..9001318,9012693..9012923)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042816"
FT                   /product="mCG1042816"
FT                   /note="gene_id=mCG1042816.1 transcript_id=mCT160520.1
FT                   protein_id=mCP59966.0"
FT                   /protein_id="EDL35523.1"
FT                   /translation="MLDYPARGTVGRWLDTSEEILTFLGRTFSSVMMSLVDKTHKTTKS
FT                   NHVCGFSTCSTCFIAKEFLSLCTFKDHHTEQARRDTSVSKKEALKHTAL"
FT   assembly_gap    9006995..9007123
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    9014437..9014456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9017338..9017380
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    9018501..9019057
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    9027392..9027411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9029324..9029343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9031993..9032012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9038059..9038298
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   gene            complement(9048373..9052715)
FT                   /gene="Zfp352"
FT                   /locus_tag="mCG_64584"
FT                   /note="gene_id=mCG64584.1"
FT   mRNA            complement(9048373..9052715)
FT                   /gene="Zfp352"
FT                   /locus_tag="mCG_64584"
FT                   /product="zinc finger protein 352"
FT                   /note="gene_id=mCG64584.1 transcript_id=mCT64767.2 created
FT                   on 11-SEP-2002"
FT   CDS             complement(9050604..9052253)
FT                   /codon_start=1
FT                   /gene="Zfp352"
FT                   /locus_tag="mCG_64584"
FT                   /product="zinc finger protein 352"
FT                   /note="gene_id=mCG64584.1 transcript_id=mCT64767.2
FT                   protein_id=mCP26869.1"
FT                   /protein_id="EDL35524.1"
FT                   /translation="MAENTGASKPRPCNTQPSPTESSQLVSGQSSEILTSKQTVMASAS
FT                   CSTQESTYTQNSTAYPAKAIGFHFGEPFENTSLNQQVVSAEQKISPAGFHHMQLNGTPK
FT                   TFLPPQKTTRVDTRETFYNEDYWMRTLNSDKTLLVQNTAMCENQRVTFDNHQIALYGSH
FT                   ASQDPNVGHIFASEHDWTSYDSQMTTRNGGHLTLYGSQMTAPSYSQTLHPNQIITSFSE
FT                   QNYFEDQQSNLAVNNGFYEDQVILPNGYQAFYEPQMRANFDQTNDQMKSFSGQNVCKSQ
FT                   ENLLSGECSLSGYQTSGYRCDQDLIVNPQVPSPIGGQPLSDFQIQTSSFDTTLPGSKRT
FT                   RSSAEDNLACPLETSPRSEETFYLGQMRTSVDQNVYPSQNGTPNIKESLDRKVISFSLQ
FT                   APYVGEYSYSSHSPLIQKQPQKNSSASSLVQRQHPEMKLDFKTQSPVSQKNPSPLKLYF
FT                   CTYEGCTKFYNRAYHLKEHQKKHTCVRKYRCDEPGCTWSFFRLRDLNRHREKHSGERPY
FT                   ACPMCSTNYSRLVYLKKHLEKKHAHAQPTTAT"
FT   assembly_gap    9066731..9066750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9071239..9072962
FT                   /estimated_length=1724
FT                   /gap_type="unknown"
FT   assembly_gap    9074607..9074896
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    9091085..9120992
FT                   /estimated_length=29908
FT                   /gap_type="unknown"
FT   assembly_gap    9125374..9125432
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    9127210..9127498
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    9131526..9131545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9145561..9145580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9149371..9149517
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    9172112..9172131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9173789..9173808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9174865..9174884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9176297..9176316
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9178056..9178075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9186135..9186207
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    9190764..9190952
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    9207179..9210563
FT                   /estimated_length=3385
FT                   /gap_type="unknown"
FT   assembly_gap    9212659..9218261
FT                   /estimated_length=5603
FT                   /gap_type="unknown"
FT   assembly_gap    9221513..9224245
FT                   /estimated_length=2733
FT                   /gap_type="unknown"
FT   assembly_gap    9225614..9228176
FT                   /estimated_length=2563
FT                   /gap_type="unknown"
FT   assembly_gap    9229665..9229684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9230982..9231186
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    9232185..9233045
FT                   /estimated_length=861
FT                   /gap_type="unknown"
FT   assembly_gap    9242369..9242388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9250681..9250700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9251775..9251794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9252910..9252929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9294063..9294082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9322908..9324040
FT                   /estimated_length=1133
FT                   /gap_type="unknown"
FT   assembly_gap    9325615..9325634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9327091..9327110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9330389..9330408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9331776..9331795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9335419..9335438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9337055..9337074
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9338863..9338882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9339922..9339941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9351720..9373108
FT                   /estimated_length=21389
FT                   /gap_type="unknown"
FT   assembly_gap    9398030..9398049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9402042..9402084
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    9427405..9427424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9429287..9429306
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9432546..9432565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9445253..9446471
FT                   /estimated_length=1219
FT                   /gap_type="unknown"
FT   assembly_gap    9452488..9452507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9485021..9485040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9521629..9522118
FT                   /estimated_length=490
FT                   /gap_type="unknown"
FT   assembly_gap    9530621..9530640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9555230..9556141
FT                   /estimated_length=912
FT                   /gap_type="unknown"
FT   assembly_gap    9557662..9557681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9558803..9560622
FT                   /estimated_length=1820
FT                   /gap_type="unknown"
FT   assembly_gap    9563463..9563482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9564750..9564769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9567345..9567364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9571251..9572117
FT                   /estimated_length=867
FT                   /gap_type="unknown"
FT   assembly_gap    9584200..9584465
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    9594558..9594625
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    9595509..9598011
FT                   /estimated_length=2503
FT                   /gap_type="unknown"
FT   assembly_gap    9605891..9605910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9619301..9619320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9635148..9635171
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    9645412..9645683
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    9685983..9686002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9694954..9694973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9707469..9707627
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    9712085..9712104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9714112..9714131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9715643..9715662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9726160..9726477
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    9733459..9733575
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    9769282..9770067
FT                   /estimated_length=786
FT                   /gap_type="unknown"
FT   assembly_gap    9783493..9785729
FT                   /estimated_length=2237
FT                   /gap_type="unknown"
FT   assembly_gap    9801370..9804841
FT                   /estimated_length=3472
FT                   /gap_type="unknown"
FT   assembly_gap    9813943..9818362
FT                   /estimated_length=4420
FT                   /gap_type="unknown"
FT   assembly_gap    9822774..9822793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9824040..9824059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9825498..9825517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9830723..9830742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9834313..9834332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9835433..9835452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9879407..9879426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9880538..9880557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9882171..9882190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9884086..9884193
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    9885502..9885521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9893341..9894913
FT                   /estimated_length=1573
FT                   /gap_type="unknown"
FT   assembly_gap    9896664..9897237
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    9903649..9903668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9921014..9921033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9922179..9922198
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9925457..9927568
FT                   /estimated_length=2112
FT                   /gap_type="unknown"
FT   assembly_gap    9931639..9935695
FT                   /estimated_length=4057
FT                   /gap_type="unknown"
FT   assembly_gap    9938609..9938628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9940049..9940068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9941133..9941152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9943340..9943359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9944572..9947564
FT                   /estimated_length=2993
FT                   /gap_type="unknown"
FT   assembly_gap    9950543..9950562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9960775..9961620
FT                   /estimated_length=846
FT                   /gap_type="unknown"
FT   assembly_gap    9962875..9967892
FT                   /estimated_length=5018
FT                   /gap_type="unknown"
FT   assembly_gap    9970652..9970671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9985637..9985656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9987423..9987442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9989024..9989043
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9990585..9990604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9991625..9991644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9993126..9993145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9994490..9994509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10003493..10003667
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    10036231..10036250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10040121..10040176
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    10053202..10053348
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    10057507..10058676
FT                   /estimated_length=1170
FT                   /gap_type="unknown"
FT   assembly_gap    10059759..10059778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10061800..10068409
FT                   /estimated_length=6610
FT                   /gap_type="unknown"
FT   assembly_gap    10071905..10076983
FT                   /estimated_length=5079
FT                   /gap_type="unknown"
FT   assembly_gap    10080231..10080250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10082062..10082392
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    10083935..10083954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10088400..10088419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10090714..10090733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10091950..10091969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10093015..10093670
FT                   /estimated_length=656
FT                   /gap_type="unknown"
FT   assembly_gap    10097422..10097441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10098794..10098813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10100046..10100065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10106152..10112245
FT                   /estimated_length=6094
FT                   /gap_type="unknown"
FT   assembly_gap    10113458..10113477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10119379..10119398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10120650..10120669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10122652..10122671
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10135930..10136276
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   gene            complement(10138393..10149652)
FT                   /gene="BC050188"
FT                   /locus_tag="mCG_52104"
FT                   /note="gene_id=mCG52104.2"
FT   mRNA            complement(join(10138393..10139341,10146765..10146995,
FT                   10148825..10148920,10149149..10149652))
FT                   /gene="BC050188"
FT                   /locus_tag="mCG_52104"
FT                   /product="cDNA sequence BC050188, transcript variant
FT                   mCT173186"
FT                   /note="gene_id=mCG52104.2 transcript_id=mCT173186.0 created
FT                   on 11-SEP-2002"
FT   mRNA            complement(join(10138393..10139274,10144476..10144603,
FT                   10146765..10146995,10148825..10148920,10149149..10149652))
FT                   /gene="BC050188"
FT                   /locus_tag="mCG_52104"
FT                   /product="cDNA sequence BC050188, transcript variant
FT                   mCT52287"
FT                   /note="gene_id=mCG52104.2 transcript_id=mCT52287.2 created
FT                   on 11-SEP-2002"
FT   mRNA            complement(join(<10138736..10139274,10144476..10144573,
FT                   10144737..10144759,10146765..10146995,10148825..10148920,
FT                   10149149..>10149574))
FT                   /gene="BC050188"
FT                   /locus_tag="mCG_52104"
FT                   /product="cDNA sequence BC050188, transcript variant
FT                   mCT193320"
FT                   /note="gene_id=mCG52104.2 transcript_id=mCT193320.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(10138736..10139341,10146765..10146995,
FT                   10148825..10148920,10149149..10149574))
FT                   /codon_start=1
FT                   /gene="BC050188"
FT                   /locus_tag="mCG_52104"
FT                   /product="cDNA sequence BC050188, isoform CRA_a"
FT                   /note="gene_id=mCG52104.2 transcript_id=mCT173186.0
FT                   protein_id=mCP96105.0 isoform=CRA_a"
FT                   /protein_id="EDL35525.1"
FT                   /translation="MSNHEKMSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLMC
FT                   LLKSWEEHNTPLSCPECWRTLGAPHFQANERLGRLANIGRQLRSQVLQSEDEQSICGRM
FT                   PGPSWVFSDDEQSVINVSPPSQGTNKACFSSEAEEQHKEKLQDIINILRKKKKEVQAIL
FT                   NHEKERVMLCKEETKTCKQVVVSEYMKMHQFLKEEEQLQLQLLEREEKANMKKLRENEI
FT                   QLTQQIRRLGKMIGRIESTCQNLTLESFEVKINIFGRLPRMSKDWFSSLLAADITLDPA
FT                   TANAYLLLSEDLKSVRYGGTRQQLPDNPERFDQSATVLGAQIFTCGRHYWEVEVGKKTE
FT                   WEVGICKDSVNRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVHKVGVFL
FT                   DYDSGHIAFYNATDESLIYSFPPTPFHEALRPIFSPCLPNEGTNTDPLIICHI"
FT   CDS             complement(join(10138736..10139274,10144476..10144573,
FT                   10144737..10144759,10146765..10146995,10148825..10148920,
FT                   10149149..10149574))
FT                   /codon_start=1
FT                   /gene="BC050188"
FT                   /locus_tag="mCG_52104"
FT                   /product="cDNA sequence BC050188, isoform CRA_b"
FT                   /note="gene_id=mCG52104.2 transcript_id=mCT193320.0
FT                   protein_id=mCP114292.0 isoform=CRA_b"
FT                   /db_xref="GOA:B2RUL3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR001870"
FT                   /db_xref="InterPro:IPR003877"
FT                   /db_xref="InterPro:IPR003879"
FT                   /db_xref="InterPro:IPR006574"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="MGI:MGI:2687279"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUL3"
FT                   /protein_id="EDL35526.1"
FT                   /translation="MSNHEKMSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLMC
FT                   LLKSWEEHNTPLSCPECWRTLGAPHFQANERLGRLANIGRQLRSQVLQSEDEQSICGRM
FT                   PGPSWVFSDDEQSVINVSPPSQGTNKACFSSEAEEQHKEKLQDIINILRKKKKEVQAIL
FT                   NHEKERVMLCKEETKTCKQVVVSEYMKMHQFLKEEEQLQLQLLEREEKANMKKLRENEI
FT                   QLTQQIRRLGKMIGRIESTCQNLTLESFEEVKGAMDRYESLLFQSPEATITELSLCHIT
FT                   GMREMLRKFSTDITLDPATANAYLLLSEDLKSVRYGGTRQQLPDNPERFDQSATVLGAQ
FT                   IFTCGRHYWEVEVGKKTEWEVGICKDSVNRKGNLPKPPGDLFSLIGLKIGDDYSLWVSS
FT                   PLKGQHVREPVHKVGVFLDYDSGHIAFYNATDESLIYSFPPTPFHEALRPIFSPCLPNE
FT                   GTNTDPLIICHI"
FT   CDS             complement(join(10144595..10144603,10146765..10146995,
FT                   10148825..10148920,10149149..10149574))
FT                   /codon_start=1
FT                   /gene="BC050188"
FT                   /locus_tag="mCG_52104"
FT                   /product="cDNA sequence BC050188, isoform CRA_c"
FT                   /note="gene_id=mCG52104.2 transcript_id=mCT52287.2
FT                   protein_id=mCP42297.2 isoform=CRA_c"
FT                   /protein_id="EDL35527.1"
FT                   /translation="MSNHEKMSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLMC
FT                   LLKSWEEHNTPLSCPECWRTLGAPHFQANERLGRLANIGRQLRSQVLQSEDEQSICGRM
FT                   PGPSWVFSDDEQSVINVSPPSQGTNKACFSSEAEEQHKEKLQDIINILRKKKKEVQAIL
FT                   NHEKERVMLCKEETKTCKQVVVSEYMKMHQFLKEEEQLQLQLLEREEKANMKKLRENEI
FT                   QLTQQIRRLGKMIGRIESTCQNLTLESFERE"
FT   gene            complement(10149861..10154462)
FT                   /locus_tag="mCG_1051090"
FT                   /note="gene_id=mCG1051090.0"
FT   mRNA            complement(join(10149861..10150197,10150239..10150725,
FT                   10153082..10154462))
FT                   /locus_tag="mCG_1051090"
FT                   /product="mCG1051090"
FT                   /note="gene_id=mCG1051090.0 transcript_id=mCT194879.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    10151543..10151562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10153051..10153070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(10153550..10153738)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051090"
FT                   /product="mCG1051090"
FT                   /note="gene_id=mCG1051090.0 transcript_id=mCT194879.0
FT                   protein_id=mCP115908.0"
FT                   /protein_id="EDL35528.1"
FT                   /translation="MKLIKKDNYLFGRGKCNGTIVGIESRRCPSPNSKSECGLYDALQL
FT                   NCETCSKTPSRLGYELH"
FT   assembly_gap    10154463..10155983
FT                   /estimated_length=1521
FT                   /gap_type="unknown"
FT   assembly_gap    10158338..10158357
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10159544..10159563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10161506..10166794
FT                   /pseudo
FT                   /locus_tag="mCG_51673"
FT                   /note="gene_id=mCG51673.2"
FT   mRNA            join(10161506..10163092,10163834..10165488,
FT                   10165798..10166794)
FT                   /pseudo
FT                   /locus_tag="mCG_51673"
FT                   /note="gene_id=mCG51673.2 transcript_id=mCT51856.2 created
FT                   on 11-SEP-2002"
FT   assembly_gap    10165603..10165684
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    10183186..10183205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10194860..10194879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10200252..10201061
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   gene            10203824..10204381
FT                   /pseudo
FT                   /locus_tag="mCG_141113"
FT                   /note="gene_id=mCG141113.0"
FT   mRNA            10203824..10204381
FT                   /pseudo
FT                   /locus_tag="mCG_141113"
FT                   /note="gene_id=mCG141113.0 transcript_id=mCT173178.0
FT                   created on 11-SEP-2002"
FT   assembly_gap    10204657..10204676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10204855..10205447
FT                   /pseudo
FT                   /locus_tag="mCG_141114"
FT                   /note="gene_id=mCG141114.0"
FT   mRNA            10204855..10205447
FT                   /pseudo
FT                   /locus_tag="mCG_141114"
FT                   /note="gene_id=mCG141114.0 transcript_id=mCT173177.0
FT                   created on 11-SEP-2002"
FT   assembly_gap    10205858..10205877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10206918..10206937
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10209345..10212990
FT                   /estimated_length=3646
FT                   /gap_type="unknown"
FT   assembly_gap    10218568..10219273
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    10226488..10226507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10247071..10249356
FT                   /estimated_length=2286
FT                   /gap_type="unknown"
FT   assembly_gap    10251316..10253656
FT                   /estimated_length=2341
FT                   /gap_type="unknown"
FT   assembly_gap    10260764..10260783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10261828..10261847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10268876..10269036
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    10271799..10271818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10290661..10290744
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            complement(10307514..10319587)
FT                   /gene="Zfp42"
FT                   /locus_tag="mCG_10211"
FT                   /note="gene_id=mCG10211.2"
FT   mRNA            complement(join(10307514..10308971,10313018..10313095,
FT                   10316862..10316945,10319468..10319587))
FT                   /gene="Zfp42"
FT                   /locus_tag="mCG_10211"
FT                   /product="zinc finger protein 42, transcript variant
FT                   mCT180409"
FT                   /note="gene_id=mCG10211.2 transcript_id=mCT180409.0 created
FT                   on 13-FEB-2003"
FT   mRNA            complement(join(10307514..10308971,10313018..10313095,
FT                   10316862..10316945,10319459..10319587))
FT                   /gene="Zfp42"
FT                   /locus_tag="mCG_10211"
FT                   /product="zinc finger protein 42, transcript variant
FT                   mCT10522"
FT                   /note="gene_id=mCG10211.2 transcript_id=mCT10522.2 created
FT                   on 13-FEB-2003"
FT   CDS             complement(10308031..10308897)
FT                   /codon_start=1
FT                   /gene="Zfp42"
FT                   /locus_tag="mCG_10211"
FT                   /product="zinc finger protein 42, isoform CRA_a"
FT                   /note="gene_id=mCG10211.2 transcript_id=mCT10522.2
FT                   protein_id=mCP21588.1 isoform=CRA_a"
FT                   /protein_id="EDL35529.1"
FT                   /translation="MNEQKMNEQMKKTAKTSGQKGPGGRALDRLTLKQDEARPVQNTRV
FT                   EAPRVTYTIRDESEISPETEEDGFPDGYLECIIRGEFSEPILEEDFLFKSFESLEEVEQ
FT                   NLSRQVLEASSLLESSLEYMTKGTKQEKTEVTQETPPLRVGASSLLAGGPAEKPEGGVY
FT                   CGVLSMLECPQAGCKKKLRGKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLVHT
FT                   GEKPYQCTFEGCGKRFSLDFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTH
FT                   AKAGKKC"
FT   CDS             complement(10308031..10308897)
FT                   /codon_start=1
FT                   /gene="Zfp42"
FT                   /locus_tag="mCG_10211"
FT                   /product="zinc finger protein 42, isoform CRA_a"
FT                   /note="gene_id=mCG10211.2 transcript_id=mCT180409.0
FT                   protein_id=mCP103331.0 isoform=CRA_a"
FT                   /protein_id="EDL35530.1"
FT                   /translation="MNEQKMNEQMKKTAKTSGQKGPGGRALDRLTLKQDEARPVQNTRV
FT                   EAPRVTYTIRDESEISPETEEDGFPDGYLECIIRGEFSEPILEEDFLFKSFESLEEVEQ
FT                   NLSRQVLEASSLLESSLEYMTKGTKQEKTEVTQETPPLRVGASSLLAGGPAEKPEGGVY
FT                   CGVLSMLECPQAGCKKKLRGKTALRKHMLVHGPRRHVCAECGKAFTESSKLKRHFLVHT
FT                   GEKPYQCTFEGCGKRFSLDFNLRTHIRIHTGERRFVCPFDGCEKSFIQSNNQKIHILTH
FT                   AKAGKKC"
FT   assembly_gap    10311386..10311405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10319588..10319759
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    10324843..10325255
FT                   /estimated_length=413
FT                   /gap_type="unknown"
FT   assembly_gap    10326298..10327103
FT                   /estimated_length=806
FT                   /gap_type="unknown"
FT   assembly_gap    10330589..10334568
FT                   /estimated_length=3980
FT                   /gap_type="unknown"
FT   assembly_gap    10337554..10337573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10342140..10342218
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    10352839..10352858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10362346..10362610
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    10366729..10366889
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    10371174..10371342
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    10391411..10393206
FT                   /estimated_length=1796
FT                   /gap_type="unknown"
FT   assembly_gap    10395199..10395218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10475893..10475912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10487248..10487274
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    10500734..10500753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10517073..10517092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10530391..10532210
FT                   /estimated_length=1820
FT                   /gap_type="unknown"
FT   gene            complement(<10532917..10541086)
FT                   /locus_tag="mCG_114742"
FT                   /note="gene_id=mCG114742.1"
FT   mRNA            complement(join(<10532917..10535068,10540938..10541086))
FT                   /locus_tag="mCG_114742"
FT                   /product="mCG114742"
FT                   /note="gene_id=mCG114742.1 transcript_id=mCT115838.1
FT                   created on 12-SEP-2002"
FT   CDS             complement(<10532917..10534911)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114742"
FT                   /product="mCG114742"
FT                   /note="gene_id=mCG114742.1 transcript_id=mCT115838.1
FT                   protein_id=mCP60015.1"
FT                   /protein_id="EDL35531.1"
FT                   /translation="MFLKFCLWTMFFFSAWSPIGHAKYSSLPEVVTPLRVTVTRGNNTS
FT                   PGWLSYSLNIGGQRHIITMKPKKNLMSRNLILLTYTQQGDLLEQRPFVPNDCYYHGYVD
FT                   EDPESLVILNTCFGSLQGTLEINGTTYEIMPKSSTSTFEHLAYKMDNGDSEPSPMRCGL
FT                   SEEEIAQQRKLRERNAPTLLQIPHENWWTHHRFIEYFVVIDHKQYVHRNNNITTCIQDM
FT                   LQIVNGVNGYYLQIDTDVVLTALEIWNEKNYINVELSIFKVLGDFCTWKQNMFGNRIRH
FT                   DIIHLLVRQGYGLYLGLAYLADVCTPYNCGVSSFLSDVMSDMAHIVAHEMGHNLGMKHD
FT                   GIGCTCGLKDCLMAPYKTNSPKFSNCSYEEMYSVVTKRSCLYDIPEALVTNLTVCGNKV
FT                   VEEGEECDCGSTESCLQDPCCSSDCVLKPGAQCAFGLCCQDCQFLKTGTVCREEKNECD
FT                   LPEWCNGTSAECPGDVYKADGIPCSGEGYCYKMECHQRDEQCRKIFGNGSRSADEICYM
FT                   EMNRRGDRFGNCGNDSSKYKICELADVLCGRIQCENVIQLPQRRNHETVHYTHFSNVTC
FT                   WTMDYHFGITIDDIGAVSDGTACAPYHICVDRKCVSKSDLVSNCTTKLCHMQGVCNNKN
FT                   HCHCTNTWEPPDCQLRGHGGSLDSGPPPLH"
FT   assembly_gap    10552296..10553956
FT                   /estimated_length=1661
FT                   /gap_type="unknown"
FT   assembly_gap    10563888..10563907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10576719..10576738
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10582002..10582175
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   gene            complement(10582329..10590749)
FT                   /locus_tag="mCG_114744"
FT                   /note="gene_id=mCG114744.1"
FT   mRNA            complement(join(10582329..10584659,10590601..10590749))
FT                   /locus_tag="mCG_114744"
FT                   /product="mCG114744"
FT                   /note="gene_id=mCG114744.1 transcript_id=mCT115840.1
FT                   created on 12-SEP-2002"
FT   CDS             complement(10582409..10584502)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114744"
FT                   /product="mCG114744"
FT                   /note="gene_id=mCG114744.1 transcript_id=mCT115840.1
FT                   protein_id=mCP60018.1"
FT                   /db_xref="GOA:Q9R158"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:105985"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9R158"
FT                   /protein_id="EDL35532.1"
FT                   /translation="MFLKFCLWTMFFFSAWSPIGHAKYSSLLEVVTPLRVTVTRGNNIS
FT                   PGWLSYSLNIGGQRHIITMKPKKNLISRNFLLFTYSDQGDLLEQHHFVQNDCYYHGYVD
FT                   EDLESPVIVNTCFGSLQGTLEINGTSYEIMPKSSTSTFEHLVYKMDSGDSESSPMRCGL
FT                   SEEETAQQTKLQESNAPTLLQIPYENWWTHHRFIEYFVVLDHKQYVHRNNNITTCIQDM
FT                   LQIVNGVNGYYLQIDTDVVLTTLEVWNEKNYINVELSIFKVLGDFCTWKQNMFGNRIRH
FT                   DIIHLLVRQGYGLYLGLAYLADVCTPYNCGVSSVLSDVMSDMAHIVAHEMGHNFGMKHD
FT                   GIGCTCGLKDCLMAPYKTNSPKFSNCSYEEMYSVVTKRSCLYDIPEALVTNLTVCGNKV
FT                   VEEGEQCDCGNSESCLQDPCCSSDCVLKPGAQCAFGLCCKNCQFLKAGTVCRKEKNECD
FT                   LPEWCNGTSAECPGDVYKADGIPCSGEGYCYKMECHQRDEQCRKIFGNGSRSADEICYM
FT                   EMNRQGDRFGNCGNDSSTYRTCQIADVLCGQIQCENVIQLPQRRNHETVHYTHFSNITC
FT                   WTMDYHFGITIDDIGAVSDGTAYAPDHICVDRKCVSKSVLVSNCSPQLYHMQGICNNKQ
FT                   HCHCGVTWKPPDCQKRGHGGSIDSGPPPLPLSHSKWIVYILIVLDVCIVIIIYLFSFYK
FT                   LSK"
FT   assembly_gap    10594475..10594564
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    10603075..10605861
FT                   /estimated_length=2787
FT                   /gap_type="unknown"
FT   assembly_gap    10607211..10607716
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    10615417..10615436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10631275..10632921)
FT                   /pseudo
FT                   /locus_tag="mCG_141118"
FT                   /note="gene_id=mCG141118.0"
FT   mRNA            complement(join(10631275..10632159,10632400..10632921))
FT                   /pseudo
FT                   /locus_tag="mCG_141118"
FT                   /note="gene_id=mCG141118.0 transcript_id=mCT173179.0
FT                   created on 12-SEP-2002"
FT   assembly_gap    10633267..10633286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10638686..10639329
FT                   /estimated_length=644
FT                   /gap_type="unknown"
FT   gene            complement(<10639330..>10641343)
FT                   /locus_tag="mCG_141117"
FT                   /note="gene_id=mCG141117.0"
FT   mRNA            complement(<10639330..>10641343)
FT                   /locus_tag="mCG_141117"
FT                   /product="mCG141117"
FT                   /note="gene_id=mCG141117.0 transcript_id=mCT173180.0
FT                   created on 12-SEP-2002"
FT   CDS             complement(<10639330..10641343)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141117"
FT                   /product="mCG141117"
FT                   /note="gene_id=mCG141117.0 transcript_id=mCT173180.0
FT                   protein_id=mCP96102.0"
FT                   /protein_id="EDL35533.1"
FT                   /translation="MFLKFCLWTMFFFSAYSPIGHAKYSSLPEVVTPLRVTVTRGNNSS
FT                   PGWLSYSLSIGGQRHIITMKPKENLISRNFLLFTYSDQGDLLEEHPFVQNDCYYHGYVD
FT                   EDPESLVIVNTCFGSLQGTLEINGTIYEIMPRSKTSTFEHLAYKMDSGESEPSPMRCGL
FT                   SEEEIAQQMNLQESNASTLLQIPYENWWTHHRFIDYFVVIDHNCYVHRNNNTTTCIQDM
FT                   LQVVNGINGYFLQIQTDVVLTKVEVWSQNNLINVEEEMSAALDAFCSWKKNAIGNRVRH
FT                   DIIHLFVRHNYVKFLGMAKLGQVCLTLNCAVNSFLTDSLSYLAFIVAHEMGHNLGMKHD
FT                   GSACTCGLHTCIMYPYAYISPKFSNCSYEEMFSVVNRRSCLYNIPDALKTITLVPTMCG
FT                   NNLVEEGEQCDCGNSESCLQDPCCSSDCVLKPGAKCAFGLCCKDCQFLQTGTVCRQEKN
FT                   ECDLPEWCNGTSGECPGDVYKADGIRCSRGGYCYKMECQRHDRQCREIFGKRSRSADEI
FT                   CYMEMNRRGDRFGNCGNDSSMYKRCELTDVLCGRIQCENVIKLPQRRNHETVHYTHFSN
FT                   NTCWTMDYHFGITIDDVGAVSDGTPCAPDHICLDRKCVSKSVLVSNCTPHLCHMQGVCN
FT                   NKHHCHCTNTWEPPDCQLHGHGGSIDSGPPPVPLSP"
FT   assembly_gap    10658656..10658675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10664486..10716181)
FT                   /gene="Adam34"
FT                   /locus_tag="mCG_141116"
FT                   /note="gene_id=mCG141116.0"
FT   mRNA            complement(join(10664486..10666903,10716027..10716181))
FT                   /gene="Adam34"
FT                   /locus_tag="mCG_141116"
FT                   /product="a disintegrin and metallopeptidase domain 34,
FT                   transcript variant mCT173183"
FT                   /note="gene_id=mCG141116.0 transcript_id=mCT173183.0
FT                   created on 20-FEB-2003"
FT   mRNA            complement(join(10664486..10666903,10705568..10705659,
FT                   10712201..10712262))
FT                   /gene="Adam34"
FT                   /locus_tag="mCG_141116"
FT                   /product="a disintegrin and metallopeptidase domain 34,
FT                   transcript variant mCT173181"
FT                   /note="gene_id=mCG141116.0 transcript_id=mCT173181.0
FT                   created on 20-FEB-2003"
FT   CDS             complement(10664639..10666783)
FT                   /codon_start=1
FT                   /gene="Adam34"
FT                   /locus_tag="mCG_141116"
FT                   /product="a disintegrin and metallopeptidase domain 34,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG141116.0 transcript_id=mCT173181.0
FT                   protein_id=mCP96099.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2RSG8"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:2181992"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSG8"
FT                   /protein_id="EDL35534.1"
FT                   /translation="MSGAKALVHKRNMFLKFCLWTMFFFSAWSSIGHAKYSSLPEVVTP
FT                   LRVTVTRGNNISPGWLSYSLNIEGQRHIITMKPKKNLISRNFLLFTYSDQGDLLEEQPF
FT                   VQNDCYYHGYVDEDPESLVIVNTCFGSLQGTLEINGTTYEIMPKSTTSTFEHLAYKMDN
FT                   GESEPSPMRCGLSEEEIAQQMKLQESNASTLLQIPYENWWTHHRFIDYFVVIDHNRYVH
FT                   RNNNTTTCIQDMLQVVNGINGYYLQIQTDVVLTKLEVWSQNNLINVEQEIRKVLGAFCN
FT                   WKINAIGNRVRHDIIHLFVRRSYGTYLGLANVGTVCLTLNCAVNSFLSDSLSDMAFIIA
FT                   HEMGHNLGMMHDGSSCTCGLSSCIMAPYKSNSPKFSNCSYEEMFSVVTKRSCLYDIPDA
FT                   LKTINLMPTMCGNNLVEEGEECDCGSTESCLQDPCCSSDCVLKPGAQCAFGLCCKNCQF
FT                   LKTGTVCREEKNECDLPEWCNGTSAECPGDVYKADGIPCSGEGYCYKMECHQRDEQCRK
FT                   IFGNGSRSADEICYMEMNRRGDRFGNCGNDSSMYRRCNLADVLCGRIQCENVIQLPQRR
FT                   NHETVHYTHFSNVTCWTTDYHFGITIDDVGAVSDGTTCGPDYLCVHRKCVSKSVLVRNC
FT                   TPQLCHMQGVCNNKDHCHCNNTWEPPDCQLRGHGGSIDSGPPPVPLSPSNWSMYFLAFI
FT                   IMYVLGFIALYGIRELKKKS"
FT   CDS             complement(10664639..10666783)
FT                   /codon_start=1
FT                   /gene="Adam34"
FT                   /locus_tag="mCG_141116"
FT                   /product="a disintegrin and metallopeptidase domain 34,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG141116.0 transcript_id=mCT173183.0
FT                   protein_id=mCP96100.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2RSG8"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:2181992"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSG8"
FT                   /protein_id="EDL35535.1"
FT                   /translation="MSGAKALVHKRNMFLKFCLWTMFFFSAWSSIGHAKYSSLPEVVTP
FT                   LRVTVTRGNNISPGWLSYSLNIEGQRHIITMKPKKNLISRNFLLFTYSDQGDLLEEQPF
FT                   VQNDCYYHGYVDEDPESLVIVNTCFGSLQGTLEINGTTYEIMPKSTTSTFEHLAYKMDN
FT                   GESEPSPMRCGLSEEEIAQQMKLQESNASTLLQIPYENWWTHHRFIDYFVVIDHNRYVH
FT                   RNNNTTTCIQDMLQVVNGINGYYLQIQTDVVLTKLEVWSQNNLINVEQEIRKVLGAFCN
FT                   WKINAIGNRVRHDIIHLFVRRSYGTYLGLANVGTVCLTLNCAVNSFLSDSLSDMAFIIA
FT                   HEMGHNLGMMHDGSSCTCGLSSCIMAPYKSNSPKFSNCSYEEMFSVVTKRSCLYDIPDA
FT                   LKTINLMPTMCGNNLVEEGEECDCGSTESCLQDPCCSSDCVLKPGAQCAFGLCCKNCQF
FT                   LKTGTVCREEKNECDLPEWCNGTSAECPGDVYKADGIPCSGEGYCYKMECHQRDEQCRK
FT                   IFGNGSRSADEICYMEMNRRGDRFGNCGNDSSMYRRCNLADVLCGRIQCENVIQLPQRR
FT                   NHETVHYTHFSNVTCWTTDYHFGITIDDVGAVSDGTTCGPDYLCVHRKCVSKSVLVRNC
FT                   TPQLCHMQGVCNNKDHCHCNNTWEPPDCQLRGHGGSIDSGPPPVPLSPSNWSMYFLAFI
FT                   IMYVLGFIALYGIRELKKKS"
FT   assembly_gap    10673261..10673990
FT                   /estimated_length=730
FT                   /gap_type="unknown"
FT   assembly_gap    10675050..10675069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10686230..10686363
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   gene            complement(10686414..10688838)
FT                   /locus_tag="mCG_141115"
FT                   /note="gene_id=mCG141115.0"
FT   mRNA            complement(10686414..10688838)
FT                   /locus_tag="mCG_141115"
FT                   /product="mCG141115"
FT                   /note="gene_id=mCG141115.0 transcript_id=mCT173182.0
FT                   created on 12-SEP-2002"
FT   CDS             complement(10686576..10688717)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141115"
FT                   /product="mCG141115"
FT                   /note="gene_id=mCG141115.0 transcript_id=mCT173182.0
FT                   protein_id=mCP96101.0"
FT                   /db_xref="GOA:Q7M765"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR006586"
FT                   /db_xref="InterPro:IPR018358"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:3647274"
FT                   /db_xref="UniProtKB/TrEMBL:Q7M765"
FT                   /protein_id="EDL35536.1"
FT                   /translation="MTGAKVLVHKRNMFLKFCLWKMLFSAYSPIGHAKYSSLPEVVIPL
FT                   RVTVTRGNNISPGWLSYSLNIGGQRHIITMKPKKNLISRNFLLFTYSDQGDLLEEQPFV
FT                   QNDCYYHGYVDEDPESLVIVNTCFGSLQGTLEINGTTYEIMPKSSTSTFEHLAYKMESG
FT                   ESEPSPMRCGLSEEEIARQMKLQESNASTLLQIPYENWWTHHRFIDYFVVIDHKRYVHR
FT                   NNNTTTCIQDMLQVVNGINGYYLQIQTDVVLTKLEVWSQNNLINVEQEMSKVLGAFCNW
FT                   KIKTIGKRVRHDIIHLFVRRSYGIYLGLAYVGTVCLTLNCAVNSFLSDSLSDMAFIIAH
FT                   EMGHNFGMMHDGSACTCGLHSCIMAPHKSNSPKFSNCSYEEMFSVVTKRSCLYDIPDAL
FT                   KTINLMPTKCGNNLVEEGEQCDCGNSESCLQDPCCSSNCVFKPGAKCAFGRCCKNCQFL
FT                   KAGTVCRQEKNECDLPEWCNGTSGECPGDVYKADGIRCSRGGYCYKMECQRHNRQCREI
FT                   FGKRSRSADEICYMEMNRRGDRFGNCGNDSSKYKICELTDVLCGRIQCENVIQLPQRRN
FT                   HETVHFTHFSNNTCWTMDYHFGITIDDVGAVSDGTPCAPDHICLDRKCVSKSVLVSNCT
FT                   PQLCHMQGVCNNKDHCHCNNTWEPPDCQLRGHGGSIDSGPPPVPLSPSNWSMYFLAFII
FT                   MYVLGFIALYGIHELRKIS"
FT   gene            complement(10712202..10714199)
FT                   /pseudo
FT                   /locus_tag="mCG_15512"
FT                   /note="gene_id=mCG15512.2"
FT   mRNA            complement(10712202..10714199)
FT                   /pseudo
FT                   /locus_tag="mCG_15512"
FT                   /note="gene_id=mCG15512.2 transcript_id=mCT17127.2 created
FT                   on 12-SEP-2002"
FT   assembly_gap    10737027..10737162
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            complement(10741998..10742561)
FT                   /pseudo
FT                   /locus_tag="mCG_1042792"
FT                   /note="gene_id=mCG1042792.1"
FT   mRNA            complement(10741998..10742561)
FT                   /pseudo
FT                   /locus_tag="mCG_1042792"
FT                   /note="gene_id=mCG1042792.1 transcript_id=mCT160496.1
FT                   created on 12-SEP-2002"
FT   assembly_gap    10750876..10750895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10808861..10809746
FT                   /estimated_length=886
FT                   /gap_type="unknown"
FT   gene            10818158..10818687
FT                   /pseudo
FT                   /locus_tag="mCG_1042820"
FT                   /note="gene_id=mCG1042820.0"
FT   mRNA            10818158..10818687
FT                   /pseudo
FT                   /locus_tag="mCG_1042820"
FT                   /note="gene_id=mCG1042820.0 transcript_id=mCT160524.1
FT                   created on 12-SEP-2002"
FT   assembly_gap    10829568..10829701
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    10837975..10837994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10843743..10843762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10890427..10890446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10930765..10932024
FT                   /estimated_length=1260
FT                   /gap_type="unknown"
FT   assembly_gap    10958750..10958769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10960063..10960082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10968948..10968972
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    10976236..10982352
FT                   /estimated_length=6117
FT                   /gap_type="unknown"
FT   assembly_gap    10985582..10985755
FT                   /estimated_length=174
FT                   /gap_type="unknown"
FT   assembly_gap    10986457..10990590
FT                   /estimated_length=4134
FT                   /gap_type="unknown"
FT   assembly_gap    11022845..11022864
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11054679..11054698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11079062..11079082
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    11224485..11226402
FT                   /estimated_length=1918
FT                   /gap_type="unknown"
FT   assembly_gap    11227404..11227525
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    11248748..11254496
FT                   /estimated_length=5749
FT                   /gap_type="unknown"
FT   assembly_gap    11260864..11261169
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    11289411..11290115
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   assembly_gap    11295378..11296101
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    11320019..11320038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11323749..11323768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11336891..11337082
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    11354836..11354985
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    11378694..11378713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11395801..11395820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11414868..11414895
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    11419970..11420014
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    11441421..11441653
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    11450501..11450625
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    11465434..11465712
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    11519032..11519051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11524647..11524835
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    11599081..11602337
FT                   /estimated_length=3257
FT                   /gap_type="unknown"
FT   gene            11603051..11606836
FT                   /locus_tag="mCG_1042887"
FT                   /note="gene_id=mCG1042887.0"
FT   mRNA            join(11603051..11603441,11606565..11606836)
FT                   /locus_tag="mCG_1042887"
FT                   /product="mCG1042887"
FT                   /note="gene_id=mCG1042887.0 transcript_id=mCT160591.0
FT                   created on 12-SEP-2002"
FT   CDS             join(11603171..11603441,11606565..11606581)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042887"
FT                   /product="mCG1042887"
FT                   /note="gene_id=mCG1042887.0 transcript_id=mCT160591.0
FT                   protein_id=mCP59853.1"
FT                   /protein_id="EDL35537.1"
FT                   /translation="MVLFISITCLYVFSSFSVRTSTCLIVFSCFSLRTCNSLAVFSCIS
FT                   LSDLLKSFLMSSTIIMRYAFKSRSRFSGVLGCPGLGEVGVLGSDDDIYKT"
FT   assembly_gap    11604310..11604329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11608829..11609665
FT                   /estimated_length=837
FT                   /gap_type="unknown"
FT   assembly_gap    11622204..11622223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11624529..11624548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11648824..11649121
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    11659826..11660379
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    11690892..11691252
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    11731907..11733114
FT                   /estimated_length=1208
FT                   /gap_type="unknown"
FT   assembly_gap    11733825..11733845
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    11760091..11760110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11828274..11828320
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    11844577..11844679
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    11858291..11858361
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    11866960..11867027
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    11870372..11870572
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    11872086..11874922
FT                   /estimated_length=2837
FT                   /gap_type="unknown"
FT   assembly_gap    11875691..11876226
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    11882773..11883169
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    11894547..11894732
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    11920681..11920700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11940467..11940581
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    11941102..11942140
FT                   /estimated_length=1039
FT                   /gap_type="unknown"
FT   assembly_gap    11945723..11945799
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    11960161..11960180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11964753..12067344
FT                   /locus_tag="mCG_141119"
FT                   /note="gene_id=mCG141119.0"
FT   mRNA            join(11964753..11968032,12003842..12004156,
FT                   12022190..12022251,12024741..12025073,12025349..12025559,
FT                   12028054..12028193,12032455..12032730,12032925..12033135,
FT                   12037894..12041961,12042574..12042770,12044546..12044699,
FT                   12045202..12045435,12046355..12046744,12048429..12048643,
FT                   12048922..12049059,12050555..12050698,12051209..12051406,
FT                   12051766..12052567,12053347..12053478,12054887..12055044,
FT                   12055621..12056083,12056967..12057120,12057296..12057406,
FT                   12059010..12059641,12060118..12060255,12065868..12067344)
FT                   /locus_tag="mCG_141119"
FT                   /product="mCG141119"
FT                   /note="gene_id=mCG141119.0 transcript_id=mCT173185.0
FT                   created on 12-SEP-2002"
FT   CDS             join(11964759..11968032,12003842..12004156,
FT                   12022190..12022251,12024741..12025073,12025349..12025559,
FT                   12028054..12028193,12032455..12032730,12032925..12033135,
FT                   12037894..12041961,12042574..12042770,12044546..12044699,
FT                   12045202..12045435,12046355..12046744,12048429..12048643,
FT                   12048922..12049059,12050555..12050698,12051209..12051406,
FT                   12051766..12052567,12053347..12053478,12054887..12055044,
FT                   12055621..12056083,12056967..12057120,12057296..12057406,
FT                   12059010..12059641,12060118..12060255,12065868..12066496)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141119"
FT                   /product="mCG141119"
FT                   /note="gene_id=mCG141119.0 transcript_id=mCT173185.0
FT                   protein_id=mCP96104.0"
FT                   /protein_id="EDL35538.1"
FT                   /translation="MGRHLTLLLLLLLFLQQFGDSDGSQRLEPTPPIQFTHFQYNVTVH
FT                   ENSAAKTYVGHPRKMGIYILDPSWEIRYKIVSGDSENLFKAEEYVLGDFCFLRIRTKGG
FT                   NTAILNREVRDHYTLIVKAVEKATDAEARAKVRVQVLDTNDLRPLFSPTSYSVSLPENT
FT                   AIRTSIARVSATDADIGTNGEFYYSFKDRTDVFAIHPTSGVVVLTGRLDFLETQLYELE
FT                   ILAADRGMKLYGSSGVSSLAKLTVHVEQANECAPIITAVTLSPSELDKDPTYAIITVED
FT                   CDQGANGEIASLSIVAGDLLQQFKTVRSFPGSKAFKVKAVGAVDWDSHPYGYNLTLQAK
FT                   DKGTPPQFSPVKVVHIISPQFRAGPVKFEMDVYRAEISEFAPPHTPVVLVKAIPSYSHL
FT                   RYVFKSAPGKPKFGLNHNTGLISILEPIRRQHTSHFELEVTTSDKRASARVVVKVLGTN
FT                   SNPPEFTQTSYKASIDENAPIGAAVTRVSAMDPDEGENGYVTYSIANLNHVPFVIDHFT
FT                   GTVSTSENLDYELMPRVYTLRIRASDWGLPYRREVEVLATITLNNLNDNTPLFERINCE
FT                   GTIPRDLGVGEQITTVSAIDADELQLVRYQIEAGNELDLFGLNPSSGVLSLKHSLTDGL
FT                   GAKVSFHSLRITATDGENFATPLYINLTVAASRKPVNLQCEETGVAKMLAEKLLQANKL
FT                   HSQGDVEDIFFDSYSVNTHTPQFGVTLPTGIEVKENLPVGANILFMNATDLDSGFNGKL
FT                   VYAISGGNDDSCFTIDMETGVLKVLSPLDREVMDKYTLNITVYDLGIPQRAAWRLLDVT
FT                   VLDANDNAPEFLQESYFVEVSEDKEVNSEIIQVEATDKDLGPSGHVTYAILTDTEKFSI
FT                   DSMTGVVKIIQPLDREVQPVHYLKIEARDQATEEPRLFSTVLLKVSLDDVNDNPPRFIP
FT                   PNYSVKVREDLPEGTIIMWLEAYDPDVGQSSQVRYSLLDHGEGHFDVDKLSGAVRIVQQ
FT                   LDFEKKQLYNLTVRAKDKGKPVSLSSTCYVEVEVVDVNENLHTPVFSSFVEKGVVKEDV
FT                   PTGSSVMTVSAHDEDTGRDGEIRYSIRDGSGIGVFRIDEETGKCVIETSDRLDRESTSH
FT                   YWLTVYATDQGVVPLSSFIEVYIEVEDVNDNAPQTSEPVYYPEIMENSPKDVSVVQIEA
FT                   FDPDSSSNDKLTYRITSGNPQGFFSIHPKTGLITTTSRKLDREQQDEHILEVTVTDNGV
FT                   PPRSTIARVIVKILDENDNRPQFLQKFYKIRLPEREKADGDRSASKREPLYRVIAADKD
FT                   EGPNAELSYSIEEGNEHGRFSIEPKTGVVSSKKFSAAGEYDILSIKAVDNGRPQKSSTT
FT                   RLHIEWISKPKPSSEPISFEESVFSFTVMESDPVAHMIGVISVEPPGMPLWFDIIGGNY
FT                   DSHFDVDKGTGTIIVAKPLDAEQKSSYNLTVEATDGTTTILTQVLIKVIDTNDHRPQFS
FT                   TSKYEVAVPEDTEPEVEILQISAVDRDEKNKLIYTLQSSIDPASLKKFRLDPATGALYT
FT                   AEKLDHEAIHQHVLTVMVRDQDVPVKRNFARIVVNVSDKNDHAPWFTSPSYDGRVYESA
FT                   AVGSVVLQVTALDKDKGRNAEVLYSIESGNIGNSFTIDPILGSIKTARELDRSHQVDYD
FT                   LMVKATDKGDPPMSEMTSVRIAVTVADNASPKFTSKEYSAEISEAIRIGSFVGMVSAHS
FT                   QSSVMYEIRDGNMGDAFNINPHSGSIITQRALDFETLPMYSLTVQGTNMAGLSTNTTVV
FT                   VHVRDENDNPPVFTQAEYSGFISESASVNSVVLTDRNVPLVIRATDADRESNALLVYQI
FT                   VEPSVHNYFAIDPTTGAIRTVLSLDYEETHAFHFTVQVHDMGTPRLFAEYAANVTVHVI
FT                   DINDCPPVFSKSLYEVSLLLPTYRGVNVITVNATDADSKAFSQVMYSITEGNIGEKFSM
FT                   DHKTGTIAIQNTTQLRSRYELTVRASDGRFTSMASVKINVKESRESPLKFTQDAYSAVV
FT                   KENSTEARTLAVITAIGNPLNEPLFYRILNPDRRFKISHTSGVLSTTGIPFDREQQETF
FT                   DVVVEVTKEHEPSAVAHVVVKVTVEDQNDNAPVFVNLPYYAVVKVDAEVGHVIRYVTAI
FT                   DRDSGRNGDIHYYLKEHHDHFQIGPSGDISLKKQFEHDTLNKEYLVTVVAKDGGSPAFS
FT                   AEVLVPITVMNKAMPVFEKAFYSAEIPENIQMHSPVVHIQANSPEGLKVFYSITDGDPF
FT                   SQFTINFNTGVVNVIAPLDFESHPAYKLSVRATDSLTGAHAEVFVDIIVEDINDNPPVF
FT                   VQPSYSTTLSEASVIGTPVLQVRATDSDSEPNRGISYQLIGNHSKSHDHFHIDSNTGLI
FT                   SLVRALDYEQSQQHRIFVRAVDGGMPALSSDVVVTVAVTDLNDNPPLFEQQVYEARISE
FT                   HAAHGHFVMCVRACDADSSDLDKLEYSILSGNDHKSFIIDRETGIITLSNLRRHTLKPF
FT                   YSLNVSVSDGVFRSSARVNVTVMGGNLHSPVFHQNEYEVELAENAPLHTLVVQVKASDR
FT                   DSGIYSHVTYHIVNDFAKDRFYVNDRGQIFTLEKLDRETPAEKVISIRLMAKDAGGKVA
FT                   FCTVNVILTDDNDNAPQFRSTKYEVNIGSSAAKGTSVVKVFASDADEGSNADVTYAIEA
FT                   DSESVKENLEINKLTGLITTKESLIGLENEFFTFFVRAVDSGSPPRESVVPVYIKILPP
FT                   EVQLPRFSEPFYTYTISEDTPIGTEIDLIRVEHGGAVLYILVKGNTPESNRDEFFVIDR
FT                   QNGRLKLEKSLDHETTKWYQFSILARCTLDDYEVVASIDVSIQVKDANDNSPVLESSPY
FT                   EAFIVENLPGGSRVIQIRASDLDSGANGQVMYSLDQSQDADIIESFAINMETGWITTLK
FT                   ELDHEERASYQIKVVASDHGEKVQLSSTAIVGVTVTDVNDSPPRFTAEIYKGTVSEDDP
FT                   PGGVIAILSTTDADTEEINRQVSYFITGGDALGQFAVENVQSDWRVYVKKPLDREQKDS
FT                   YLLTVTATDGTFSSKARVEVKVLDANDNSPVCEKTSYSDTIPEDALPGKLVMQVSATDA
FT                   DIRSNAEITYTLFGSGAEKFKLNPDTGELRTLALLDREEQAVYNLLVKATDGGGRSCQA
FT                   AIVLTLEDVNDNAPEFTAEPYTITVFENTEPGTPLTRVQATDADTGLNRKISYSLVESA
FT                   DGQFSINERSGIIQLEKHLDRELQAVYTLTLKAVDQGLPRRLTATGTVVVSVLDINDNP
FT                   PVFEYREYGASVSEDIVIGTEVLQVYAASRDIEANAEITYAIISGNEHGKFSIDSKTGA
FT                   IFIIESLDYESSHEYYLTVEATDGGTPSLSDVATVNINVTDINDNSPVFSQDTYTTVVS
FT                   EDAALEQPVITIMADDADGPSNSHIHYSIIEGNQGSPFTIDPVRGEVKVTKPLDRETIS
FT                   GYTLTVQAADNGNPPRVNTTTVNIDVSDVNDNAPLFSRDNYSVIIQENKPVGFSVLKLV
FT                   VTDKDSSHNGPPFFFTIVSGNDENAFEVNQHGVLLTAATIKRKVKDHYLLHVKVADSGK
FT                   PQLSSMTHIDIRVIEESIHPPAILPLEIFITAFGEEYSGGVIGKIHATDQDVYDTLMYS
FT                   LDPHMDGLFSVSSTGGKLIAHRKLDIGQYLLNVSVTDGKFTTVADITVHIQQVTQEMLN
FT                   HTVAIRFANLTPEEFVGDYWRNFQRALRNILGVRKNDIQIVSLQPSEPHSHLDVLLFVE
FT                   RSGGTHVSTKQLLHKINSSVTDVEEIIGVRILEVFQKLCAGLDCPWKFCDEKVSVDENV
FT                   MSTHSTARLSFVTPRHHRTAVCLCKDGTCPPVHHGCEDNPCPAGSECVADPREEKYSCV
FT                   CPGGGFGKCPGSSSITFTGNSFVKYRLLENENRLEMKLSMRLRTYSSHAVVMYARGTDY
FT                   SILEIHTGRLQYKFDCGSGPGIVSVQSIQVNDGQWHAVSLEVEGNYAKLVLDEVHTASG
FT                   TAPGALKTLNLDNYVFFGGHLRQQGTKHGRGAQVASGFRGCMDSIYLNGQELPLNNKPR
FT                   AYAHIEEWVDLSHGCLLTATEDCSSSPCQNGGVCNPSPTGGYYCKCSALYVGTFCEVSV
FT                   NPCSSNPCLYGGTCMVDNGGFVCQCRGLYTGQRCQLSPYCKDDPCKNGGTCFDSLDGAV
FT                   CQCDSGFRGERCQSDIDECAGNPCRNGALCENTHGSYHCNCSQEYRGKHCEDASPNHYV
FT                   STPWNIGLAEGIGIIVFIAGIVLLVMVFVLCRKMISRKKKRQAEPEDKRLGPTTAFLQR
FT                   PYFDSKLNKNIYSDIPPQVPVRPISYTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNP
FT                   ESMHGHRKAVAVCSVAPNLPPPPPSNSPSDSDSIQKPSWDFDYDAKVVDLDPCLSKKPL
FT                   EEKPSQPYSARESLSEVQSLSSFQSESCDDNGYHWDTSDWMPSVPLPDIQEFPNYEAID
FT                   EHTPLYSADPNAIDTDYYPGGYDIESDFPPPPEDFPAPDELPPLPPEFSDQFESIHPPR
FT                   DMPAAGSLGSSSRSRQRFNLNQYLPNFYPADMSEPQKQGAGENSPCREPYTPYPPGYQR
FT                   NFEAPTIENMPMSVYASTASCSDVSACCEVESEVMMSDYESGDDGHFEEVTIPPLDSQQ
FT                   HTEV"
FT   assembly_gap    11971161..11971180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11976376..11976402
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    11978836..11978855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12004608..12004663
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    12021758..12021777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12026022..12026230
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    12076680..12076995
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   gene            complement(12076996..12080388)
FT                   /locus_tag="mCG_1051091"
FT                   /note="gene_id=mCG1051091.0"
FT   mRNA            complement(join(12076996..12077499,12078009..12078107,
FT                   12078221..12078348,12079897..12079981,12080066..12080388))
FT                   /locus_tag="mCG_1051091"
FT                   /product="mCG1051091"
FT                   /note="gene_id=mCG1051091.0 transcript_id=mCT194880.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(12077107..12077493)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051091"
FT                   /product="mCG1051091"
FT                   /note="gene_id=mCG1051091.0 transcript_id=mCT194880.0
FT                   protein_id=mCP115909.0"
FT                   /protein_id="EDL35539.1"
FT                   /translation="MHSVVFNNTLQHPPLTRFLATGQERRNKPESSAAKALLLTSSGAR
FT                   VQESKSSIAYIFRSQSKSAREQEPEQERERKQEKEQEQESKSKRERKQEQEREKEWQNP
FT                   VPFKENYPPPRTYYSLIGCSPSAQ"
FT   assembly_gap    12079638..12079764
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    12080424..12080482
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            <12084097..12103388
FT                   /gene="Mtnr1a"
FT                   /locus_tag="mCG_20978"
FT                   /note="gene_id=mCG20978.1"
FT   mRNA            join(<12084097..12084289,12102079..12103388)
FT                   /gene="Mtnr1a"
FT                   /locus_tag="mCG_20978"
FT                   /product="melatonin receptor 1A"
FT                   /note="gene_id=mCG20978.1 transcript_id=mCT19519.0 created
FT                   on 19-JUL-2002"
FT   CDS             join(12084097..12084289,12102079..12102947)
FT                   /codon_start=1
FT                   /gene="Mtnr1a"
FT                   /locus_tag="mCG_20978"
FT                   /product="melatonin receptor 1A"
FT                   /note="gene_id=mCG20978.1 transcript_id=mCT19519.0
FT                   protein_id=mCP20364.0"
FT                   /db_xref="GOA:Q14AC3"
FT                   /db_xref="InterPro:IPR000025"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR002278"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:102967"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AC3"
FT                   /protein_id="EDL35540.1"
FT                   /translation="MKGNVSELLNATQQAPGGGEGGRPRPSWLASTLAFILIFTIVVDI
FT                   LGNLLVILSVYRNKKLRNSGNIFVVSLAVADLVVAVYPYPLVLTSILNNGWNLGYLHCQ
FT                   VSAFLMGLSVIGSIFNITGIAMNRYCYICHSLKYDKIYSNKNSLCYVFLIWMLTLIAIM
FT                   PNLQTGTLQYDPRIYSCTFTQSVSSAYTIAVVVFHFIVPMIIVIFCYLRIWVLVLQVRR
FT                   RVKPDNKPKLKPQDFRNFVTMFVVFVLFAICWAPLNLIGLIVASDPATMVPRIPEWLFV
FT                   ASYYLAYFNSCLNAIIYGLLNQNFRKEYKKIIVSLCTAKMFFVESSNEEADKIKCKPSP
FT                   LIPNNNLIKVDSV"
FT   assembly_gap    12099092..12099111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12114804..12115081
FT                   /estimated_length=278
FT                   /gap_type="unknown"
FT   assembly_gap    12122893..12122912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12126185..12126815)
FT                   /pseudo
FT                   /locus_tag="mCG_1042889"
FT                   /note="gene_id=mCG1042889.1"
FT   mRNA            complement(12126185..12126815)
FT                   /pseudo
FT                   /locus_tag="mCG_1042889"
FT                   /note="gene_id=mCG1042889.1 transcript_id=mCT160593.1
FT                   created on 13-SEP-2002"
FT   assembly_gap    12142341..12142635
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    12144111..12144130
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12145374..12145437
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    12155530..12155549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12163730..12163754
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            complement(12175462..12180144)
FT                   /locus_tag="mCG_1042890"
FT                   /note="gene_id=mCG1042890.1"
FT   mRNA            complement(join(12175462..12176020,12176422..12176487,
FT                   12179877..12180144))
FT                   /locus_tag="mCG_1042890"
FT                   /product="mCG1042890"
FT                   /note="gene_id=mCG1042890.1 transcript_id=mCT160594.1
FT                   created on 13-SEP-2002"
FT   CDS             complement(join(12175885..12176020,12176422..12176487,
FT                   12179877..12179932))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042890"
FT                   /product="mCG1042890"
FT                   /note="gene_id=mCG1042890.1 transcript_id=mCT160594.1
FT                   protein_id=mCP59871.1"
FT                   /protein_id="EDL35541.1"
FT                   /translation="MTNGGPYGKWGTHHVGRQWLGSYRMVSLRAFTTQCEKKLQSSTNI
FT                   TKSLENLLFYSNQPSNSHWIPSCAESNKPTPCHQIPACCD"
FT   assembly_gap    12186235..12186517
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    12191062..12191081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12199212..12199920
FT                   /estimated_length=709
FT                   /gap_type="unknown"
FT   assembly_gap    12207019..12207038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12211195..12211468
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   gene            complement(12255663..12276435)
FT                   /gene="F11"
FT                   /locus_tag="mCG_119843"
FT                   /note="gene_id=mCG119843.1"
FT   mRNA            complement(join(12255663..12256099,12256707..12256846,
FT                   12257356..12257451,12259980..12260155,12261099..12261258,
FT                   12262906..12263012,12263096..12263258,12263363..12263472,
FT                   12263857..12264016,12264409..12264518,12267424..12267530,
FT                   12269606..12269768,12275428..12275483,12276344..12276435))
FT                   /gene="F11"
FT                   /locus_tag="mCG_119843"
FT                   /product="coagulation factor XI, transcript variant
FT                   mCT173184"
FT                   /note="gene_id=mCG119843.1 transcript_id=mCT173184.0
FT                   created on 13-SEP-2002"
FT   mRNA            complement(join(12255663..12256099,12256707..12256846,
FT                   12257356..12257451,12259980..12260155,12261099..12261258,
FT                   12262906..12263018,12263096..12263258,12263363..12263472,
FT                   12263857..12264016,12264409..12264518,12266420..12266579,
FT                   12267424..12267530,12269606..12269768,12275428..12275483,
FT                   12276344..12276435))
FT                   /gene="F11"
FT                   /locus_tag="mCG_119843"
FT                   /product="coagulation factor XI, transcript variant
FT                   mCT121021"
FT                   /note="gene_id=mCG119843.1 transcript_id=mCT121021.1
FT                   created on 13-SEP-2002"
FT   CDS             complement(join(12255938..12256099,12256707..12256846,
FT                   12257356..12257451,12259980..12260155,12261099..12261258,
FT                   12262906..12263018,12263096..12263258,12263363..12263472,
FT                   12263857..12264016,12264409..12264518,12266420..12266579,
FT                   12267424..12267530,12269606..12269768,12275428..12275482))
FT                   /codon_start=1
FT                   /gene="F11"
FT                   /locus_tag="mCG_119843"
FT                   /product="coagulation factor XI, isoform CRA_a"
FT                   /note="gene_id=mCG119843.1 transcript_id=mCT121021.1
FT                   protein_id=mCP59959.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q91Y47"
FT                   /db_xref="InterPro:IPR000177"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR003014"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="MGI:MGI:99481"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91Y47"
FT                   /protein_id="EDL35542.1"
FT                   /translation="MTSLHQVLYFIFFASVSSECVTKVFKDISFQGGDLSTVFTPSATY
FT                   CRLVCTHHPRCLLFTFMAESSSDDPTKWFACILKDSVTEILPMVNMTGAISGYSFKQCP
FT                   QQLSTCSKDVYVNLDMKGMNYNSSVVKNARECQERCTDDAHCQFFTYATGYFPSVDHRK
FT                   MCLLKYTRTGTPTTITKLNGVVSGFSLKSCGLSNLACIRDIFPNTVLADLNIDSVVAPD
FT                   AFVCRRICTHHPTCLFFTFFSQAWPKESQRHLCLLKTSESGLPSTRITKSHALSGFSLQ
FT                   HCRHSVPVFCHPSFYNDTDFLGEELDIVDVKGQETCQKTCTNNARCQFFTYYPSHRLCN
FT                   ERNRRGRCYLKLSSNGSPTRILHGRGGISGYSLRLCKMDNVCTTKINPRVVGGAASVHG
FT                   EWPWQVTLHISQGHLCGGSIIGNQWILTAAHCFSGIETPKKLRVYGGIVNQSEINEGTA
FT                   FFRVQEMIIHDQYTTAESGYDIALLKLESAMNYTDFQRPICLPSKGDRNAVHTECWVTG
FT                   WGYTALRGEVQSTLQKAKVPLVSNEECQTRYRRHKITNKMICAGYKEGGKDTCKGDSGG
FT                   PLSCKYNGVWHLVGITSWGEGCGQKERPGVYTNVAKYVDWILEKTQTV"
FT   assembly_gap    12257515..12257911
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    12258567..12258874
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   CDS             complement(join(12264502..12264518,12267424..12267530,
FT                   12269606..12269768,12275428..12275482))
FT                   /codon_start=1
FT                   /gene="F11"
FT                   /locus_tag="mCG_119843"
FT                   /product="coagulation factor XI, isoform CRA_b"
FT                   /note="gene_id=mCG119843.1 transcript_id=mCT173184.0
FT                   protein_id=mCP96103.0 isoform=CRA_b"
FT                   /protein_id="EDL35543.1"
FT                   /translation="MTSLHQVLYFIFFASVSSECVTKVFKDISFQGGDLSTVFTPSATY
FT                   CRLVCTHHPRCLLFTFMAESSSDDPTKWFACILKDSVTEILPMVNMTGAISGYSFKQCP
FT                   QQLSIKCVF"
FT   assembly_gap    12265985..12266075
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    12283858..12283902
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   gene            complement(12283903..12348048)
FT                   /locus_tag="mCG_119836"
FT                   /note="gene_id=mCG119836.2"
FT   mRNA            complement(join(12283903..12284534,12285093..12285232,
FT                   12286757..12286852,12287917..12288092,12289851..12290019,
FT                   12290485..12290597,12290693..12290855,12291418..12291527,
FT                   12292411..12292570,12297116..12297225,12297600..12297759,
FT                   12301315..12301421,12303409..12303571,12308463..12308521,
FT                   12309131..12309421,12321270..12321495,12322767..12322946,
FT                   12323044..12323178,12324568..12324670,12330360..12330545,
FT                   12332492..12332618,12334939..12335008,12335375..12335565,
FT                   12336551..12336636,12342961..12343073,12347617..12348048))
FT                   /locus_tag="mCG_119836"
FT                   /product="mCG119836"
FT                   /note="gene_id=mCG119836.2 transcript_id=mCT121014.2
FT                   created on 05-MAY-2004"
FT   CDS             complement(join(12284343..12284534,12285093..12285232,
FT                   12286757..12286852,12287917..12288092,12289851..12290019,
FT                   12290485..12290597,12290693..12290855,12291418..12291527,
FT                   12292411..12292570,12297116..12297225,12297600..12297759,
FT                   12301315..12301421,12303409..12303571,12308463..12308521,
FT                   12309131..12309261))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119836"
FT                   /product="mCG119836"
FT                   /note="gene_id=mCG119836.2 transcript_id=mCT121014.2
FT                   protein_id=mCP59788.2"
FT                   /protein_id="EDL35544.1"
FT                   /translation="MPETQCKHWSQAKTALGAIFRGLEDHLHVKTPSPPEPQRDHPSRM
FT                   ILFNRVGYFVSLFATVSCGCMTQLYKNTFFRGGDLAAIYTPDAQYCQKMCTFHPRCLLF
FT                   SFLAVTPPKETNKRFGCFMKESITGTLPRIHRTGAISGHSLKQCGHQISACHRDIYKGL
FT                   DMRGSNFNISKTDNIEECQKLCTNNFHCQFFTYATSAFYRPEYRKKCLLKHSASGTPTS
FT                   IKSADNLVSGFSLKSCALSEIGCPMDIFQHSAFADLNVSQVITPDAFVCRTICTFHPNC
FT                   LFFTFYTNEWETESQRNVCFLKTSKSGRPSPPIPQENAISGYSLLTCRKTRPEPCHSKI
FT                   YSGVDFEGEELNVTFVQGADVCQETCTKTIRCQFFIYSLLPQDCKEEGCKCSLRLSTDG
FT                   SPTRITYGMQGSSGYSLRLCKLVDSPDCTTKINARIVGGTNASLGEWPWQVSLQVKLVS
FT                   QTHLCGGSIIGRQWVLTAAHCFDGIPYPDVWRIYGGILSLSEITKETPSSRIKELIIHQ
FT                   EYKVSEGNYDIALIKLQTPLNYTEFQKPICLPSKADTNTIYTNCWVTGWGYTKEQGETQ
FT                   NILQKATIPLVPNEECQKKYRDYVINKQMICAGYKEGGTDACKGDSGGPLVCKHSGRWQ
FT                   LVGITSWGEGCARKDQPGVYTKVSEYMDWILEKTQSSDVRALETSSA"
FT   assembly_gap    12295537..12295749
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   gene            complement(12320189..12348048)
FT                   /locus_tag="mCG_1050379"
FT                   /note="gene_id=mCG1050379.0"
FT   mRNA            complement(join(12320189..12321495,12322767..12322946,
FT                   12323044..12323178,12324568..12324670,12330360..12330545,
FT                   12332492..12332618,12334939..12335008,12335375..12335565,
FT                   12336551..12336636,12342961..12343073,12347617..12348048))
FT                   /locus_tag="mCG_1050379"
FT                   /product="mCG1050379"
FT                   /note="gene_id=mCG1050379.0 transcript_id=mCT194384.0
FT                   created on 05-MAY-2004"
FT   CDS             complement(join(12321323..12321495,12322767..12322946,
FT                   12323044..12323178,12324568..12324670,12330360..12330545,
FT                   12332492..12332618,12334939..12335008,12335375..12335565,
FT                   12336551..12336636,12342961..12343073,12347617..12347830))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050379"
FT                   /product="mCG1050379"
FT                   /note="gene_id=mCG1050379.0 transcript_id=mCT194384.0
FT                   protein_id=mCP115413.0"
FT                   /db_xref="GOA:B2RSR0"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:2142763"
FT                   /db_xref="UniProtKB/TrEMBL:B2RSR0"
FT                   /protein_id="EDL35545.1"
FT                   /translation="MLWLWLGLSGQKLLLWGAASAVSLAGATILISIFPMLVSYARKWQ
FT                   QMRSIPSVARAYPLVGHALYMKPNNAEFFQQLIYYTEEFRHLPIIKLWIGPVPLVALYK
FT                   AENVEVILTSSKQIDKSFLYKFLQPWLGLGLLTSTGSKWRTRRKMLTPTFHFTILENFL
FT                   DVMNEQANILVNKLEKHVNQEAFNCFFYITLCALDIICETAMGKNIGAQSNNDSEYVRT
FT                   VYRMSDMIYRRMKMPWLWFDLWYLVFKEGRDHKRGLKCLHTFTNNVIAERVKERKAEED
FT                   WTGAGRGPIPSKNKRKAFLDLLLSVTDEEGNRLSQEDIREEVDTFMFEGHDTTAAAINW
FT                   SLYLLGTNPEVQRKVDQELDEVFGRSHRPVTLEDLKKLKYLDCVIKETLRVFPSVPLFA
FT                   RSLSEDCEVGGYKVTKGTEAIIIPYALHRDPRYFPDPEEFRPERFFPENSQGRHPYAYV
FT                   PFSAGPRNCIGQKFAVMEEKTILACILRQFWVESNQKREELGLAGDLILRPNNGIWIKL
FT                   KRRHEDDP"
FT   assembly_gap    12329318..12329337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12334852..12334879
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   gene            complement(12353423..>12396286)
FT                   /gene="BC035537"
FT                   /locus_tag="mCG_7021"
FT                   /note="gene_id=mCG7021.2"
FT   mRNA            complement(join(12353423..12354224,12357335..12357458,
FT                   12359402..12359605,12359916..12360028,12363354..12363508,
FT                   12363863..12364053,12365309..12365479,12366571..12366696,
FT                   12368727..12368869,12370140..12370278,12370530..12370637,
FT                   12396145..>12396286))
FT                   /gene="BC035537"
FT                   /locus_tag="mCG_7021"
FT                   /product="cDNA sequence BC035537, transcript variant
FT                   mCT173187"
FT                   /note="gene_id=mCG7021.2 transcript_id=mCT173187.0 created
FT                   on 13-SEP-2002"
FT   mRNA            complement(join(12353423..12354224,12357335..12357458,
FT                   12359402..12359605,12359916..12360028,12363354..12363508,
FT                   12363863..12364011,12365309..12365479,12366571..12366696,
FT                   12368727..12368869,12370140..12370278,12370530..12370637,
FT                   12373308..>12373712))
FT                   /gene="BC035537"
FT                   /locus_tag="mCG_7021"
FT                   /product="cDNA sequence BC035537, transcript variant
FT                   mCT5802"
FT                   /note="gene_id=mCG7021.2 transcript_id=mCT5802.2 created on
FT                   13-SEP-2002"
FT   CDS             complement(join(12354183..12354224,12357335..12357458,
FT                   12359402..12359605,12359916..12360028,12363354..12363508,
FT                   12363863..12364053,12365309..12365479,12366571..12366696,
FT                   12368727..12368869,12370140..12370278,12370530..12370637,
FT                   12396145..>12396284))
FT                   /codon_start=1
FT                   /gene="BC035537"
FT                   /locus_tag="mCG_7021"
FT                   /product="cDNA sequence BC035537, isoform CRA_a"
FT                   /note="gene_id=mCG7021.2 transcript_id=mCT173187.0
FT                   protein_id=mCP96106.0 isoform=CRA_a"
FT                   /protein_id="EDL35546.1"
FT                   /translation="RQLRAPGEREPSVWMAPGPVPKTLFFTLPDIGEEWTSDSDSQDDP
FT                   EGRGLSEGLRKQSSEKSKDPLPTNFTRNVQKAIDKFASESPSSFSSSGSRTPTEAHNSW
FT                   PGSSTQSSTTGLSTERSSVSSWRDDEFDKVSAQKVHQLFWEVEELLFEGKVSPQTQNLL
FT                   AECSEWARRSLHLRVVGRQLVPPTDEGFQHFQGSLPSSATHEALPHVPDHTSSSRELCI
FT                   SGSQIVPEVHSASALTDPDGTESADLTSCSSLKEEVYHVDGNIEEYFAFDRKQDGDEHL
FT                   GQSPALRGRKRHRHGLPPISPDDCIRDAVAAEVFDHVWTNVVEILEDLIRKTWESALTG
FT                   GKKHKEKLKVAENRSPHVLMSRLSTDVCSVPPSRSSDTLQPSLAPHFNPPQFPQLHRFS
FT                   SNFYSDLSGVMTIQAKPLQQRPTYSADRTQNDQDDKLPGGGVGASSRHRLGRILDARGP
FT                   QTSVKKTPVHRRLPSIASDPQRLKTPTVYSDEILRGTKLQTGIDYLPSPAAVQTSRSRL
FT                   PPIGSETGEPNTAASGSRPVSVHSICPNLIRGQP"
FT   CDS             complement(join(12354183..12354224,12357335..12357458,
FT                   12359402..12359605,12359916..12360028,12363354..12363508,
FT                   12363863..12364011,12365309..12365479,12366571..12366696,
FT                   12368727..12368869,12370140..12370278,12370530..12370637,
FT                   12373308..>12373711))
FT                   /codon_start=1
FT                   /gene="BC035537"
FT                   /locus_tag="mCG_7021"
FT                   /product="cDNA sequence BC035537, isoform CRA_b"
FT                   /note="gene_id=mCG7021.2 transcript_id=mCT5802.2
FT                   protein_id=mCP20317.2 isoform=CRA_b"
FT                   /protein_id="EDL35547.1"
FT                   /translation="TILPTAARAEAGGRKDGRIERPRCGIQPLLDLRVRSRKPCPEPRD
FT                   PPRPWAPPAPLAPSLPARWSRTLRGFSASGARGSGLGGRGAEVPGIRGHAAALALRENG
FT                   ADNHRTVLPRPRGSRPGLWDKSQSLRLIVIGRGLSEGLRKQSSEKSKDPLPTNFTRNVQ
FT                   KAIDKFASESPSSFSSSGSRTPTEAHNSWPGSSTQSSTTGLSTERSSVSSWRDDEFDKV
FT                   SAQKVHQLFWEVEELLFEGKVSPQTQNLLAECSEWARRSLHLRVVGRQLVPPTDEGFQH
FT                   FQGSLPSSATHEALPHVPDHTSSSRELCISGSQIVPEVHSASALTDPDGTESADLTSCS
FT                   SLKEEVYHVDGNIEEYFAFDRKQEKRHRHGLPPISPDDCIRDAVAAEVFDHVWTNVVEI
FT                   LEDLIRKTWESALTGGKKHKEKLKVAENRSPHVLMSRLSTDVCSVPPSRSSDTLQPSLA
FT                   PHFNPPQFPQLHRFSSNFYSDLSGVMTIQAKPLQQRPTYSADRTQNDQDDKLPGGGVGA
FT                   SSRHRLGRILDARGPQTSVKKTPVHRRLPSIASDPQRLKTPTVYSDEILRGTKLQTGID
FT                   YLPSPAAVQTSRSRLPPIGSETGEPNTAASGSRPVSVHSICPNLIRGQP"
FT   assembly_gap    12355644..12356280
FT                   /estimated_length=637
FT                   /gap_type="unknown"
FT   assembly_gap    12360336..12360531
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    12395503..12395617
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    12396770..12398035
FT                   /estimated_length=1266
FT                   /gap_type="unknown"
FT   gene            complement(12410555..12425553)
FT                   /gene="Tlr3"
FT                   /locus_tag="mCG_7015"
FT                   /note="gene_id=mCG7015.3"
FT   mRNA            complement(join(12410555..12412031,12412260..12414112,
FT                   12415532..12415723,12417584..12418036,12423477..12423546,
FT                   12424607..12424801,12425387..>12425474))
FT                   /gene="Tlr3"
FT                   /locus_tag="mCG_7015"
FT                   /product="toll-like receptor 3, transcript variant
FT                   mCT193310"
FT                   /note="gene_id=mCG7015.3 transcript_id=mCT193310.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(12410558..12412031,12412260..12414112,
FT                   12415532..12415723,12417584..12418036,12423477..12423546,
FT                   12424607..12424789,12425387..12425553))
FT                   /gene="Tlr3"
FT                   /locus_tag="mCG_7015"
FT                   /product="toll-like receptor 3, transcript variant mCT5806"
FT                   /note="gene_id=mCG7015.3 transcript_id=mCT5806.2 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(12411803..12412031,12412260..12414112,
FT                   12415532..12415723,12417584..>12418030))
FT                   /codon_start=1
FT                   /gene="Tlr3"
FT                   /locus_tag="mCG_7015"
FT                   /product="toll-like receptor 3, isoform CRA_a"
FT                   /note="gene_id=mCG7015.3 transcript_id=mCT193310.0
FT                   protein_id=mCP114295.0 isoform=CRA_a"
FT                   /protein_id="EDL35548.1"
FT                   /translation="IMKGCSSYLMYSFGGLLSLWILLVSSTNQCTVRYNVADCSHLKLT
FT                   HIPDDLPSNITVLNLTHNQLRRLPPTNFTRYSQLAILDAGFNSISKLEPELCQILPLLK
FT                   VLNLQHNELSQISDQTFVFCTNLTELDLMSNSIHKIKSNPFKNQKNLIKLDLSHNGLSS
FT                   TKLGTGVQLENLQELLLAKNKILALRSEELEFLGNSSLRKLDLSSNPLKEFSPGCFQTI
FT                   GKLFALLLNNAQLNPHLTEKLCWELSNTSIQNLSLANNQLLATSESTFSGLKWTNLTQL
FT                   DLSYNNLHDVGNGSFSYLPSLRYLSLEYNNIQRLSPRSFYGLSNLRYLSLKRAFTKQSV
FT                   SLASHPNIDDFSFQWLKYLEYLNMDDNNIPSTKSNTFTGLVSLKYLSLSKTFTSLQTLT
FT                   NETFVSLAHSPLLTLNLTKNHISKIANGTFSWLGQLRILDLGLNEIEQKLSGQEWRGLR
FT                   NIFEIYLSYNKYLQLSTSSFALVPSLQRLMLRRVALKNVDISPSPFRPLRNLTILDLSN
FT                   NNIANINEDLLEGLENLEILDFQHNNLARLWKRANPGGPVNFLKGLSHLHILNLESNGL
FT                   DEIPVGVFKNLFELKSINLGLNNLNKLEPFIFDDQTSLRSLNLQKNLITSVEKDVFGPP
FT                   FQNLNSLDMRFNPFDCTCESISWFVNWINQTHTNISELSTHYLCNTPHHYYGFPLKLFD
FT                   TSSCKDSAPFELLFIISTSMLLVFILVVLLIHIEGWRISFYWNVSVHRILGFKEIDTQA
FT                   EQFEYTAYIIHAHKDRDWVWEHFSPMEEQDQSLKFCLEERDFEAGVLGLEAIVNSIKRS
FT                   RKIIFVITHHLLKDPLCRRFKVHHAVQQAIEQNLDSIILIFLQNIPDYKLNHALCLRRG
FT                   MFKSHCILNWPVQKERINAFHHKLQVALGSRNSAH"
FT   CDS             complement(join(12411803..12412031,12412260..12414112,
FT                   12415532..12415723,12417584..12418027))
FT                   /codon_start=1
FT                   /gene="Tlr3"
FT                   /locus_tag="mCG_7015"
FT                   /product="toll-like receptor 3, isoform CRA_b"
FT                   /note="gene_id=mCG7015.3 transcript_id=mCT5806.2
FT                   protein_id=mCP20348.2 isoform=CRA_b"
FT                   /protein_id="EDL35549.1"
FT                   /translation="MKGCSSYLMYSFGGLLSLWILLVSSTNQCTVRYNVADCSHLKLTH
FT                   IPDDLPSNITVLNLTHNQLRRLPPTNFTRYSQLAILDAGFNSISKLEPELCQILPLLKV
FT                   LNLQHNELSQISDQTFVFCTNLTELDLMSNSIHKIKSNPFKNQKNLIKLDLSHNGLSST
FT                   KLGTGVQLENLQELLLAKNKILALRSEELEFLGNSSLRKLDLSSNPLKEFSPGCFQTIG
FT                   KLFALLLNNAQLNPHLTEKLCWELSNTSIQNLSLANNQLLATSESTFSGLKWTNLTQLD
FT                   LSYNNLHDVGNGSFSYLPSLRYLSLEYNNIQRLSPRSFYGLSNLRYLSLKRAFTKQSVS
FT                   LASHPNIDDFSFQWLKYLEYLNMDDNNIPSTKSNTFTGLVSLKYLSLSKTFTSLQTLTN
FT                   ETFVSLAHSPLLTLNLTKNHISKIANGTFSWLGQLRILDLGLNEIEQKLSGQEWRGLRN
FT                   IFEIYLSYNKYLQLSTSSFALVPSLQRLMLRRVALKNVDISPSPFRPLRNLTILDLSNN
FT                   NIANINEDLLEGLENLEILDFQHNNLARLWKRANPGGPVNFLKGLSHLHILNLESNGLD
FT                   EIPVGVFKNLFELKSINLGLNNLNKLEPFIFDDQTSLRSLNLQKNLITSVEKDVFGPPF
FT                   QNLNSLDMRFNPFDCTCESISWFVNWINQTHTNISELSTHYLCNTPHHYYGFPLKLFDT
FT                   SSCKDSAPFELLFIISTSMLLVFILVVLLIHIEGWRISFYWNVSVHRILGFKEIDTQAE
FT                   QFEYTAYIIHAHKDRDWVWEHFSPMEEQDQSLKFCLEERDFEAGVLGLEAIVNSIKRSR
FT                   KIIFVITHHLLKDPLCRRFKVHHAVQQAIEQNLDSIILIFLQNIPDYKLNHALCLRRGM
FT                   FKSHCILNWPVQKERINAFHHKLQVALGSRNSAH"
FT   assembly_gap    12419989..12420113
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    12424978..12424997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12437043..12442389
FT                   /estimated_length=5347
FT                   /gap_type="unknown"
FT   assembly_gap    12445230..12445695
FT                   /estimated_length=466
FT                   /gap_type="unknown"
FT   assembly_gap    12453573..12453817
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    12458183..12458202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12459355..12459374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12469535..12469554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12471535..12471631
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    12474033..12475190
FT                   /estimated_length=1158
FT                   /gap_type="unknown"
FT   assembly_gap    12476141..12476161
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            12518579..12838624
FT                   /locus_tag="mCG_7027"
FT                   /note="gene_id=mCG7027.2"
FT   mRNA            join(12518579..12518658,12669486..12669624,
FT                   12746867..12746916,12752201..12752293,12756134..12756160,
FT                   12756500..12756555,12769768..12769906,12773735..12773907,
FT                   12780541..12780607,12781258..12781302,12783246..12783420,
FT                   12786301..12786415,12794251..12794334,12795977..12796033,
FT                   12800684..12800733,12803502..12803689,12810431..12810519,
FT                   12811686..12811732,12814353..12814467,12814554..12814682,
FT                   12816374..12816574,12830440..12830489,12834450..12834556,
FT                   12836468..12838624)
FT                   /locus_tag="mCG_7027"
FT                   /product="mCG7027, transcript variant mCT173188"
FT                   /note="gene_id=mCG7027.2 transcript_id=mCT173188.0 created
FT                   on 13-SEP-2002"
FT   assembly_gap    12566878..12567072
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    12589646..12590383
FT                   /estimated_length=738
FT                   /gap_type="unknown"
FT   assembly_gap    12604249..12604268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12628412..12629105
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   mRNA            join(12639164..12639252,12656528..12656619,
FT                   12669486..12669624,12746867..12746916,12756134..12756160,
FT                   12756431..12756555,12769768..12769906,12773735..12773907,
FT                   12780541..12780607,12781258..12781302,12783246..12783420,
FT                   12786301..12786415,12794251..12794334,12795977..12796033,
FT                   12800684..12800733,12803502..12803689,12810431..12810519,
FT                   12811686..12811732,12814353..12814467,12814554..12814682,
FT                   12816374..12816574,12830440..12830489,12834450..12834556,
FT                   12836468..12838624)
FT                   /locus_tag="mCG_7027"
FT                   /product="mCG7027, transcript variant mCT5796"
FT                   /note="gene_id=mCG7027.2 transcript_id=mCT5796.2 created on
FT                   13-SEP-2002"
FT   assembly_gap    12642049..12642107
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    12651483..12651590
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    12666474..12666535
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    12689276..12689295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12731785..12731804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12733980..>12830019)
FT                   /locus_tag="mCG_146308"
FT                   /note="gene_id=mCG146308.0"
FT   mRNA            complement(join(12733980..12734448,12748598..12748779,
FT                   12752593..12752711,12752859..12754285,12756445..12756528,
FT                   12829826..>12830019))
FT                   /locus_tag="mCG_146308"
FT                   /product="mCG146308"
FT                   /note="gene_id=mCG146308.0 transcript_id=mCT186411.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(12734363..12734448,12748598..12748779,
FT                   12752593..>12752600))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146308"
FT                   /product="mCG146308"
FT                   /note="gene_id=mCG146308.0 transcript_id=mCT186411.0
FT                   protein_id=mCP107775.0"
FT                   /protein_id="EDL35552.1"
FT                   /translation="FMRIKITPYKWKADVVVSVDALQQQLGPDTRKLKKKKKQRSWKTI
FT                   VAIIGTGRPTVEYIVYKQEEEEEEICGFGDFQIFTARRKDATKDNI"
FT   assembly_gap    12737313..12737408
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   CDS             join(12746907..12746916,12752201..12752293,
FT                   12756134..12756160,12756500..12756555,12769768..12769906,
FT                   12773735..12773907,12780541..12780607,12781258..12781302,
FT                   12783246..12783420,12786301..12786415,12794251..12794334,
FT                   12795977..12796033,12800684..12800733,12803502..12803689,
FT                   12810431..12810519,12811686..12811732,12814353..12814467,
FT                   12814554..12814682,12816374..12816574,12830440..12830489,
FT                   12834450..12834556,12836468..12836529)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7027"
FT                   /product="mCG7027, isoform CRA_a"
FT                   /note="gene_id=mCG7027.2 transcript_id=mCT173188.0
FT                   protein_id=mCP96107.0 isoform=CRA_a"
FT                   /protein_id="EDL35550.1"
FT                   /translation="MNTDSGGCARKRAAMSVTLTSVKRVQSSPNLLAAGRESQSPDSAK
FT                   GFRSVRPNLQDKRSPTQSQITINGNSGGAVSPVSYYQRPFSPSAYSLPASLNSSIIMQH
FT                   GRSLDSAETYSQHAQSLDGTMGSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTA
FT                   IRTTVDRPKDWYKTMFKQIHMVHKPDEDTDMYNTPYTYNAGLYNSPYSAQSHPAAKTQT
FT                   YRPLSKSHSDNGTDAFKEVPSPVPPPHVPPRPRDQSSTLKHDWDPPDRKVDTRKFRSEP
FT                   RSIFEYEPGKSSILQHERPTGRINPADIDLENEPWYKFFSELEFGHPPPKKALDYVQDH
FT                   SSGVSNEVSIYQSSIDRSLERPSSSASMAGDFRKRRKSEPAVGPLRGLGDQSSSRTSPG
FT                   RADLPGSSSTFTKSFISSSPSSPSRAQDHESPRSYSSTLTDLGRSASRERRGTPEKEKL
FT                   PAKAVYDFKAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVGIFPISYVEKLTPPEK
FT                   AQPARPPPPVQPGEIGEAIAKYNFNADTNVELSLRKGDRIILLKRVDQNWYEGKIPGTN
FT                   RQGIFPVSYVEVVKRNAKGAEDYPDPPLPHSYSSDRIYTLSSNKPQRPGFSHENIQGGG
FT                   EPFQALYNYTPRNEDELELRESDVVDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL"
FT   CDS             join(12746907..12746916,12756134..12756160,
FT                   12756431..12756555,12769768..12769906,12773735..12773907,
FT                   12780541..12780607,12781258..12781302,12783246..12783420,
FT                   12786301..12786415,12794251..12794334,12795977..12796033,
FT                   12800684..12800733,12803502..12803689,12810431..12810519,
FT                   12811686..12811732,12814353..12814467,12814554..12814682,
FT                   12816374..12816574,12830440..12830489,12834450..12834556,
FT                   12836468..12836529)
FT                   /codon_start=1
FT                   /locus_tag="mCG_7027"
FT                   /product="mCG7027, isoform CRA_b"
FT                   /note="gene_id=mCG7027.2 transcript_id=mCT5796.2
FT                   protein_id=mCP20318.2 isoform=CRA_b"
FT                   /protein_id="EDL35551.1"
FT                   /translation="MNTGRESQSPDSAWRSYNDRNPETLNGDATYSSLAAKGFRSVRPN
FT                   LQDKRSPTQSQITINGNSGGAVSPVSYYQRPFSPSAYSLPASLNSSIIMQHGRSLDSAE
FT                   TYSQHAQSLDGTMGSSIPLYRSSEEEKRVTVIKAPHYPGIGPVDESGIPTAIRTTVDRP
FT                   KDWYKTMFKQIHMVHKPDEDTDMYNTPYTYNAGLYNSPYSAQSHPAAKTQTYRPLSKSH
FT                   SDNGTDAFKEVPSPVPPPHVPPRPRDQSSTLKHDWDPPDRKVDTRKFRSEPRSIFEYEP
FT                   GKSSILQHERPTGRINPADIDLENEPWYKFFSELEFGHPPPKKALDYVQDHSSGVSNEV
FT                   SIYQSSIDRSLERPSSSASMAGDFRKRRKSEPAVGPLRGLGDQSSSRTSPGRADLPGSS
FT                   STFTKSFISSSPSSPSRAQDHESPRSYSSTLTDLGRSASRERRGTPEKEKLPAKAVYDF
FT                   KAQTSKELSFKKGDTVYILRKIDQNWYEGEHHGRVGIFPISYVEKLTPPEKAQPARPPP
FT                   PVQPGEIGEAIAKYNFNADTNVELSLRKGDRIILLKRVDQNWYEGKIPGTNRQGIFPVS
FT                   YVEVVKRNAKGAEDYPDPPLPHSYSSDRIYTLSSNKPQRPGFSHENIQGGGEPFQALYN
FT                   YTPRNEDELELRESDVVDVMEKCDDGWFVGTSRRTKFFGTFPGNYVKRL"
FT   assembly_gap    12846446..12847117
FT                   /estimated_length=672
FT                   /gap_type="unknown"
FT   assembly_gap    12866762..12866863
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    12878795..12879338
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    12889462..12889729
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   gene            12896382..12929896
FT                   /gene="Pdlim3"
FT                   /locus_tag="mCG_7019"
FT                   /note="gene_id=mCG7019.2"
FT   mRNA            join(12896382..12896593,12907794..12907945,
FT                   12910743..12910827,12918737..12918924,12925397..12925527,
FT                   12927726..12927837,12929093..12929896)
FT                   /gene="Pdlim3"
FT                   /locus_tag="mCG_7019"
FT                   /product="PDZ and LIM domain 3, transcript variant mCT5800"
FT                   /note="gene_id=mCG7019.2 transcript_id=mCT5800.2 created on
FT                   19-JUL-2002"
FT   mRNA            join(12896382..12896593,12907794..12907945,
FT                   12910743..12910827,12919287..12919354,12923965..12924228,
FT                   12925397..12925527,12927726..12927837,12929093..12929896)
FT                   /gene="Pdlim3"
FT                   /locus_tag="mCG_7019"
FT                   /product="PDZ and LIM domain 3, transcript variant
FT                   mCT170824"
FT                   /note="gene_id=mCG7019.2 transcript_id=mCT170824.0 created
FT                   on 19-JUL-2002"
FT   CDS             join(12896501..12896593,12907794..12907945,
FT                   12910743..12910827,12918737..12918924,12925397..12925527,
FT                   12927726..12927837,12929093..12929282)
FT                   /codon_start=1
FT                   /gene="Pdlim3"
FT                   /locus_tag="mCG_7019"
FT                   /product="PDZ and LIM domain 3, isoform CRA_b"
FT                   /note="gene_id=mCG7019.2 transcript_id=mCT5800.2
FT                   protein_id=mCP20340.1 isoform=CRA_b"
FT                   /protein_id="EDL35554.1"
FT                   /translation="MPQNVVLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCP
FT                   GDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAETRLWSPQVSEDGKAHPFKIN
FT                   LEAEPQEFKPIGTAHNRRAQPFVAAANIDDKRQVVSASYNSPIGLYSTSNIQDALHGQL
FT                   RGLIPGSLQNEPTASVPPQSDVYRMLHDNRDDPAAPRQSGSFRVLQDLVNDGPDDRPAG
FT                   TRSVRAPVTKVHGGAGSAQRMPLCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQ
FT                   KGYFFVEGELYCETHARARTRPPEGYDTVTLYPKA"
FT   CDS             join(12896501..12896593,12907794..12907945,
FT                   12910743..12910827,12919287..12919354,12923965..12924228,
FT                   12925397..12925527,12927726..12927837,12929093..12929282)
FT                   /codon_start=1
FT                   /gene="Pdlim3"
FT                   /locus_tag="mCG_7019"
FT                   /product="PDZ and LIM domain 3, isoform CRA_a"
FT                   /note="gene_id=mCG7019.2 transcript_id=mCT170824.0
FT                   protein_id=mCP93742.0 isoform=CRA_a"
FT                   /protein_id="EDL35553.1"
FT                   /translation="MPQNVVLPGPAPWGFRLSGGIDFNQPLVITRITPGSKAAAANLCP
FT                   GDVILAIDGFGTESMTHADAQDRIKAASYQLCLKIDRAETRLWSPQVSEDGKAHPFKIN
FT                   LEAEPQDVNYFEHKHNIRPKPFIIPGRTSGCSTPSGVDCGSGRSTPSSVSTVSTICPGD
FT                   LKVAAKMAPNIPLEMELPGVKIVHAQFNTPMQLYSDDNIMETLQGQVATALGETSSMSE
FT                   PTASVPPQSDVYRMLHDNRDDPAAPRQSGSFRVLQDLVNDGPDDRPAGTRSVRAPVTKV
FT                   HGGAGSAQRMPLCDKCGSGIVGAVVKARDKYRHPECFVCADCNLNLKQKGYFFVEGELY
FT                   CETHARARTRPPEGYDTVTLYPKA"
FT   assembly_gap    12901100..12901780
FT                   /estimated_length=681
FT                   /gap_type="unknown"
FT   assembly_gap    12908860..12909138
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   assembly_gap    12933595..12933855
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    12941633..12941652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12944967..12954454
FT                   /locus_tag="mCG_119838"
FT                   /note="gene_id=mCG119838.1"
FT   mRNA            join(12944967..12945034,12945338..12945484,
FT                   12949243..12949298,12949620..12949685,12950859..12950969,
FT                   12951791..12953897,12954400..12954454)
FT                   /locus_tag="mCG_119838"
FT                   /product="mCG119838"
FT                   /note="gene_id=mCG119838.1 transcript_id=mCT121016.1
FT                   created on 13-SEP-2002"
FT   CDS             join(12945025..12945034,12945338..12945484,
FT                   12949243..12949298,12949620..12949685,12950859..12950969,
FT                   12951791..12953897,12954400..12954449)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119838"
FT                   /product="mCG119838"
FT                   /note="gene_id=mCG119838.1 transcript_id=mCT121016.1
FT                   protein_id=mCP59804.1"
FT                   /protein_id="EDL35555.1"
FT                   /translation="MSPGYLPAPKAVLGSVPEKHLAEEDEVDSILLSASKILNSSEGVK
FT                   ESGGNEPEYGCASEPENQIQPQSALKVLQHQLESFQALRMQTLQNVSMVQSEISEILNK
FT                   SIVEVETPQFNSEKSLVFSMHPEKDLPNETQEEIPSTKTLHSMGETFSSNSDTGLPQGT
FT                   DIPPQIQVKDMLALQGLRTTADNSPPKKAMNTSEQPSATKSFSLYQFLPQGPQTAVPQA
FT                   APVILDKSTITTPFPKHGFCANLDDICHSIKHMKEELQKSHDKELALTSELHTFQADAS
FT                   TQGHHKHEPFPMHSSKLNFIQQENMEGNLSEDMKSKRISELEALVSKLLPLRDTVSKLH
FT                   VNFCRKCKKLSKSEVYRGKKNEKNKDIPITSKNIMDLKFHSRAPRYTLSVLDLGKHKIK
FT                   DKEGQAFIVSQGPATLENEKLPKGKFIPEQCVPKQSVAKIHYLQNYLKESLQNQKKMTE
FT                   LENENLALKTKMKPLVFTAQSLIQKVEAHEKQLKSLAEEKSALQSKLSKAEEENKDCLR
FT                   ELKKIVSTYNVLGGQHKMLEEKNSQLSLEKQQMLETIDHLKSKEHKSQSDMAVLQNENS
FT                   RMNIEIEAMKTSMLLVQDEREMLEKETYQLLKDKSTLESDLKESKLEILQLKEKERLIK
FT                   AEQESLLHSLDTAKAEKLSLEATLQESTSTRQKLERKLVDIQAYQSAAEEKFLKEIKSA
FT                   KSETSIYKNNLAEISKECEILSKMVMEIKADNQILKEELKKHSQENTKFENSISRLTED
FT                   KILLENYVRSIENEKDTLEFEMRNLQRDYLSLSDKVSSQNNSASKSTYISRREKLYFDN
FT                   YDAYEDASSLRNRPVASDLKGIPHKLYQRLPSKICK"
FT   gene            complement(12963934..12985534)
FT                   /gene="1700029J07Rik"
FT                   /locus_tag="mCG_7025"
FT                   /note="gene_id=mCG7025.1"
FT   mRNA            complement(join(12963934..12964139,12966724..12966893,
FT                   12972581..12972760,12978188..12978263,12978359..12978496,
FT                   12980686..12980905,12983790..12983966,12985360..12985534))
FT                   /gene="1700029J07Rik"
FT                   /locus_tag="mCG_7025"
FT                   /product="RIKEN cDNA 1700029J07"
FT                   /note="gene_id=mCG7025.1 transcript_id=mCT5805.2 created on
FT                   13-SEP-2002"
FT   CDS             complement(join(12964073..12964139,12966724..12966893,
FT                   12972581..12972760,12978188..12978263,12978359..12978496,
FT                   12980686..12980905,12983790..12983889))
FT                   /codon_start=1
FT                   /gene="1700029J07Rik"
FT                   /locus_tag="mCG_7025"
FT                   /product="RIKEN cDNA 1700029J07"
FT                   /note="gene_id=mCG7025.1 transcript_id=mCT5805.2
FT                   protein_id=mCP20363.2"
FT                   /protein_id="EDL35556.1"
FT                   /translation="MPIEGGKTDMERIGLFSEMEYITVGDKYVSPFNRPFNEAASKNRQ
FT                   ILPGGTKEMSSLQAGYFDSQFARIFEGEGYVNLNQVRRRYMLAESKKNLGKAFIPSSGE
FT                   KKPSGLGSYYGTIGGPVPFFSAQIKPKDKYQPPGKNLYTNPGKKGTGYGYANVTIGKQL
FT                   SHSSDLYDAARQSYKKESEEHHRLIKGSPFKLHLHPKDYFDTNPYFLEHHLPPLRREEK
FT                   KEVSFKPFKPSSPGKKAGGMKAGAFDPYPAHSADPYVVKVEKAIPSKGERVFHPPNGPK
FT                   SRPVESIMALNVKRALNVKNYKNASSTTLGKQLVF"
FT   gene            12985808..13007278
FT                   /gene="1810047C23Rik"
FT                   /locus_tag="mCG_140749"
FT                   /note="gene_id=mCG140749.0"
FT   mRNA            join(12985808..12985869,12989490..12989576,
FT                   12990575..12990752,12990833..12990899,12993771..12993928,
FT                   12994289..12994481,12995570..12995716,13002072..13002236,
FT                   13002432..13002556,13004339..13004415,13005862..13005986,
FT                   13007026..13007278)
FT                   /gene="1810047C23Rik"
FT                   /locus_tag="mCG_140749"
FT                   /product="RIKEN cDNA 1810047C23"
FT                   /note="gene_id=mCG140749.0 transcript_id=mCT171161.0
FT                   created on 23-JUL-2002"
FT   CDS             join(12989513..12989576,12990575..12990752,
FT                   12990833..12990899,12993771..12993928,12994289..12994481,
FT                   12995570..12995716,13002072..13002236,13002432..13002556,
FT                   13004339..13004415,13005862..13005986,13007026..13007112)
FT                   /codon_start=1
FT                   /gene="1810047C23Rik"
FT                   /locus_tag="mCG_140749"
FT                   /product="RIKEN cDNA 1810047C23"
FT                   /note="gene_id=mCG140749.0 transcript_id=mCT171161.0
FT                   protein_id=mCP94079.0"
FT                   /protein_id="EDL35557.1"
FT                   /translation="MDILFRIRGGFDLAFQLAPPKEMFIKNALRQVLSDLTTKLSSDAL
FT                   VLRVCNSSVYLWPNSDANTGELTDSSACKNVVRFIQFDQEEDTKRKFIKKKDKKLTDTQ
FT                   QIVNIDLMLEISTPLGAVTPILERENEEHHYINMSLPIDAVVSVAPEESWGKVRKLLVD
FT                   AILRQLVDVEKCILRYMKGTSIVVPEPLHFQLPGKKNLVTVLYPSGIPDDQLQAYRKEL
FT                   HDLFNLPHDRPYFKRINAYHFPDELYKDGYIRNPHTYLSPPNIEGSMICVVQGTYAYHH
FT                   YMQDRIDDNGWGCAYRSLQTICSWFRHQGYTERSIPTHREIQQALVDAGDKPATFVGSR
FT                   QWIGSIEVQMVLNQLIGVTSKILFVNQGSEMASQGRELANHFQNVGTPVMVGGGVLAHT
FT                   ILGVAWNETTGQIKFLILDPHYTGAEDLQVMLEKGWCGWKSPDFWNKDAYYNLCLPQRP
FT                   NAL"
FT   assembly_gap    12990030..12990066
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    12998818..12998837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13006682..13016066)
FT                   /locus_tag="mCG_7018"
FT                   /note="gene_id=mCG7018.2"
FT   mRNA            complement(join(13006682..13007449,13007938..13008144,
FT                   13008721..13008812,13009575..13009727,13011578..13011687,
FT                   13015995..13016066))
FT                   /locus_tag="mCG_7018"
FT                   /product="mCG7018, transcript variant mCT173508"
FT                   /note="gene_id=mCG7018.2 transcript_id=mCT173508.0 created
FT                   on 16-SEP-2002"
FT   mRNA            complement(join(13006682..13007449,13007938..13008144,
FT                   13008721..13008812,13009575..13009727,13009975..>13010192))
FT                   /locus_tag="mCG_7018"
FT                   /product="mCG7018, transcript variant mCT5811"
FT                   /note="gene_id=mCG7018.2 transcript_id=mCT5811.2 created on
FT                   16-SEP-2002"
FT   mRNA            complement(join(13006682..13007449,13007938..13008144,
FT                   13008721..13008812,13009575..13009727,13009941..13010192))
FT                   /locus_tag="mCG_7018"
FT                   /product="mCG7018, transcript variant mCT173510"
FT                   /note="gene_id=mCG7018.2 transcript_id=mCT173510.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(13007449,13007938..13008144,
FT                   13008721..13008812,13009575..13009727,13009941..13009967))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7018"
FT                   /product="mCG7018, isoform CRA_c"
FT                   /note="gene_id=mCG7018.2 transcript_id=mCT173510.0
FT                   protein_id=mCP96428.0 isoform=CRA_c"
FT                   /protein_id="EDL35560.1"
FT                   /translation="MLLLSCNLEEDDLKSLLETGASVNAPPDPQEQSPAHLAAGGGLAC
FT                   FLLWQLQTGADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIGVCNKNGQTAEDLA
FT                   WSYGFPECARFLTMIKCMQTARSSGEQQERDPRAPVLRQKRSFRTVESGVMKRKC"
FT   CDS             complement(join(13007449,13007938..13008144,
FT                   13008721..13008812,13009575..>13009727))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7018"
FT                   /product="mCG7018, isoform CRA_d"
FT                   /note="gene_id=mCG7018.2 transcript_id=mCT5811.2
FT                   protein_id=mCP20366.0 isoform=CRA_d"
FT                   /protein_id="EDL35561.1"
FT                   /translation="EDDLKSLLETGASVNAPPDPQEQSPAHLAAGGGLACFLLWQLQTG
FT                   ADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIGVCNKNGQTAEDLAWSYGFPECA
FT                   RFLTMIKCMQTARSSGEQQERDPRAPVLRQKRSFRTVESGVMKRKC"
FT   CDS             complement(join(13007449,13007938..13008065))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7018"
FT                   /product="mCG7018, isoform CRA_a"
FT                   /note="gene_id=mCG7018.2 transcript_id=mCT173508.0
FT                   protein_id=mCP96427.0 isoform=CRA_a"
FT                   /protein_id="EDL35558.1"
FT                   /translation="MIKCMQTARSSGEQQERDPRAPVLRQKRSFRTVESGVMKRKC"
FT   mRNA            complement(join(13008421..13008812,13009575..13009727,
FT                   13009941..13010192))
FT                   /locus_tag="mCG_7018"
FT                   /product="mCG7018, transcript variant mCT173509"
FT                   /note="gene_id=mCG7018.2 transcript_id=mCT173509.0 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(13008717..13008812,13009575..13009727,
FT                   13009941..13009967))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7018"
FT                   /product="mCG7018, isoform CRA_b"
FT                   /note="gene_id=mCG7018.2 transcript_id=mCT173509.0
FT                   protein_id=mCP96429.0 isoform=CRA_b"
FT                   /protein_id="EDL35559.1"
FT                   /translation="MLLLSCNLEEDDLKSLLETGASVNAPPDPQEQSPAHLAAGGGLAC
FT                   FLLWQLQTGADLNQQDVLGETPLHKAAKVGSLDCLSLLVASDVQIG"
FT   gene            13009626..13039608
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /note="gene_id=mCG7022.2"
FT   mRNA            join(13009626..13009829,13021466..13021586,
FT                   13022298..13022410,13023494..13023607,13030592..13030734,
FT                   13030814..13030919,13033035..13033258,13035249..13035423,
FT                   13037385..13037774)
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /product="Lrp2 binding protein, transcript variant
FT                   mCT173511"
FT                   /note="gene_id=mCG7022.2 transcript_id=mCT173511.0 created
FT                   on 16-SEP-2002"
FT   mRNA            join(13009631..13010025,13021466..13021586,
FT                   13022298..13022410,13023494..13023607,13030592..13030734,
FT                   13030814..13030919,13033035..13033258,13035249..13035423,
FT                   13037385..13037774)
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /product="Lrp2 binding protein, transcript variant
FT                   mCT173512"
FT                   /note="gene_id=mCG7022.2 transcript_id=mCT173512.0 created
FT                   on 16-SEP-2002"
FT   CDS             join(13009984..13010025,13021466..13021586,
FT                   13022298..13022410,13023494..13023607,13030592..13030734,
FT                   13030814..13030919,13033035..13033258,13035249..13035423,
FT                   13037385..13037450)
FT                   /codon_start=1
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /product="Lrp2 binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG7022.2 transcript_id=mCT173512.0
FT                   protein_id=mCP96431.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8E5"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1914870"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8E5"
FT                   /protein_id="EDL35565.1"
FT                   /translation="MTSVPGSSERQHWPDPHCGDRMKLSSEKLPKNPFSLSQYAAKQQK
FT                   FFQWKKEKPDYYLHANLVDTALQFLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEE
FT                   IQEKDHQAIYQLGVMYYDGLGTIANAEKGVNYMRKILDSSCPQTMHLKFAAAYNLGRAY
FT                   FEGKGVKRSDEEAERLWLLAADNGNPKASVKAQSILGLFYSMKEPKELEKAFFWHSEAC
FT                   GNGSLESQGALGLMYFYGQGIRQDTDAALHCLREAAERGNVYAQGTLVEYYYKMKFFTK
FT                   CVSFSKRIADYDEVHDIPMIAHVTDCLPEFIIKGMAMAAFYHGRCLQLGLGIMKDEESA
FT                   KHYYSKACRLNPTLADELHSLLIHQRI"
FT   assembly_gap    13015318..13015357
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    13017003..13017022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(13020962..13021152,13021466..13021586,
FT                   13022298..13022410,13023494..13023607,13030592..13030734,
FT                   13030814..13030919,13033035..13033258,13035249..13035423,
FT                   13037385..13037553,13039569..13039608)
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /product="Lrp2 binding protein, transcript variant mCT5804"
FT                   /note="gene_id=mCG7022.2 transcript_id=mCT5804.2 created on
FT                   16-SEP-2002"
FT   mRNA            join(13020962..13021152,13021466..13021586,
FT                   13022298..13022410,13023494..13023607,13030592..13030734,
FT                   13030814..13030919,13033035..13033258,13035249..13035423,
FT                   13037385..13037774)
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /product="Lrp2 binding protein, transcript variant
FT                   mCT173513"
FT                   /note="gene_id=mCG7022.2 transcript_id=mCT173513.0 created
FT                   on 16-SEP-2002"
FT   CDS             join(13021487..13021586,13022298..13022410,
FT                   13023494..13023607,13030592..13030734,13030814..13030919,
FT                   13033035..13033258,13035249..13035423,13037385..13037450)
FT                   /codon_start=1
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /product="Lrp2 binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG7022.2 transcript_id=mCT173511.0
FT                   protein_id=mCP96430.0 isoform=CRA_a"
FT                   /protein_id="EDL35562.1"
FT                   /translation="MKLSSEKLPKNPFSLSQYAAKQQKFFQWKKEKPDYYLHANLVDTA
FT                   LQFLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEKDHQAIYQLGVMYYDGLG
FT                   TIANAEKGVNYMRKILDSSCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLLAA
FT                   DNGNPKASVKAQSILGLFYSMKEPKELEKAFFWHSEACGNGSLESQGALGLMYFYGQGI
FT                   RQDTDAALHCLREAAERGNVYAQGTLVEYYYKMKFFTKCVSFSKRIADYDEVHDIPMIA
FT                   HVTDCLPEFIIKGMAMAAFYHGRCLQLGLGIMKDEESAKHYYSKACRLNPTLADELHSL
FT                   LIHQRI"
FT   CDS             join(13021487..13021586,13022298..13022410,
FT                   13023494..13023607,13030592..13030734,13030814..13030919,
FT                   13033035..13033258,13035249..13035423,13037385..13037450)
FT                   /codon_start=1
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /product="Lrp2 binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG7022.2 transcript_id=mCT173513.0
FT                   protein_id=mCP96432.0 isoform=CRA_a"
FT                   /protein_id="EDL35563.1"
FT                   /translation="MKLSSEKLPKNPFSLSQYAAKQQKFFQWKKEKPDYYLHANLVDTA
FT                   LQFLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEKDHQAIYQLGVMYYDGLG
FT                   TIANAEKGVNYMRKILDSSCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLLAA
FT                   DNGNPKASVKAQSILGLFYSMKEPKELEKAFFWHSEACGNGSLESQGALGLMYFYGQGI
FT                   RQDTDAALHCLREAAERGNVYAQGTLVEYYYKMKFFTKCVSFSKRIADYDEVHDIPMIA
FT                   HVTDCLPEFIIKGMAMAAFYHGRCLQLGLGIMKDEESAKHYYSKACRLNPTLADELHSL
FT                   LIHQRI"
FT   CDS             join(13021487..13021586,13022298..13022410,
FT                   13023494..13023607,13030592..13030734,13030814..13030919,
FT                   13033035..13033258,13035249..13035423,13037385..13037450)
FT                   /codon_start=1
FT                   /gene="Lrp2bp"
FT                   /locus_tag="mCG_7022"
FT                   /product="Lrp2 binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG7022.2 transcript_id=mCT5804.2
FT                   protein_id=mCP20358.2 isoform=CRA_a"
FT                   /protein_id="EDL35564.1"
FT                   /translation="MKLSSEKLPKNPFSLSQYAAKQQKFFQWKKEKPDYYLHANLVDTA
FT                   LQFLKERIRRGDAMAYFLRGQLYFEEGWYEEALAQFEEIQEKDHQAIYQLGVMYYDGLG
FT                   TIANAEKGVNYMRKILDSSCPQTMHLKFAAAYNLGRAYFEGKGVKRSDEEAERLWLLAA
FT                   DNGNPKASVKAQSILGLFYSMKEPKELEKAFFWHSEACGNGSLESQGALGLMYFYGQGI
FT                   RQDTDAALHCLREAAERGNVYAQGTLVEYYYKMKFFTKCVSFSKRIADYDEVHDIPMIA
FT                   HVTDCLPEFIIKGMAMAAFYHGRCLQLGLGIMKDEESAKHYYSKACRLNPTLADELHSL
FT                   LIHQRI"
FT   assembly_gap    13022453..13022581
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    13027028..13030135
FT                   /estimated_length=3108
FT                   /gap_type="unknown"
FT   assembly_gap    13033896..13033915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13040617..13041046
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   gene            complement(13043531..13133092)
FT                   /gene="Snx25"
FT                   /locus_tag="mCG_67813"
FT                   /note="gene_id=mCG67813.2"
FT   mRNA            complement(join(13043531..13044086,13044666..13044766,
FT                   13045802..13045983,13048719..13048785,13051581..13051698,
FT                   13054232..13054396,13055450..13055563,13057555..13057695,
FT                   13059630..13059761,13064614..13064775,13066236..13066511,
FT                   13068855..13068986,13077190..13077371,13089308..13089378,
FT                   13112418..13112604,13114022..13114194,13125139..13125355,
FT                   13133007..13133092))
FT                   /gene="Snx25"
FT                   /locus_tag="mCG_67813"
FT                   /product="sorting nexin 25"
FT                   /note="gene_id=mCG67813.2 transcript_id=mCT67996.2 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(13044006..13044086,13044666..13044766,
FT                   13045802..13045983,13048719..13048785,13051581..13051698,
FT                   13054232..13054396,13055450..13055563,13057555..13057695,
FT                   13059630..13059761,13064614..13064775,13066236..13066511,
FT                   13068855..13068986,13077190..13077371,13089308..13089378,
FT                   13112418..13112604,13114022..13114194,13125139..13125355,
FT                   13133007..13133028))
FT                   /codon_start=1
FT                   /gene="Snx25"
FT                   /locus_tag="mCG_67813"
FT                   /product="sorting nexin 25"
FT                   /note="gene_id=mCG67813.2 transcript_id=mCT67996.2
FT                   protein_id=mCP40491.2"
FT                   /protein_id="EDL35566.1"
FT                   /translation="MDRVLRDVFDYSYRDYILSWYGNLSRDDGQLYHLLLDDFWEIVKQ
FT                   IRQRLSHVDVVKVVCNDIVKALLTHFCDLKAATARHEEQPRPFVLHACLKDSHDEVRFL
FT                   QTCSQVLVLCLLPSKDIQSLSLRTMLAEILTTKVLKPVVELLSNPDYINQMLLRQLEYR
FT                   EQMSEHHKRAYTYAPSYEDFIKLINSNSDVDFLKQLRYQIVVEIIQATTISSFPQLKRH
FT                   KGKESAAMKTDLLRARNMKRYINQLTVAKKQCEKRIRILGGPAYDQQEDGASDEGEGPQ
FT                   SQKILQFEDIMTNPFYRERFGTYMERIDKRALVGFWESAEHLKNANKSEIPQLVSEMYQ
FT                   NFFVESKEISVEKSLYKEIQQCLVGNRGIEVFSKIQADVSEVLRERYYPSFLVSDLYEK
FT                   LMREEEEEEPDAQLASEKDELGSGGEAGEEAVEGTSGVSDPASFAVIKLRELNEKLEYK
FT                   RQALSSIQNAPKPDKKIISKLKDEILLIEKECTALQLHMARTDWWCENLGLWRASITSA
FT                   EVTEENGEQMPCYFVRVNLQEVGGVETKNWTVPRRLSEFQNLHRKLSECVPSLKKVQLP
FT                   SLSKLPFKSIDHKFLGKSRNQLNAFLQNLLSDERLFQSEALYAFLSPSPDYLKVIDVQG
FT                   KKTSFSLSSFLEKLPRDFFSHQEEEIEEDSDLSDYGDDVDGKKDSLAEPCFMLIGEIFE
FT                   LRGMFKWVRRTLIALVQVTFGRTINKQIRDTVSWISSEQMLVYYISAFRDAFWPNGKLA
FT                   PPTRIRSVAQSQETKQRAQQKLLENIPDTLQSLVGQQNARHGIIKIFKALQETKANKHL
FT                   LYVLMELLLTELCPELRAHLDQFKAGQV"
FT   assembly_gap    13059844..13060222
FT                   /estimated_length=379
FT                   /gap_type="unknown"
FT   assembly_gap    13063504..13063763
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    13065825..13065936
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    13077700..13077780
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    13092490..13092886
FT                   /estimated_length=397
FT                   /gap_type="unknown"
FT   assembly_gap    13112164..13112183
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13114843..13114896
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    13160700..13161489
FT                   /estimated_length=790
FT                   /gap_type="unknown"
FT   gene            13172556..13204480
FT                   /gene="4933411K20Rik"
FT                   /locus_tag="mCG_7014"
FT                   /note="gene_id=mCG7014.2"
FT   mRNA            join(13172556..13172644,13178454..13179547,
FT                   13190611..13190879,13200472..13200622,13201477..13204480)
FT                   /gene="4933411K20Rik"
FT                   /locus_tag="mCG_7014"
FT                   /product="RIKEN cDNA 4933411K20"
FT                   /note="gene_id=mCG7014.2 transcript_id=mCT5810.2 created on
FT                   19-JUL-2002"
FT   CDS             join(13178470..13179547,13190611..13190879,
FT                   13200472..13200622,13201477..13201604)
FT                   /codon_start=1
FT                   /gene="4933411K20Rik"
FT                   /locus_tag="mCG_7014"
FT                   /product="RIKEN cDNA 4933411K20"
FT                   /note="gene_id=mCG7014.2 transcript_id=mCT5810.2
FT                   protein_id=mCP20332.2"
FT                   /protein_id="EDL35567.1"
FT                   /translation="MDRFGDISEGEVDHSFFDSDFEDAKKCESNSIFDKQNDDDLKEGI
FT                   NKDTKNVNLKFGVQNDHLKEKIDNNTENVNLKLGLQTTENYLTQKGNERKANFSSKEQH
FT                   IENDPTQARSSSVLTSSRSKKSCDATKGHKLNLPVPDRIPKIVKGEDDYYTDGEESSDD
FT                   GKKYVRSKSAKPSSNLKKNVSKKYSSSSLSSSSSRSNSDCSDMGSDRQRRSESHSSGKC
FT                   VSSVTPSSPKQRCKSGRKSSAQPSSTKQKTGDYHESEGNVPDITPLSTPDVSPAQSLEL
FT                   GQPPDQKVKVKKQENVSRDVYEDAEALKNDSRCVKSAKRKEKHGQSFAPKSSVLDANLD
FT                   RRSKQKVLHDTMDLNHLLKAFLQLDKKGPQKHHFEQPAIIPRKNYSFTREEVRQIDREN
FT                   QRLLKELSRQAEKPGSKSTIPGRSIGHPPKLYHSALNRQREQQRIERENMALLKRLEAV
FT                   KPTVGMKRSEQLMDYHRNMSYLNPSPSVRRVRSTLGHYSPLRGASRTSSATSGLSCKTD
FT                   RSVLDTSNGFLLRPKPPNVRTAWL"
FT   assembly_gap    13180381..13180471
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   gene            complement(13215576..13219901)
FT                   /locus_tag="mCG_7017"
FT                   /note="gene_id=mCG7017.2"
FT   mRNA            complement(join(13215576..13216512,13217290..13217430,
FT                   13217914..13218400,13219704..13219901))
FT                   /locus_tag="mCG_7017"
FT                   /product="mCG7017"
FT                   /note="gene_id=mCG7017.2 transcript_id=mCT5803.2 created on
FT                   16-SEP-2002"
FT   CDS             complement(join(13216355..13216512,13217290..13217430,
FT                   13217914..13218400,13219704..13219814))
FT                   /codon_start=1
FT                   /locus_tag="mCG_7017"
FT                   /product="mCG7017"
FT                   /note="gene_id=mCG7017.2 transcript_id=mCT5803.2
FT                   protein_id=mCP20349.2"
FT                   /protein_id="EDL35568.1"
FT                   /translation="MGDQALSFLKDFLAGGIAAAVSKTAVAPIERVKLLLQVQHASKQI
FT                   SAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVD
FT                   RHKQFWRYFAGNLASGGAAGATSLCFVYPLDFARTRLAADVGKGSSQREFNGLGDCLTK
FT                   IFKSDGLKGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTA
FT                   VAGLVSYPFDTVRRRMMMQSGRKGADIMYTGTLDCWRKIAKDEGANAFFKGAWSNVLRG
FT                   MGGAFVLVLYDEIKKYV"
FT   assembly_gap    13232053..13232227
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   gene            13237872..13239686
FT                   /pseudo
FT                   /locus_tag="mCG_114700"
FT                   /note="gene_id=mCG114700.0"
FT   mRNA            13237872..13239686
FT                   /pseudo
FT                   /locus_tag="mCG_114700"
FT                   /note="gene_id=mCG114700.0 transcript_id=mCT115795.0
FT                   created on 16-SEP-2002"
FT   assembly_gap    13254060..13254079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13263230..13264498)
FT                   /pseudo
FT                   /locus_tag="mCG_114699"
FT                   /note="gene_id=mCG114699.2"
FT   mRNA            complement(13263230..13264498)
FT                   /pseudo
FT                   /locus_tag="mCG_114699"
FT                   /note="gene_id=mCG114699.2 transcript_id=mCT115794.2
FT                   created on 25-JUN-2003"
FT   assembly_gap    13269995..13270014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13275979..13275998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13287766..13287971
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   gene            13288777..13289370
FT                   /pseudo
FT                   /locus_tag="mCG_51365"
FT                   /note="gene_id=mCG51365.1"
FT   mRNA            13288777..13289370
FT                   /pseudo
FT                   /locus_tag="mCG_51365"
FT                   /note="gene_id=mCG51365.1 transcript_id=mCT51548.1 created
FT                   on 16-SEP-2002"
FT   gene            complement(13301216..>13303307)
FT                   /gene="Helt"
FT                   /locus_tag="mCG_54200"
FT                   /note="gene_id=mCG54200.2"
FT   mRNA            complement(join(13301216..13301902,13302341..13302437,
FT                   13302658..13302762,13303197..>13303295))
FT                   /gene="Helt"
FT                   /locus_tag="mCG_54200"
FT                   /product="Hey-like transcription factor (zebrafish),
FT                   transcript variant mCT193314"
FT                   /note="gene_id=mCG54200.2 transcript_id=mCT193314.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(13301219..13301905,13302341..13302437,
FT                   13302658..13302762,13303197..>13303307))
FT                   /gene="Helt"
FT                   /locus_tag="mCG_54200"
FT                   /product="Hey-like transcription factor (zebrafish),
FT                   transcript variant mCT193313"
FT                   /note="gene_id=mCG54200.2 transcript_id=mCT193313.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(13301222..13301902,13302341..13302437,
FT                   13302658..13302961))
FT                   /gene="Helt"
FT                   /locus_tag="mCG_54200"
FT                   /product="Hey-like transcription factor (zebrafish),
FT                   transcript variant mCT54383"
FT                   /note="gene_id=mCG54200.2 transcript_id=mCT54383.1 created
FT                   on 16-SEP-2002"
FT   CDS             complement(join(13301409..13301905,13302341..13302437,
FT                   13302658..13302762,13303197..>13303307))
FT                   /codon_start=1
FT                   /gene="Helt"
FT                   /locus_tag="mCG_54200"
FT                   /product="Hey-like transcription factor (zebrafish),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG54200.2 transcript_id=mCT193313.0
FT                   protein_id=mCP114293.0 isoform=CRA_a"
FT                   /protein_id="EDL35569.1"
FT                   /translation="EHLKRHTRWNVDECLAPPPLPRARTHTRMSDRLKERKRTPVSHKV
FT                   IEKRRRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADFPRGREK
FT                   AELLAEFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPTFP
FT                   PLSLPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALPYLSSAT
FT                   VPLPSPAQQHSPFLAPMQGLDRHYLNLIGHGHPNGLNLHTPQHPPVL"
FT   CDS             complement(join(13301409..13301902,13302341..13302437,
FT                   13302658..13302762,13303197..>13303295))
FT                   /codon_start=1
FT                   /gene="Helt"
FT                   /locus_tag="mCG_54200"
FT                   /product="Hey-like transcription factor (zebrafish),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG54200.2 transcript_id=mCT193314.0
FT                   protein_id=mCP114294.0 isoform=CRA_b"
FT                   /protein_id="EDL35570.1"
FT                   /translation="RHTRWNVDECLAPPPLPRARTHTRMSDRLKERKRTPVSHKVIEKR
FT                   RRDRINRCLNELGKTVPMALAKQSSGKLEKAEILEMTVQYLRALHSADFPRGREKELLA
FT                   EFANYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPTFPPLSLP
FT                   EPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALPYLSSATVPLPS
FT                   PAQQHSPFLAPMQGLDRHYLNLIGHGHPNGLNLHTPQHPPVL"
FT   CDS             complement(join(13301409..13301902,13302341..13302437,
FT                   13302658..13302675))
FT                   /codon_start=1
FT                   /gene="Helt"
FT                   /locus_tag="mCG_54200"
FT                   /product="Hey-like transcription factor (zebrafish),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG54200.2 transcript_id=mCT54383.1
FT                   protein_id=mCP40474.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q8BRJ9"
FT                   /db_xref="InterPro:IPR003650"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:3040955"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BRJ9"
FT                   /protein_id="EDL35571.1"
FT                   /translation="MALAKQSSGKLEKAEILEMTVQYLRALHSADFPRGREKELLAEFA
FT                   NYFHYGYHECMKNLVHYLTTVERMETKDTKYARILAFLQSKARLGAEPTFPPLSLPEPD
FT                   FSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALPYLSSATVPLPSPAQ
FT                   QHSPFLAPMQGLDRHYLNLIGHGHPNGLNLHTPQHPPVL"
FT   assembly_gap    13306524..13307893
FT                   /estimated_length=1370
FT                   /gap_type="unknown"
FT   gene            <13308207..13334561
FT                   /locus_tag="mCG_144911"
FT                   /note="gene_id=mCG144911.0"
FT   mRNA            join(<13308207..13308391,13310713..13310823,
FT                   13315523..13315668,13315877..13315964,13333669..13334561)
FT                   /locus_tag="mCG_144911"
FT                   /product="mCG144911"
FT                   /note="gene_id=mCG144911.0 transcript_id=mCT184335.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    13314149..13314168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<13315901..13315964,13333669..13333844)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144911"
FT                   /product="mCG144911"
FT                   /note="gene_id=mCG144911.0 transcript_id=mCT184335.0
FT                   protein_id=mCP106289.0"
FT                   /protein_id="EDL35572.1"
FT                   /translation="STEIPTWILCLQEECRDQGPAGTVAGHEIKQGERVAPSFPAPVPL
FT                   RELAGPCGTRRSGIQAGHPDCGRNVEMCSAGAWA"
FT   assembly_gap    13328019..13328071
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    13343569..13343763
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    13346693..13346861
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    13360454..13360473
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13361657..13361676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13383838..13383865
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    13390407..13394131
FT                   /estimated_length=3725
FT                   /gap_type="unknown"
FT   assembly_gap    13427044..13427734
FT                   /estimated_length=691
FT                   /gap_type="unknown"
FT   assembly_gap    13440279..13440298
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13449168..13449296
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    13450816..13450925
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    13454698..13454806
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    13465256..13465689
FT                   /estimated_length=434
FT                   /gap_type="unknown"
FT   assembly_gap    13466575..13466594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13469187..13469206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13481105..13545982
FT                   /gene="Acsl1"
FT                   /locus_tag="mCG_1844"
FT                   /note="gene_id=mCG1844.2"
FT   mRNA            join(<13481105..13481294,13502569..13502683,
FT                   13515604..13515721,13518288..13518352,13521315..13521416,
FT                   13523246..13523345,13523528..13523706,13528223..13528255,
FT                   13528404..13528455,13528916..13528989,13531236..13531313,
FT                   13534881..13535015,13536182..13536316,13537125..13537220,
FT                   13538515..13538587,13540322..13540410,13540905..13541021,
FT                   13541723..13541866,13543301..13543402,13543500..13543571,
FT                   13544275..13545982)
FT                   /gene="Acsl1"
FT                   /locus_tag="mCG_1844"
FT                   /product="acyl-CoA synthetase long-chain family member 1,
FT                   transcript variant mCT1217"
FT                   /note="gene_id=mCG1844.2 transcript_id=mCT1217.2 created on
FT                   23-JUL-2002"
FT   mRNA            join(<13500902..13500930,13502569..13502683,
FT                   13515604..13515721,13518288..13518352,13521315..13521416,
FT                   13523246..13523345,13523528..13523706,13528223..13528255,
FT                   13528404..13528455,13528916..13528989,13531236..13531313,
FT                   13534881..13535015,13536182..13536316,13537125..13537220,
FT                   13538515..13538587,13540322..13540410,13540905..13541021,
FT                   13541723..13541866,13543301..13543402,13543500..13543571,
FT                   13544275..13545982)
FT                   /gene="Acsl1"
FT                   /locus_tag="mCG_1844"
FT                   /product="acyl-CoA synthetase long-chain family member 1,
FT                   transcript variant mCT171163"
FT                   /note="gene_id=mCG1844.2 transcript_id=mCT171163.0 created
FT                   on 23-JUL-2002"
FT   assembly_gap    13502686..13505826
FT                   /estimated_length=3141
FT                   /gap_type="unknown"
FT   CDS             join(<13515604..13515721,13518288..13518352,
FT                   13521315..13521416,13523246..13523345,13523528..13523706,
FT                   13528223..13528255,13528404..13528455,13528916..13528989,
FT                   13531236..13531313,13534881..13535015,13536182..13536316,
FT                   13537125..13537220,13538515..13538587,13540322..13540410,
FT                   13540905..13541021,13541723..13541866,13543301..13543402,
FT                   13543500..13543571,13544275..13544415)
FT                   /codon_start=1
FT                   /gene="Acsl1"
FT                   /locus_tag="mCG_1844"
FT                   /product="acyl-CoA synthetase long-chain family member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1844.2 transcript_id=mCT1217.2
FT                   protein_id=mCP20362.2 isoform=CRA_a"
FT                   /protein_id="EDL35573.1"
FT                   /translation="GTTDGIRRSAVLEDDKLLVYYYDDVRTMYDGFQRGIQVSNNGPCL
FT                   GSRKPNQPYEWISYKEVAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPEWVIVEQGCF
FT                   SYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIM
FT                   DSYGSDLVERGKKCGVEIISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGA
FT                   MITHQNIINDCSGFIKATESAFIASTDDVLISFLPLAHMFETVVECVMLCHGAKIGFFQ
FT                   GDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQANTSLKRWLLDFASKRKEAELRSG
FT                   IVRNNSLWDKLIFHKIQSSLGGKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTEC
FT                   TAGCCLSLPGDWTAGHVGAPMPCNYVKLVDVEEMNYLASKGEGEVCVKGANVFKGYLKD
FT                   PARTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSE
FT                   AVAQVFVHGESLQAFLIAVVVPDVESLPSWAQKRGLQGSFEELCRNKDINKAILDDLLK
FT                   LGKEAGLKPFEQVKGIAVHPELFSIDNGLLTPTLKAKRPELRNYFRSQIDELYATIKI"
FT   CDS             join(<13515604..13515721,13518288..13518352,
FT                   13521315..13521416,13523246..13523345,13523528..13523706,
FT                   13528223..13528255,13528404..13528455,13528916..13528989,
FT                   13531236..13531313,13534881..13535015,13536182..13536316,
FT                   13537125..13537220,13538515..13538587,13540322..13540410,
FT                   13540905..13541021,13541723..13541866,13543301..13543402,
FT                   13543500..13543571,13544275..13544415)
FT                   /codon_start=1
FT                   /gene="Acsl1"
FT                   /locus_tag="mCG_1844"
FT                   /product="acyl-CoA synthetase long-chain family member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG1844.2 transcript_id=mCT171163.0
FT                   protein_id=mCP94081.0 isoform=CRA_a"
FT                   /protein_id="EDL35574.1"
FT                   /translation="GTTDGIRRSAVLEDDKLLVYYYDDVRTMYDGFQRGIQVSNNGPCL
FT                   GSRKPNQPYEWISYKEVAELAECIGSGLIQKGFKPCSEQFIGLFSQNRPEWVIVEQGCF
FT                   SYSMVVVPLYDTLGADAITYIVNKAELSVIFADKPEKAKLLLEGVENKLTPCLKIIVIM
FT                   DSYGSDLVERGKKCGVEIISLKALEDLGRVNRVKPKPPEPEDLAIICFTSGTTGNPKGA
FT                   MITHQNIINDCSGFIKATESAFIASTDDVLISFLPLAHMFETVVECVMLCHGAKIGFFQ
FT                   GDIRLLMDDLKVLQPTIFPVVPRLLNRMFDRIFGQANTSLKRWLLDFASKRKEAELRSG
FT                   IVRNNSLWDKLIFHKIQSSLGGKVRLMITGAAPVSATVLTFLRTALGCQFYEGYGQTEC
FT                   TAGCCLSLPGDWTAGHVGAPMPCNYVKLVDVEEMNYLASKGEGEVCVKGANVFKGYLKD
FT                   PARTAEALDKDGWLHTGDIGKWLPNGTLKIIDRKKHIFKLAQGEYIAPEKIENIYLRSE
FT                   AVAQVFVHGESLQAFLIAVVVPDVESLPSWAQKRGLQGSFEELCRNKDINKAILDDLLK
FT                   LGKEAGLKPFEQVKGIAVHPELFSIDNGLLTPTLKAKRPELRNYFRSQIDELYATIKI"
FT   gene            13561961..13589558
FT                   /gene="Mlf1ip"
FT                   /locus_tag="mCG_1843"
FT                   /note="gene_id=mCG1843.1"
FT   mRNA            join(13561961..13562060,13563948..13563996,
FT                   13566015..13566126,13569802..13569904,13571709..13571769,
FT                   13572349..13572576,13578541..13578610,13579965..13580073,
FT                   13582726..13582804,13583407..13583454,13583824..13583885,
FT                   13586201..13586357,13588230..13589558)
FT                   /gene="Mlf1ip"
FT                   /locus_tag="mCG_1843"
FT                   /product="myeloid leukemia factor 1 interacting protein"
FT                   /note="gene_id=mCG1843.1 transcript_id=mCT1218.2 created on
FT                   16-SEP-2002"
FT   CDS             join(13562020..13562060,13563948..13563996,
FT                   13566015..13566126,13569802..13569904,13571709..13571769,
FT                   13572349..13572576,13578541..13578610,13579965..13580073,
FT                   13582726..13582804,13583407..13583454,13583824..13583885,
FT                   13586201..13586357,13588230..13588343)
FT                   /codon_start=1
FT                   /gene="Mlf1ip"
FT                   /locus_tag="mCG_1843"
FT                   /product="myeloid leukemia factor 1 interacting protein"
FT                   /note="gene_id=mCG1843.1 transcript_id=mCT1218.2
FT                   protein_id=mCP20359.2"
FT                   /protein_id="EDL35575.1"
FT                   /translation="MAARRSLRYSGNPGAKHSKNTLRSTYSRKQKAGPKPRPKDVFDFS
FT                   NNSDASSIPGALEEEEETYETFDPPLHSTAIYAEDELSKHCVSSSSLATHRGKASRNLD
FT                   PSEDEASGNESIKVSTKKPRRKLEPISGESDSSADDVRRRVASAEGPRSQQRQAAPAAP
FT                   SPPERPAEPVTPRRTRLHSAQLSPVDETPATQSQLKTQKKVRPSPGRRKRPRRGHTDTD
FT                   GSESMHIWCLEGKRQSDITELDVILSVFEKTFLEYKQRVESESCNQAINKFYFKMKGEL
FT                   IRMLKEAQMLKALKMKNTKIIANMEKKRQRLIEVQDELIRLEPQLKQLQTKYDDLKERK
FT                   SSLKKSKHFLSNLKQLCQDYSNVQEKGPKGTGKYDSSSLPALLFKARSILGAENHLRTI
FT                   NYQLGKLLELD"
FT   assembly_gap    13579270..13579390
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    13580961..13580980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13585590..13627209)
FT                   /gene="Ccdc111"
FT                   /locus_tag="mCG_114705"
FT                   /note="gene_id=mCG114705.2"
FT   mRNA            complement(join(13585590..13586696,13587994..13589141,
FT                   13591413..13591459,13591543..13591625,13596314..13596422,
FT                   13596578..13596667,13600196..13600284,13602574..13602736,
FT                   13603451..13603684,13609700..13609847,13615066..13615195,
FT                   13617785..13617882,13620421..13620606,13622351..13622427,
FT                   13627115..13627209))
FT                   /gene="Ccdc111"
FT                   /locus_tag="mCG_114705"
FT                   /product="coiled-coil domain containing 111"
FT                   /note="gene_id=mCG114705.2 transcript_id=mCT115800.2
FT                   created on 22-NOV-2004"
FT   CDS             complement(join(13588899..13589141,13591413..13591459,
FT                   13591543..13591625,13596314..13596422,13596578..13596667,
FT                   13600196..13600284,13602574..13602736,13603451..13603684,
FT                   13609700..13609847,13615066..13615195,13617785..13617882,
FT                   13620421..13620600))
FT                   /codon_start=1
FT                   /gene="Ccdc111"
FT                   /locus_tag="mCG_114705"
FT                   /product="coiled-coil domain containing 111"
FT                   /note="gene_id=mCG114705.2 transcript_id=mCT115800.2
FT                   protein_id=mCP60038.2"
FT                   /protein_id="EDL35576.1"
FT                   /translation="MLRKWEARVKQIEERASHYERKPLSSVYRPRLAKPEEPSSIWKLF
FT                   HRQNQAFNFVKSCKESVHVFALECKRGNGQRIYLVTSYAQLWFYYKTRKTLLHCYEVIP
FT                   ENAVCKLYFDLEFNKLANPGADGKMMVALLIQHVCKALEEFYNVQCSAEDVFNLDSSTE
FT                   EKFSRHLIFQLHNVAFKDNRHAGNFVRKILQPALHLIAEDDEAKVPEAVGQDASGFSVT
FT                   PLKQEISEAREKVGLPKQCDPDLSFLVVKNHMGEKCLFVDLGVYTKNRNFRLYQSSKIG
FT                   KCVSLEVAEDNRFIPKQSKDISEENQYFLSSLVSNVRFSDTLRVLTCHPSQTKRKRAEC
FT                   FNSTGTSVESIEGFQGSPYPEVDQFVLSLVNKHDIKGGIRRWNYFFPEELLVYDICKYR
FT                   WCENIGRAHKSNNIMILVDLKNEVWYQKCHDPVCKAQNFKSTCSPLPTEVSLLFLLKDE
FT                   DFTSGETDDTSTSLTKDSQTPPSCNLSAGGLSAAAWDDEDDALFLEATEDAEFADAADK
FT                   SLGSMDDIPDELIIEALQNS"
FT   assembly_gap    13599750..13599859
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            13627386..13649669
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /note="gene_id=mCG1848.2"
FT   mRNA            join(13627386..13627482,13639682..13639749,
FT                   13642265..13642389,13644146..13644316,13649385..13649669)
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, transcript variant mCT171167"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT171167.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(13627386..13627482,13639682..13639749,
FT                   13642265..13642317,13649131..13649669)
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, transcript variant mCT171168"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT171168.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(13627386..13627482,13639682..13639749,
FT                   13642265..13642389,13644146..13644274,13645325..13645500,
FT                   13646150..13646270,13647871..13649061)
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, transcript variant mCT180436"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT180436.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(13627386..13627477,13639682..13639749,
FT                   13642265..13642389,13644146..13644274,13645325..13645500,
FT                   13646150..13646270,13647871..13649061)
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, transcript variant mCT1216"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT1216.3 created on
FT                   13-FEB-2003"
FT   mRNA            join(13627386..13627482,13639682..13639749,
FT                   13642265..13642389,13644146..13645030)
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, transcript variant mCT171165"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT171165.0 created
FT                   on 13-FEB-2003"
FT   mRNA            join(13627386..13627482,13639682..13639749,
FT                   13642265..13642957,13643217..13645023)
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, transcript variant mCT171166"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT171166.0 created
FT                   on 13-FEB-2003"
FT   assembly_gap    13630708..13630727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(13639697..13639749,13642265..13642389,
FT                   13644146..13644316,13649385..13649440)
FT                   /codon_start=1
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, isoform CRA_c"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT171167.0
FT                   protein_id=mCP94084.0 isoform=CRA_c"
FT                   /protein_id="EDL35579.1"
FT                   /translation="MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMG
FT                   ICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSGK
FT                   IEPIQSRSFGSFAVHPQGDCALLLASLWGC"
FT   CDS             join(13639697..13639749,13642265..13642317,
FT                   13649131..13649201)
FT                   /codon_start=1
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, isoform CRA_d"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT171168.0
FT                   protein_id=mCP94086.0 isoform=CRA_d"
FT                   /protein_id="EDL35580.1"
FT                   /translation="MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSITTWESEPDH
FT                   KLLQKGFPRGLRV"
FT   CDS             join(13639697..13639749,13642265..13642389,
FT                   13644146..13644274,13645325..13645500,13646150..13646270,
FT                   13647871..13648100)
FT                   /codon_start=1
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, isoform CRA_a"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT1216.3
FT                   protein_id=mCP20331.1 isoform=CRA_a"
FT                   /protein_id="EDL35577.1"
FT                   /translation="MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMG
FT                   ICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVS
FT                   KEDHSKRSSFVCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQAC
FT                   RGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSM
FT                   LKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH"
FT   CDS             join(13639697..13639749,13642265..13642389,
FT                   13644146..13644274,13645325..13645500,13646150..13646270,
FT                   13647871..13648100)
FT                   /codon_start=1
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, isoform CRA_a"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT180436.0
FT                   protein_id=mCP103358.0 isoform=CRA_a"
FT                   /protein_id="EDL35582.1"
FT                   /translation="MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMG
FT                   ICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSVS
FT                   KEDHSKRSSFVCVILSHGDEGVIYGTNGPVELKKLTSFFRGDYCRSLTGKPKLFIIQAC
FT                   RGTELDCGIETDSGTDEEMACQKIPVEADFLYAYSTAPGYYSWRNSKDGSWFIQSLCSM
FT                   LKLYAHKLEFMHILTRVNRKVATEFESFSLDSTFHAKKQIPCIVSMLTKELYFYH"
FT   CDS             join(13639697..13639749,13642265..13642389,
FT                   13644146..13644363)
FT                   /codon_start=1
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, isoform CRA_e"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT171165.0
FT                   protein_id=mCP94083.0 isoform=CRA_e"
FT                   /protein_id="EDL35581.1"
FT                   /translation="MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMG
FT                   ICIIINNKNFHKSTGMSSRSGTDVDAANLRETFMGLKYQVRNKNDLTREDILELMDSGK
FT                   IEPIQSRSFGSFGGRWTAARSWSKNRD"
FT   CDS             join(13639697..13639749,13642265..13642406)
FT                   /codon_start=1
FT                   /gene="Casp3"
FT                   /locus_tag="mCG_1848"
FT                   /product="caspase 3, isoform CRA_b"
FT                   /note="gene_id=mCG1848.2 transcript_id=mCT171166.0
FT                   protein_id=mCP94085.0 isoform=CRA_b"
FT                   /protein_id="EDL35578.1"
FT                   /translation="MENNKTSVDSKSINNFEVKTIHGSKSVDSGIYLDSSYKMDYPEMG
FT                   ICIIINNKNFHKSTGMYVR"
FT   assembly_gap    13649062..13649081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13696180..13696383
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    13711426..13711445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13718456..13718741
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    13721581..13721751
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    13722086..13722151
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    13725556..13725575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13749800..13857831
FT                   /gene="Irf2"
FT                   /locus_tag="mCG_1847"
FT                   /note="gene_id=mCG1847.2"
FT   mRNA            join(13749800..13750004,13803774..13803866,
FT                   13816772..13816871,13817523..13817699,13818006..13818052,
FT                   13829092..13829209,13847975..13848139,13855186..13855232,
FT                   13856279..13857831)
FT                   /gene="Irf2"
FT                   /locus_tag="mCG_1847"
FT                   /product="interferon regulatory factor 2, transcript
FT                   variant mCT1215"
FT                   /note="gene_id=mCG1847.2 transcript_id=mCT1215.2 created on
FT                   23-JUL-2002"
FT   mRNA            join(13749800..13750004,13816772..13816871,
FT                   13817523..13817699,13818006..13818052,13829092..13829209,
FT                   13847975..13848099,13855186..13855232,13856279..13857831)
FT                   /gene="Irf2"
FT                   /locus_tag="mCG_1847"
FT                   /product="interferon regulatory factor 2, transcript
FT                   variant mCT171164"
FT                   /note="gene_id=mCG1847.2 transcript_id=mCT171164.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(<13749827..13750004,13803774..13803866,
FT                   13816772..13816871,13817523..13817699,13818006..13818052,
FT                   13847975..13848139,13855186..13855232,13856279..13857811)
FT                   /gene="Irf2"
FT                   /locus_tag="mCG_1847"
FT                   /product="interferon regulatory factor 2, transcript
FT                   variant mCT193319"
FT                   /note="gene_id=mCG1847.2 transcript_id=mCT193319.0 created
FT                   on 09-MAR-2004"
FT   assembly_gap    13750685..13750840
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    13764248..13764347
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    13768697..13769024
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    13778857..13778976
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    13796317..13796725
FT                   /estimated_length=409
FT                   /gap_type="unknown"
FT   CDS             join(13803780..13803866,13816772..13816871,
FT                   13817523..13817699,13818006..13818052,13829092..13829209,
FT                   13847975..13848139,13855186..13855232,13856279..13856587)
FT                   /codon_start=1
FT                   /gene="Irf2"
FT                   /locus_tag="mCG_1847"
FT                   /product="interferon regulatory factor 2, isoform CRA_a"
FT                   /note="gene_id=mCG1847.2 transcript_id=mCT1215.2
FT                   protein_id=mCP20321.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U2Z2"
FT                   /db_xref="InterPro:IPR001346"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR017431"
FT                   /db_xref="InterPro:IPR019817"
FT                   /db_xref="MGI:MGI:96591"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U2Z2"
FT                   /protein_id="EDL35583.1"
FT                   /translation="MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHG
FT                   WDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRCAMNSLPDIEEVKDRSIKKGNN
FT                   AFRVYRMLPLSERPSKKGKKPKTEKEERVKHIKQEPVESSLGLSNGVSGFSPEYAVLTS
FT                   AIKNEVDSTVNIIVVGQSHLDSNIEDQEIVTNPPDICQVVEVTTESDDQPVSMSELYPL
FT                   QISPVSSYAESETTDSVASDEENAEGRPHWRKRSIEGKQYLSNMGTRNTYLLPSMATFV
FT                   TSNKPDLQVTIKEDSCPMPYNSSWPPFTDLPLPAPVTPTPSSSRPDRETRASVIKKTSD
FT                   ITQARVKSC"
FT   assembly_gap    13813080..13813099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(13816799..13816871,13817523..13817699,
FT                   13818006..13818052,13829092..13829209,13847975..13848099,
FT                   13855186..13855232,13856279..13856489)
FT                   /codon_start=1
FT                   /gene="Irf2"
FT                   /locus_tag="mCG_1847"
FT                   /product="interferon regulatory factor 2, isoform CRA_b"
FT                   /note="gene_id=mCG1847.2 transcript_id=mCT171164.0
FT                   protein_id=mCP94082.0 isoform=CRA_b"
FT                   /protein_id="EDL35584.1"
FT                   /translation="MHAARHGWDVEKDAPLFRNWAIHTGKHQPGIDKPDPKTWKANFRC
FT                   AMNSLPDIEEVKDRSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEERVKHIKQEPVE
FT                   SSLGLSNGVSGFSPEYAVLTSAIKNEVDSTVNIIVVGQSHLDSNIEDQEIVTNPPDICQ
FT                   VVEVTTESDDQPVSMSEKAKLPTVWPVMKRTQRGDHTGGRGASKASSTSATWGHGTPIC
FT                   CPAWRPLSPPTSQICRSPSKRIAVRCLTTAPGPHLQTFPFLPQ"
FT   CDS             join(<13818043..13818052,13847975..13848139,
FT                   13855186..13855232,13856279..13856587)
FT                   /codon_start=1
FT                   /gene="Irf2"
FT                   /locus_tag="mCG_1847"
FT                   /product="interferon regulatory factor 2, isoform CRA_c"
FT                   /note="gene_id=mCG1847.2 transcript_id=mCT193319.0
FT                   protein_id=mCP114289.0 isoform=CRA_c"
FT                   /protein_id="EDL35585.1"
FT                   /translation="AHQVVGQSHLDSNIEDQEIVTNPPDICQVVEVTTESDDQPVSMSE
FT                   LYPLQISPVSSYAESETTDSVASDEENAEGRPHWRKRSIEGKQYLSNMGTRNTYLLPSM
FT                   ATFVTSNKPDLQVTIKEDSCPMPYNSSWPPFTDLPLPAPVTPTPSSSRPDRETRASVIK
FT                   KTSDITQARVKSC"
FT   assembly_gap    13848789..13848926
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    13878263..13878446
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    13922502..13922594
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    13940637..13940756
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    13948132..13948151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13970096..13970887
FT                   /estimated_length=792
FT                   /gap_type="unknown"
FT   assembly_gap    13976847..13976973
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            13997378..14106022
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /note="gene_id=mCG115485.1"
FT   mRNA            join(13997378..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076484,14076845..14076988,
FT                   14079859..14079996,14095276..14095399,14105589..14106022)
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, transcript variant mCT116591"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT116591.1
FT                   created on 17-SEP-2002"
FT   mRNA            join(13997378..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076484,14076845..14076988,
FT                   14079859..14079996,14095276..14095399,14095725..14096337)
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, transcript variant mCT160497"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT160497.1
FT                   created on 17-SEP-2002"
FT   mRNA            join(<13997414..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14077024,14079859..14079996,
FT                   14095276..14095399,14105589..14105843)
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, transcript variant mCT193323"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT193323.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<13997415..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076508)
FT                   /codon_start=1
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, isoform CRA_d"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT193323.0
FT                   protein_id=mCP114281.0 isoform=CRA_d"
FT                   /protein_id="EDL35589.1"
FT                   /translation="SSPWQTPGSMAAKLWTFLLGFGLSWVWPASAHRKLLVLLLDGFRS
FT                   DYISEDALASLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMW
FT                   DPRTNKSFDIGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYC
FT                   LEYKTVPTDINFANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDALRAV
FT                   DTVLKYMIQWIQVTQSKDN"
FT   mRNA            join(<13997424..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076484,14076845..14077024,
FT                   14079859..14079996,14095276..14095657)
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, transcript variant mCT193324"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT193324.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<13997424..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076484,14076845..14077024,
FT                   14079859..14079996,14095276..14095455)
FT                   /codon_start=1
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, isoform CRA_e"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT193324.0
FT                   protein_id=mCP114282.0 isoform=CRA_e"
FT                   /protein_id="EDL35590.1"
FT                   /translation="WQTPGSMAAKLWTFLLGFGLSWVWPASAHRKLLVLLLDGFRSDYI
FT                   SEDALASLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPR
FT                   TNKSFDIGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYCLEY
FT                   KTVPTDINFANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDALRAVDTV
FT                   LKYMIQWIQDRGLQQDLNVILFSDHGMTDIFWMDKVIELSNYISLDDLQQVKDRGPVVS
FT                   LWPVPGKHSEIYHKLRTVEHMTVYEKESIPNRFYYKKGKFVSPLTLVADEGWFIAESRE
FT                   MLPFWMNSTGKREGWQRGWHGYDNELMDMRGIFLAIGPGRQGDDWTLVGSLPRKQL"
FT   mRNA            join(<13997442..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076484,14076845..14077024,
FT                   14079859..14079996,14095276..14095399,14105589..>14105794)
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, transcript variant mCT193322"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT193322.0
FT                   created on 09-MAR-2004"
FT   CDS             join(13997442..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076484,14076845..14077024,
FT                   14079859..14079996,14095276..14095399,14105589..14105794)
FT                   /codon_start=1
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, isoform CRA_c"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT193322.0
FT                   protein_id=mCP114297.0 isoform=CRA_c"
FT                   /protein_id="EDL35588.1"
FT                   /translation="MAAKLWTFLLGFGLSWVWPASAHRKLLVLLLDGFRSDYISEDALA
FT                   SLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPRTNKSFD
FT                   IGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYCLEYKTVPTD
FT                   INFANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDALRAVDTVLKYMIQ
FT                   WIQDRGLQQDLNVILFSDHGMTDIFWMDKVIELSNYISLDDLQQVKDRGPVVSLWPVPG
FT                   KHSEIYHKLRTVEHMTVYEKESIPNRFYYKKGKFVSPLTLVADEGWFIAESREMLPFWM
FT                   NSTGKREGWQRGWHGYDNELMDMRGIFLAIGPDFKSNFRAAPIRSVDVYNIMCHVAGIT
FT                   PLPNNGSWSRVVCMLKGQTSSAPPTPLNSCALVLILLLYFV"
FT   CDS             join(13997442..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076484,14076845..14076988,
FT                   14079859..14079996,14095276..14095399,14105589..14105794)
FT                   /codon_start=1
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, isoform CRA_a"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT116591.1
FT                   protein_id=mCP59954.1 isoform=CRA_a"
FT                   /protein_id="EDL35586.1"
FT                   /translation="MAAKLWTFLLGFGLSWVWPASAHRKLLVLLLDGFRSDYISEDALA
FT                   SLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPRTNKSFD
FT                   IGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYCLEYKTVPTD
FT                   INFANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDALRAVDTVLKYMIQ
FT                   WIQDRGLQQDLNVILFSDHGMTDIFWMDKVIELSNYISLDDLQQVKDRGPVIYHKLRTV
FT                   EHMTVYEKESIPNRFYYKKGKFVSPLTLVADEGWFIAESREMLPFWMNSTGKREGWQRG
FT                   WHGYDNELMDMRGIFLAIGPDFKSNFRAAPIRSVDVYNIMCHVAGITPLPNNGSWSRVV
FT                   CMLKGQTSSAPPTPLNSCALVLILLLYFV"
FT   CDS             join(13997442..13997682,14040986..14041165,
FT                   14064140..14064251,14076343..14076484,14076845..14076988,
FT                   14079859..14079996,14095276..14095399,14095725..14095732)
FT                   /codon_start=1
FT                   /gene="Enpp6"
FT                   /locus_tag="mCG_115485"
FT                   /product="ectonucleotide pyrophosphatase/phosphodiesterase
FT                   6, isoform CRA_b"
FT                   /note="gene_id=mCG115485.1 transcript_id=mCT160497.1
FT                   protein_id=mCP59953.1 isoform=CRA_b"
FT                   /protein_id="EDL35587.1"
FT                   /translation="MAAKLWTFLLGFGLSWVWPASAHRKLLVLLLDGFRSDYISEDALA
FT                   SLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPRTNKSFD
FT                   IGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYCLEYKTVPTD
FT                   INFANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDALRAVDTVLKYMIQ
FT                   WIQDRGLQQDLNVILFSDHGMTDIFWMDKVIELSNYISLDDLQQVKDRGPVIYHKLRTV
FT                   EHMTVYEKESIPNRFYYKKGKFVSPLTLVADEGWFIAESREMLPFWMNSTGKREGWQRG
FT                   WHGYDNELMDMRGIFLAIGPAI"
FT   assembly_gap    14027693..14027963
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    14030192..14030211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14031281..14031300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14036470..14036696
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   gene            complement(14037372..14048700)
FT                   /locus_tag="mCG_1042896"
FT                   /note="gene_id=mCG1042896.0"
FT   mRNA            complement(join(14037372..14037758,14038186..14038288,
FT                   14040723..14040857,14048391..14048700))
FT                   /locus_tag="mCG_1042896"
FT                   /product="mCG1042896"
FT                   /note="gene_id=mCG1042896.0 transcript_id=mCT160600.0
FT                   created on 17-SEP-2002"
FT   CDS             complement(14037421..14037711)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042896"
FT                   /product="mCG1042896"
FT                   /note="gene_id=mCG1042896.0 transcript_id=mCT160600.0
FT                   protein_id=mCP59910.1"
FT                   /protein_id="EDL35591.1"
FT                   /translation="MYQPHSLRVLVSVFLPDPHLFLHICGACLPASGLCYPRSPAGTPA
FT                   HCLPPARCSLAEAPCDQLMALPCIRPPAHHRQVSELSFLQQQTFVRLISFQ"
FT   assembly_gap    14057237..14058489
FT                   /estimated_length=1253
FT                   /gap_type="unknown"
FT   assembly_gap    14066008..14066078
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    14067901..14067920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14084636..14084655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14087125..14087144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14088728..14088747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14097600..14097619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14134571..14134815
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    14138899..14138918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14139838..14139857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14148632..14172546
FT                   /locus_tag="mCG_148211"
FT                   /note="gene_id=mCG148211.0"
FT   mRNA            join(14148632..14148861,14172019..14172546)
FT                   /locus_tag="mCG_148211"
FT                   /product="mCG148211"
FT                   /note="gene_id=mCG148211.0 transcript_id=mCT188474.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    14150573..14150592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14152394..14153532
FT                   /estimated_length=1139
FT                   /gap_type="unknown"
FT   assembly_gap    14154579..14154598
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14161147..14161436
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   CDS             14172290..14172445
FT                   /codon_start=1
FT                   /locus_tag="mCG_148211"
FT                   /product="mCG148211"
FT                   /note="gene_id=mCG148211.0 transcript_id=mCT188474.0
FT                   protein_id=mCP108790.0"
FT                   /protein_id="EDL35592.1"
FT                   /translation="MIISNSPRSQKILGTVWNDLDRQELQVQLAVRDGTHMMNSLEQHQ
FT                   HCHQEQ"
FT   gene            14189519..14192924
FT                   /locus_tag="mCG_115488"
FT                   /note="gene_id=mCG115488.1"
FT   mRNA            join(14189519..14191140,14192585..14192924)
FT                   /locus_tag="mCG_115488"
FT                   /product="mCG115488, transcript variant mCT173505"
FT                   /note="gene_id=mCG115488.1 transcript_id=mCT173505.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(14189519..14191140,14192169..14192276)
FT                   /locus_tag="mCG_115488"
FT                   /product="mCG115488, transcript variant mCT173504"
FT                   /note="gene_id=mCG115488.1 transcript_id=mCT173504.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(14189519..14191140,14191233..14191273)
FT                   /locus_tag="mCG_115488"
FT                   /product="mCG115488, transcript variant mCT116594"
FT                   /note="gene_id=mCG115488.1 transcript_id=mCT116594.1
FT                   created on 17-SEP-2002"
FT   CDS             14189533..14189766
FT                   /codon_start=1
FT                   /locus_tag="mCG_115488"
FT                   /product="mCG115488, isoform CRA_a"
FT                   /note="gene_id=mCG115488.1 transcript_id=mCT116594.1
FT                   protein_id=mCP59792.1 isoform=CRA_a"
FT                   /protein_id="EDL35593.1"
FT                   /translation="MLFNILKSNTIQNGYFTQHYIYNMNTILPYGGTFKYRLTKIPVLF
FT                   FFLLTYCTKDDKESSFTIWYTDTIKTMLQMCC"
FT   CDS             14189533..14189766
FT                   /codon_start=1
FT                   /locus_tag="mCG_115488"
FT                   /product="mCG115488, isoform CRA_a"
FT                   /note="gene_id=mCG115488.1 transcript_id=mCT173505.0
FT                   protein_id=mCP96424.0 isoform=CRA_a"
FT                   /protein_id="EDL35594.1"
FT                   /translation="MLFNILKSNTIQNGYFTQHYIYNMNTILPYGGTFKYRLTKIPVLF
FT                   FFLLTYCTKDDKESSFTIWYTDTIKTMLQMCC"
FT   CDS             14189533..14189766
FT                   /codon_start=1
FT                   /locus_tag="mCG_115488"
FT                   /product="mCG115488, isoform CRA_a"
FT                   /note="gene_id=mCG115488.1 transcript_id=mCT173504.0
FT                   protein_id=mCP96423.0 isoform=CRA_a"
FT                   /protein_id="EDL35595.1"
FT                   /translation="MLFNILKSNTIQNGYFTQHYIYNMNTILPYGGTFKYRLTKIPVLF
FT                   FFLLTYCTKDDKESSFTIWYTDTIKTMLQMCC"
FT   gene            complement(14195413..14298234)
FT                   /gene="Stox2"
FT                   /locus_tag="mCG_2179"
FT                   /note="gene_id=mCG2179.1"
FT   mRNA            complement(join(14195413..14196040,14201307..14203572,
FT                   14212534..14212686,14297996..14298234))
FT                   /gene="Stox2"
FT                   /locus_tag="mCG_2179"
FT                   /product="storkhead box 2"
FT                   /note="gene_id=mCG2179.1 transcript_id=mCT1219.1 created on
FT                   17-SEP-2002"
FT   CDS             complement(join(14195845..14196040,14201307..14203572,
FT                   14212534..14212686,14297996..14298161))
FT                   /codon_start=1
FT                   /gene="Stox2"
FT                   /locus_tag="mCG_2179"
FT                   /product="storkhead box 2"
FT                   /note="gene_id=mCG2179.1 transcript_id=mCT1219.1
FT                   protein_id=mCP20338.1"
FT                   /protein_id="EDL35596.1"
FT                   /translation="MKKTRSTTLRRAWPSSDFSDRASDRMRSRSEKDYRLHKRFPAAFA
FT                   PQASRGYMTSGDVSPISMSPISQSQFIPLGEILCLAISAMNSARKPVTQEALMEHLTTC
FT                   FPGVPTPSQEILRHTLNTLVRERKIYPTPDGYFIVTPQTYFITPSLIRTNSKWYHLDER
FT                   VPDRSQCTSPQPGTITPSASGCVRERTLPRKHCDSCHCCREDVHSMHASTLQRKSAKDC
FT                   KDPYCPPPLCQVPPTEKSKSTINFSYKTETLSKPKDGEKQSKKFGLKLFRLSFKKDKTK
FT                   QLANFSAQFPPEEWPLRDEDTPTTIPREVEMEIIRRINPDLTVENVMRHTALMKKLEEE
FT                   KAHRSKAGSSAHHSGRSKKSRTHRKSHGKSRSHSKTRVSKGDPSDGSHLDIPGEREYEF
FT                   CDPLTRAPREGCFIIEHKGDNFIMHSNTNVIESHFPMTPEWDVSGELAKRRTEMPFPEP
FT                   SRGSSHSKVHRSHSHTQDRRSRNERSNKAKERSRSMDNSKGPLGASSLGTPEDLAEGCS
FT                   QDDQTPSQSYIDDSTLRPAQTIGHQRAHIPSASYKEVCIPEIVGGSKEPSSACSLLEPG
FT                   KTPESMPSYGELSPCPAKTAVDDYFQCNTSSETVLTAPSPLGKNKEDHDTLTLVEGVKK
FT                   LSPSERQTPHSSREPVGHKEESPKGPGGGPAASGGVAEGLANGRLVQHHSAEPSSLDKR
FT                   KEIFSKDTLFKPLHSTLSVNSYHKSSLSLLKSHPKSPVDTLPGRCEKLEPSLGTSAAQA
FT                   MPPSQRQQEPGGNQEASFDYYNVSDDDDSEEGANKNAEEEKNRDDVGTMQWLLEREKER
FT                   DLQRKFEKNLTLLTPKETDSSSNQRATHSARLDSMDSSSITVDSGFNSPRTRESLASNT
FT                   SSIVESNRRQNPALSPAHGGAGPTFNFRASTDPPTSEAEKLQKPSNCLQASVTSV"
FT   assembly_gap    14211066..14212062
FT                   /estimated_length=997
FT                   /gap_type="unknown"
FT   assembly_gap    14213801..14214872
FT                   /estimated_length=1072
FT                   /gap_type="unknown"
FT   assembly_gap    14216262..14216365
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    14234619..14234638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14288581..14288871
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   gene            complement(14304388..14456713)
FT                   /locus_tag="mCG_1851"
FT                   /note="gene_id=mCG1851.2"
FT   mRNA            complement(join(14304388..14305460,14423218..14423658,
FT                   14424429..14424538,14425621..14425702,14430355..14430459,
FT                   14443326..14443529,14454630..14454747,14456536..14456713))
FT                   /locus_tag="mCG_1851"
FT                   /product="mCG1851"
FT                   /note="gene_id=mCG1851.2 transcript_id=mCT1117.2 created on
FT                   17-SEP-2002"
FT   CDS             complement(join(14305384..14305460,14423218..14423575))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1851"
FT                   /product="mCG1851"
FT                   /note="gene_id=mCG1851.2 transcript_id=mCT1117.2
FT                   protein_id=mCP20347.2"
FT                   /protein_id="EDL35597.1"
FT                   /translation="MEKFLQIAPHSLAIVLGPADSSAEEKPGTVQPSPPVPTQPRQLAR
FT                   HHIGYEIFADFKAENMQHFWNKKVTAAVAETFFLGWIDEQVLLIQGKEEHLEALREGWT
FT                   RRALRPPSGFQIRCLGCYMEIYDSSEACGGATFFSHHVVV"
FT   gene            14331078..14331548
FT                   /locus_tag="mCG_1042899"
FT                   /note="gene_id=mCG1042899.1"
FT   mRNA            14331078..14331548
FT                   /locus_tag="mCG_1042899"
FT                   /product="mCG1042899"
FT                   /note="gene_id=mCG1042899.1 transcript_id=mCT160603.1
FT                   created on 17-SEP-2002"
FT   CDS             14331160..14331345
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042899"
FT                   /product="mCG1042899"
FT                   /note="gene_id=mCG1042899.1 transcript_id=mCT160603.1
FT                   protein_id=mCP60022.1"
FT                   /protein_id="EDL35598.1"
FT                   /translation="MLSTKLKRSSVGGTCIVCCYPVLPNAGSLLFKGTQHQHSHLRSQF
FT                   APACNSKSNSKTNTLD"
FT   assembly_gap    14339403..14339523
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    14347834..14347853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14373674..14374081
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    14399441..14399490
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    14415288..14415444
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    14421992..14422011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14424174..14424389
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   gene            14424390..14425809
FT                   /locus_tag="mCG_148214"
FT                   /note="gene_id=mCG148214.0"
FT   mRNA            14424390..14425809
FT                   /locus_tag="mCG_148214"
FT                   /product="mCG148214"
FT                   /note="gene_id=mCG148214.0 transcript_id=mCT188477.0
FT                   created on 13-JAN-2004"
FT   CDS             14425043..14425276
FT                   /codon_start=1
FT                   /locus_tag="mCG_148214"
FT                   /product="mCG148214"
FT                   /note="gene_id=mCG148214.0 transcript_id=mCT188477.0
FT                   protein_id=mCP108793.0"
FT                   /protein_id="EDL35599.1"
FT                   /translation="MCRKVEVRRYQKTVYALHTGLENQTQVIDRLGSKLYLLSHHVVSL
FT                   LVISKKYLGTAVAGSGPSSLKKKNTDLEKTLR"
FT   assembly_gap    14426229..14426325
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    14431508..14431527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14440949..14441138
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    14477155..14477174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14485444..14485535
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    14487947..14488285
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   gene            complement(14489528..>14532888)
FT                   /gene="D030016E14Rik"
FT                   /locus_tag="mCG_115486"
FT                   /note="gene_id=mCG115486.1"
FT   mRNA            complement(join(14489528..14490318,14492633..14492800,
FT                   14494397..14494530,14496313..14496404,14498048..14498159,
FT                   14500947..14501103,14501202..14501267,14502706..14502825,
FT                   14503276..14503397,14504728..14504876,14504980..14505168,
FT                   14506977..14507132,14510267..14510397,14511732..14511864,
FT                   14511957..14512018,14512679..14512824,14513150..14513204,
FT                   14513277..14513355,14513447..14513526,14514180..14514273,
FT                   14515855..14516002,14518969..14519081,14521748..14521844,
FT                   14523946..14524019,14524392..14524491,14526361..14526475,
FT                   14527381..14527451,14528750..14528919,14530073..14530298,
FT                   14532740..14532875))
FT                   /gene="D030016E14Rik"
FT                   /locus_tag="mCG_115486"
FT                   /product="RIKEN cDNA D030016E14, transcript variant
FT                   mCT116592"
FT                   /note="gene_id=mCG115486.1 transcript_id=mCT116592.1
FT                   created on 18-SEP-2002"
FT   mRNA            complement(join(14489529..14490318,14492633..14492800,
FT                   14494397..14494530,14496313..14496404,14498048..14498159,
FT                   14500947..14501103,14501202..14501267,14502706..14502825,
FT                   14503276..14503397,14504728..14504876,14504980..14505168,
FT                   14506977..14507132,14510267..14510397,14511732..14511864,
FT                   14511957..14512018,14512679..14513355,14513447..14513526,
FT                   14514180..14514273,14515855..14516002,14518969..14519102,
FT                   14521748..14521844,14523946..14524019,14524392..>14524438))
FT                   /gene="D030016E14Rik"
FT                   /locus_tag="mCG_115486"
FT                   /product="RIKEN cDNA D030016E14, transcript variant
FT                   mCT193308"
FT                   /note="gene_id=mCG115486.1 transcript_id=mCT193308.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(14490073..14490318,14492633..14492800,
FT                   14494397..14494530,14496313..14496404,14498048..14498159,
FT                   14500947..14501103,14501202..14501267,14502706..14502825,
FT                   14503276..14503397,14504728..14504876,14504980..14505168,
FT                   14506977..14507132,14510267..14510397,14511732..14511864,
FT                   14511957..14512018,14512679..14512824,14513150..14513204,
FT                   14513277..14513355,14513447..14513526,14514180..14514273,
FT                   14515855..14516002,14518969..14519102,14521748..14521844,
FT                   14523946..14524019,14524392..14524491,14526361..14526475,
FT                   14527381..14527451,14528750..14528919,14530073..14530298,
FT                   14532740..>14532888))
FT                   /gene="D030016E14Rik"
FT                   /locus_tag="mCG_115486"
FT                   /product="RIKEN cDNA D030016E14, transcript variant
FT                   mCT193309"
FT                   /note="gene_id=mCG115486.1 transcript_id=mCT193309.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(14490274..14490318,14492633..14492800,
FT                   14494397..14494530,14496313..14496404,14498048..14498159,
FT                   14500947..14501103,14501202..14501267,14502706..14502825,
FT                   14503276..14503397,14504728..14504876,14504980..14505168,
FT                   14506977..>14507047))
FT                   /codon_start=1
FT                   /gene="D030016E14Rik"
FT                   /locus_tag="mCG_115486"
FT                   /product="RIKEN cDNA D030016E14, isoform CRA_b"
FT                   /note="gene_id=mCG115486.1 transcript_id=mCT193308.0
FT                   protein_id=mCP114283.0 isoform=CRA_b"
FT                   /protein_id="EDL35601.1"
FT                   /translation="FPAKQGNCHLNLLQKQKMWERKSRSPLWDLFLGSESGRCVVLSWQ
FT                   GGGGDAASSQEALQAARSFKRRPKLAEDEIHWDSVIIQASTMIISRVPNISVHLRHEPP
FT                   ALMNEMYCLVVTVQSHEKSPIRDVKLTAGLKPGQDANLTQKTHVTLHGAELCDESYPAL
FT                   LTDIPVGDLHPGEQLEKTVYVRCGTVGSRMFLVYVSYLINTTVEGKEIICKCHKDDTVT
FT                   IETVFPFDVAVRFVSTKFEHLERVYADIPFLLMTDVLSASPWALTIVSSELQLAPSMTA
FT                   MDHLESQIDKVVLQTGESASECFCLRCPSAGNIEGGVATGHYIISWKRASVVESIPAVS
FT                   TVITLPHVIAENIPLHVNADLPSFGRVRESLPVRYHLQNKTDLVQDVEISVEPSDAFMF
FT                   SGLKQIRLRILPGTKQEMLYNFYPLMAGYQQLPSLNINLLRFPNFTNQLLRRFIPTSIF
FT                   VKPQGRLLEDTSIAAA"
FT   CDS             complement(join(14505025..14505168,14506977..14507132,
FT                   14510267..14510397,14511732..14511864,14511957..14512018,
FT                   14512679..14512824,14513150..14513204,14513277..14513355,
FT                   14513447..14513526,14514180..14514273,14515855..14516002,
FT                   14518969..14519102,14521748..14521844,14523946..14524019,
FT                   14524392..14524491,14526361..14526475,14527381..14527451,
FT                   14528750..14528919,14530073..14530298,14532740..>14532822))
FT                   /codon_start=1
FT                   /gene="D030016E14Rik"
FT                   /locus_tag="mCG_115486"
FT                   /product="RIKEN cDNA D030016E14, isoform CRA_c"
FT                   /note="gene_id=mCG115486.1 transcript_id=mCT193309.0
FT                   protein_id=mCP114284.0 isoform=CRA_c"
FT                   /protein_id="EDL35602.1"
FT                   /translation="TPLPGSLASFGADGDSPQLQRVQGVRPGFFLDALSMSPTQWDFPV
FT                   ELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANRRADRVPISFKVLPGDHEYPKCRSKR
FT                   TSYEWYIPKGVLKTGWMNKHLNLVPALVVVFYELDWDEPQWKEKQSECATRVEIVRQSL
FT                   QGRNTKVAVVLIQKKTPLPPGEDVIASERAAALCNVCELSGKSLFVLPHTDHLVGYIIR
FT                   LENAFYEHAQTYYYTEIRRVKSHKEFLNKTTHQLLFVRHQFKIAFFSELKQDTQNALKN
FT                   YRIAYNLVHELRAHETNILEIKTMAGFINYKICRLCFQHNTPLDAIAQFRKHIDLCKKK
FT                   IGSAELAFEHAAWMAKQFQAFGDLFDEAIKLGLTAIQTQNPGFYYQQAAYYAQERKQHA
FT                   KALCNHDAAVMYPNPDPLETQSGVLDFYGQRPWRQGILSFDLSDPEKEKAGILAIQLKE
FT                   RSVVHSEIIIALLSNAVAQFKKYKCPRMKSHLMVQMGEEYYYAKDYTKALKLLDYVMCD
FT                   YRSEAWWTLLTSILTTALKCSYLMAQLKDYITYSLELLGRASTLKDEQKSRIEKNLMNV
FT                   LMNESPDPEPDCDVLAVKTAQKLWADRVSLAGSNVFQIGVQDFVPFVQCKAKFHAPSFH
FT                   VDVPVEFDVFLKADCPHPIRFSKLCVSFNNQVYNQFCVLEEASKASEVLENLTQGKMCL
FT                   VPGKTRKLSFKFVAKTEDVGKKIEITSVGSVSGQRVRPVCGFELAGRRRRCCVLPGSPA
FT                   GCKVFQKAAKAC"
FT   CDS             complement(join(14505025..14505168,14506977..14507132,
FT                   14510267..14510397,14511732..14511864,14511957..14512018,
FT                   14512679..14512824,14513150..14513204,14513277..14513355,
FT                   14513447..14513526,14514180..14514273,14515855..14516002,
FT                   14518969..14519081,14521748..14521844,14523946..14524019,
FT                   14524392..14524491,14526361..14526475,14527381..14527451,
FT                   14528750..14528919,14530073..14530276))
FT                   /codon_start=1
FT                   /gene="D030016E14Rik"
FT                   /locus_tag="mCG_115486"
FT                   /product="RIKEN cDNA D030016E14, isoform CRA_a"
FT                   /note="gene_id=mCG115486.1 transcript_id=mCT116592.1
FT                   protein_id=mCP59960.1 isoform=CRA_a"
FT                   /protein_id="EDL35600.1"
FT                   /translation="MSPTQWDFPVELCCRPMAFVTLTGLDVVYNAVHRAVWDAFCANRR
FT                   ADRVPISFKVLPGDHEYPKCRSKRTSYEWYIPKGVLKTGWMNKHLNLVPALVVVFYELD
FT                   WDEPQWKEKQSECATRVEIVRQSLQGRNTKVAVVLIQKKTPLPPGEDVIASERAAALCN
FT                   VCELSGKSLFVLPHTDHLVGYIIRLENAFYEHAQTYYYTEIRRVKSHKEFLNKTTHQLL
FT                   FVRHQFKIAFFSELKQDTQNALKNYRIAYNLVHELRAHETNILEIKTMAGFINYKHNTP
FT                   LDAIAQFRKHIDLCKKKIGSAELAFEHAAWMAKQFQAFGDLFDEAIKLGLTAIQTQNPG
FT                   FYYQQAAYYAQERKQHAKALCNHDAAVMYPNPDPLETQSGVLDFYGQRPWRQGILSFDL
FT                   SDPEKEKAGILAIQLKERSVVHSEIIIALLSNAVAQFKKYKCPRMKSHLMVQMGEEYYY
FT                   AKDYTKALKLLDYVMCDYRSEAWWTLLTSILTTALKCSYLMAQLKDYITYSLELLGRAS
FT                   TLKDEQKSRIEKNLMNVLMNESPDPEPDCDVLAVKTAQKLWADRVSLAGSNVFQIGVQD
FT                   FVPFVQCKAKFHAPSFHVDVPVEFDVFLKADCPHPIRFSKLCVSFNNQVYNQFCVLEEA
FT                   SKASEVLENLTQGKMCLVPGKTRKLSFKFVAKTEDVGKKIEITSVGSVSGQRVRPVCGF
FT                   ELAGRRRRCCVLPGSPAGCKVFQKAAKAC"
FT   gene            14533064..14552421
FT                   /gene="Rwdd4a"
FT                   /locus_tag="mCG_1849"
FT                   /note="gene_id=mCG1849.3"
FT   mRNA            join(14533064..14533364,14536699..14536779,
FT                   14542111..14542220,14542301..14542448,14543577..14543694,
FT                   14547255..14547304,14550161..14552421)
FT                   /gene="Rwdd4a"
FT                   /locus_tag="mCG_1849"
FT                   /product="RWD domain containing 4A, transcript variant
FT                   mCT1114"
FT                   /note="gene_id=mCG1849.3 transcript_id=mCT1114.3 created on
FT                   14-FEB-2003"
FT   mRNA            join(14533064..14533364,14536699..14536779,
FT                   14542115..14542220,14542301..14542448,14543577..14543694,
FT                   14547255..14547304,14550161..14552421)
FT                   /gene="Rwdd4a"
FT                   /locus_tag="mCG_1849"
FT                   /product="RWD domain containing 4A, transcript variant
FT                   mCT180437"
FT                   /note="gene_id=mCG1849.3 transcript_id=mCT180437.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(14533341..14533364,14536699..14536779,
FT                   14542111..14542220,14542301..14542448,14543577..14543694,
FT                   14547255..14547304,14550161..14550193)
FT                   /codon_start=1
FT                   /gene="Rwdd4a"
FT                   /locus_tag="mCG_1849"
FT                   /product="RWD domain containing 4A, isoform CRA_a"
FT                   /note="gene_id=mCG1849.3 transcript_id=mCT1114.3
FT                   protein_id=mCP20326.1 isoform=CRA_a"
FT                   /protein_id="EDL35603.1"
FT                   /translation="MGANEDQEMELEALRSIYEGDNSFRELSPVSFQYRIGEDGDPKAF
FT                   LIEVSWTETYPQTAPVISMNAFFNNTISSAVKQSILAKLQEAVEVNLGTAMTYTLFEYA
FT                   KDHKEQFMENHHPGNSATPVANIISVETPTTAPSSKKKEKKEQLSKAQKRKLADKTDHK
FT                   GELPRGWNWVDVVKLSKTGSKDDE"
FT   CDS             join(14533341..14533364,14536699..14536779,
FT                   14542115..14542144)
FT                   /codon_start=1
FT                   /gene="Rwdd4a"
FT                   /locus_tag="mCG_1849"
FT                   /product="RWD domain containing 4A, isoform CRA_b"
FT                   /note="gene_id=mCG1849.3 transcript_id=mCT180437.0
FT                   protein_id=mCP103359.0 isoform=CRA_b"
FT                   /db_xref="GOA:H3BJI4"
FT                   /db_xref="InterPro:IPR006575"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="MGI:MGI:2681000"
FT                   /db_xref="UniProtKB/TrEMBL:H3BJI4"
FT                   /protein_id="EDL35604.1"
FT                   /translation="MGANEDQEMELEALRSIYEGDNSFRELSPVSFQYRVKTAIPKPS"
FT   assembly_gap    14539782..14539865
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    14542601..14542939
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    14588857..14588876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14600218..14600237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14601392..14601411
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14601948..14602354
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   gene            complement(14632238..14632738)
FT                   /pseudo
FT                   /locus_tag="mCG_58326"
FT                   /note="gene_id=mCG58326.2"
FT   mRNA            complement(14632238..14632738)
FT                   /pseudo
FT                   /locus_tag="mCG_58326"
FT                   /note="gene_id=mCG58326.2 transcript_id=mCT58509.2 created
FT                   on 18-SEP-2002"
FT   assembly_gap    14634051..14634070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14636849..14637395)
FT                   /pseudo
FT                   /locus_tag="mCG_1860"
FT                   /note="gene_id=mCG1860.0"
FT   mRNA            complement(14636849..14637395)
FT                   /pseudo
FT                   /locus_tag="mCG_1860"
FT                   /note="gene_id=mCG1860.0 transcript_id=mCT1106.0 created on
FT                   18-SEP-2002"
FT   assembly_gap    14640383..14640519
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    14658132..14658151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14673281..14680255)
FT                   /gene="Ing2"
FT                   /locus_tag="mCG_1858"
FT                   /note="gene_id=mCG1858.2"
FT   mRNA            complement(join(14673281..14674387,14680210..14680255))
FT                   /gene="Ing2"
FT                   /locus_tag="mCG_1858"
FT                   /product="inhibitor of growth family, member 2, transcript
FT                   variant mCT171169"
FT                   /note="gene_id=mCG1858.2 transcript_id=mCT171169.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(14673281..14674387,14679205..14679858))
FT                   /gene="Ing2"
FT                   /locus_tag="mCG_1858"
FT                   /product="inhibitor of growth family, member 2, transcript
FT                   variant mCT1111"
FT                   /note="gene_id=mCG1858.2 transcript_id=mCT1111.1 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(14673717..14674387,14679205..14679379))
FT                   /codon_start=1
FT                   /gene="Ing2"
FT                   /locus_tag="mCG_1858"
FT                   /product="inhibitor of growth family, member 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1858.2 transcript_id=mCT1111.1
FT                   protein_id=mCP20320.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9ESK4"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR024610"
FT                   /db_xref="InterPro:IPR028639"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="MGI:MGI:1916510"
FT                   /db_xref="PDB:1WES"
FT                   /db_xref="PDB:2G6Q"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ESK4"
FT                   /protein_id="EDL35605.1"
FT                   /translation="MLGQQQQQQLYSSAALLTGERSRLLSCYVQDYLECVESLPHDMQR
FT                   NVSVLRELDNKYQETLKEIDDVYEKYKKEDDSNQKKRLQQHLQRALINSQELGDEKIQI
FT                   VTQMLELVENRARQMELHSQCFQDPAESERASDKSKMDSSQPERSSRRPRRQRTSESRD
FT                   LCHMTNGIDDCDDQPPKEKRSKSAKKKKRSKAKQEREASPVEFAIDPNEPTYCLCNQVS
FT                   YGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKERRAR
FT                   "
FT   CDS             complement(14673717..14674241)
FT                   /codon_start=1
FT                   /gene="Ing2"
FT                   /locus_tag="mCG_1858"
FT                   /product="inhibitor of growth family, member 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1858.2 transcript_id=mCT171169.0
FT                   protein_id=mCP94087.0 isoform=CRA_b"
FT                   /db_xref="GOA:B6ZI39"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR028639"
FT                   /db_xref="InterPro:IPR028651"
FT                   /db_xref="MGI:MGI:1916510"
FT                   /db_xref="UniProtKB/TrEMBL:B6ZI39"
FT                   /protein_id="EDL35606.1"
FT                   /translation="MLELVENRARQMELHSQCFQDPAESERASDKSKMDSSQPERSSRR
FT                   PRRQRTSESRDLCHMTNGIDDCDDQPPKEKRSKSAKKKKRSKAKQEREASPVEFAIDPN
FT                   EPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKS
FT                   TEKTKKERRAR"
FT   assembly_gap    14678452..14678951
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    14684230..14684466
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    14697754..14697773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14714212..14718797)
FT                   /gene="4921511I16Rik"
FT                   /locus_tag="mCG_1862"
FT                   /note="gene_id=mCG1862.3"
FT   mRNA            complement(join(14714212..14717161,14717786..14717885,
FT                   14718386..14718795))
FT                   /gene="4921511I16Rik"
FT                   /locus_tag="mCG_1862"
FT                   /product="RIKEN cDNA 4921511I16, transcript variant
FT                   mCT185732"
FT                   /note="gene_id=mCG1862.3 transcript_id=mCT185732.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(14714316..14717161,14717755..14717885,
FT                   14718386..14718797))
FT                   /gene="4921511I16Rik"
FT                   /locus_tag="mCG_1862"
FT                   /product="RIKEN cDNA 4921511I16, transcript variant
FT                   mCT1103"
FT                   /note="gene_id=mCG1862.3 transcript_id=mCT1103.3 created on
FT                   12-JUN-2003"
FT   mRNA            complement(join(14715097..14716328,14717764..14717885,
FT                   14718386..14718797))
FT                   /gene="4921511I16Rik"
FT                   /locus_tag="mCG_1862"
FT                   /product="RIKEN cDNA 4921511I16, transcript variant
FT                   mCT173507"
FT                   /note="gene_id=mCG1862.3 transcript_id=mCT173507.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(14715852..14717161,14717755..14717885,
FT                   14718386..14718636))
FT                   /codon_start=1
FT                   /gene="4921511I16Rik"
FT                   /locus_tag="mCG_1862"
FT                   /product="RIKEN cDNA 4921511I16, isoform CRA_a"
FT                   /note="gene_id=mCG1862.3 transcript_id=mCT1103.3
FT                   protein_id=mCP20344.2 isoform=CRA_a"
FT                   /protein_id="EDL35607.1"
FT                   /translation="MAQEVSEYLSQNPRVAAWVETLRCEGETDKHWRHRREFLLRNAGD
FT                   LVPATDETADAESGARTRQLQQLVSFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTD
FT                   APIHTTRDELVAKVKKRGISSSNEGVEEPSKKRAVEGKNNSSVERDHGKKSAKTDRSAA
FT                   QQENSSPSRGSSTKSESGGTSARSSSSGSHQDSATSEGDRSVCSQSSSNSSQVTAGSGK
FT                   ALESEAPHKRGSASFVSSLLKSSMNSHMTQSTDNRQQSGSPKKGALEGSSGSASQSSSE
FT                   IEVPLLGSSGSAEVELPLLSCKSSSETASSGLTSKSSSEANISSSVSKNSSSSGSSLLT
FT                   PQSSSTNPSLLTSKSTAQVAASLLATKSGASLGSVSQLAAKSGSQSSTSQLPSKSTSQA
FT                   SESSVKFACRKLTNEDIKQKQPFFNRLYKTVAWKLVAVGGFSPTVNHGELLNAAIEALK
FT                   ATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKL
FT                   FLKKKVVVKICKRKYRGSEIEDLVLLDEEARPVNLPPALKHPQELL"
FT   CDS             complement(14715852..14716808)
FT                   /codon_start=1
FT                   /gene="4921511I16Rik"
FT                   /locus_tag="mCG_1862"
FT                   /product="RIKEN cDNA 4921511I16, isoform CRA_c"
FT                   /note="gene_id=mCG1862.3 transcript_id=mCT185732.0
FT                   protein_id=mCP106990.0 isoform=CRA_c"
FT                   /protein_id="EDL35609.1"
FT                   /translation="MNSHMTQSTDNRQQSGSPKKGALEGSSGSASQSSSEIEVPLLGSS
FT                   GSAEVELPLLSCKSSSETASSGLTSKSSSEANISSSVSKNSSSSGSSLLTPQSSSTNPS
FT                   LLTSKSTAQVAASLLATKSGASLGSVSQLAAKSGSQSSTSQLPSKSTSQASESSVKFAC
FT                   RKLTNEDIKQKQPFFNRLYKTVAWKLVAVGGFSPTVNHGELLNAAIEALKATLDVFFVP
FT                   LKELADLPQNKSSQESIVCELRCKSVYLGTGCGKSKENAKAVASREALKLFLKKKVVVK
FT                   ICKRKYRGSEIEDLVLLDEEARPVNLPPALKHPQELL"
FT   CDS             complement(join(14716303..14716328,14717764..14717885,
FT                   14718386..14718636))
FT                   /codon_start=1
FT                   /gene="4921511I16Rik"
FT                   /locus_tag="mCG_1862"
FT                   /product="RIKEN cDNA 4921511I16, isoform CRA_b"
FT                   /note="gene_id=mCG1862.3 transcript_id=mCT173507.0
FT                   protein_id=mCP96426.0 isoform=CRA_b"
FT                   /protein_id="EDL35608.1"
FT                   /translation="MAQEVSEYLSQNPRVAAWVETLRCEGETDKHWRHRREFLLRNAGD
FT                   LVPATDETADAESGARTRQLQQLVSFSMAWANHVFLGCRYPQKVMDKILSMAEGIKVTD
FT                   APIHTTRDELVAKVKKRGISICLSEVNQ"
FT   assembly_gap    14723413..14724132
FT                   /estimated_length=720
FT                   /gap_type="unknown"
FT   assembly_gap    14738935..14738978
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    14743979..14744441
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   assembly_gap    14745301..14745320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14749952..>14754904)
FT                   /locus_tag="mCG_145544"
FT                   /note="gene_id=mCG145544.0"
FT   mRNA            complement(join(14749952..14750357,14753520..14753645,
FT                   14754871..>14754904))
FT                   /locus_tag="mCG_145544"
FT                   /product="mCG145544"
FT                   /note="gene_id=mCG145544.0 transcript_id=mCT184968.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(14750027..>14750224)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145544"
FT                   /product="mCG145544"
FT                   /note="gene_id=mCG145544.0 transcript_id=mCT184968.0
FT                   protein_id=mCP106295.0"
FT                   /protein_id="EDL35610.1"
FT                   /translation="VTHREAGLGAPVQLPKMVSREQLRISHVPDPCSNFPTRVRWHICR
FT                   PSSEEAEAGEERIQGQPNRQ"
FT   assembly_gap    14755245..14755281
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(14769285..>14771452)
FT                   /locus_tag="mCG_145541"
FT                   /note="gene_id=mCG145541.0"
FT   mRNA            complement(join(14769285..14769990,14771059..14771355,
FT                   14771402..>14771452))
FT                   /locus_tag="mCG_145541"
FT                   /product="mCG145541"
FT                   /note="gene_id=mCG145541.0 transcript_id=mCT184965.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(14769879..14769990,14771059..>14771228))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145541"
FT                   /product="mCG145541"
FT                   /note="gene_id=mCG145541.0 transcript_id=mCT184965.0
FT                   protein_id=mCP106292.0"
FT                   /protein_id="EDL35611.1"
FT                   /translation="TKLASNSKICLPLPPEWWNLRCVPPLPGCTPHSISSPFLCLSSQI
FT                   SSCWIFADSLASIAVCAANSPSPWPEPKEPSQPPPQMLSDLNMPRCLV"
FT   assembly_gap    14778632..14778669
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   gene            14778760..14783082
FT                   /locus_tag="mCG_1042904"
FT                   /note="gene_id=mCG1042904.1"
FT   mRNA            join(14778760..14779211,14782497..14783082)
FT                   /locus_tag="mCG_1042904"
FT                   /product="mCG1042904"
FT                   /note="gene_id=mCG1042904.1 transcript_id=mCT160608.1
FT                   created on 18-SEP-2002"
FT   assembly_gap    14779823..14779842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14780162..14780659
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   CDS             14782605..14782799
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042904"
FT                   /product="mCG1042904"
FT                   /note="gene_id=mCG1042904.1 transcript_id=mCT160608.1
FT                   protein_id=mCP60040.1"
FT                   /protein_id="EDL35612.1"
FT                   /translation="MEDINHPTETNLEEKVFFLFVCLFVSGAWIQKAAFCPSLLGSIAS
FT                   RSTMRKTLLVCRRGGSLPI"
FT   assembly_gap    14810214..14810356
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   gene            complement(14817046..14823730)
FT                   /locus_tag="mCG_1042905"
FT                   /note="gene_id=mCG1042905.0"
FT   mRNA            complement(join(14817046..14817373,14823523..14823730))
FT                   /locus_tag="mCG_1042905"
FT                   /product="mCG1042905"
FT                   /note="gene_id=mCG1042905.0 transcript_id=mCT160609.0
FT                   created on 18-SEP-2002"
FT   CDS             complement(join(14817245..14817373,14823523..14823546))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042905"
FT                   /product="mCG1042905"
FT                   /note="gene_id=mCG1042905.0 transcript_id=mCT160609.0
FT                   protein_id=mCP59748.1"
FT                   /protein_id="EDL35613.1"
FT                   /translation="MVCEMSQQDPEGQKRTSESLELELQVDGSHHAAPGLELGSSRRAT
FT                   SALNY"
FT   assembly_gap    14825252..14826445
FT                   /estimated_length=1194
FT                   /gap_type="unknown"
FT   gene            <14827694..>14828356
FT                   /locus_tag="mCG_51871"
FT                   /note="gene_id=mCG51871.0"
FT   mRNA            <14827694..>14828356
FT                   /locus_tag="mCG_51871"
FT                   /product="mCG51871"
FT                   /note="gene_id=mCG51871.0 transcript_id=mCT52054.0 created
FT                   on 19-SEP-2002"
FT   CDS             14827694..14828356
FT                   /codon_start=1
FT                   /locus_tag="mCG_51871"
FT                   /product="mCG51871"
FT                   /note="gene_id=mCG51871.0 transcript_id=mCT52054.0
FT                   protein_id=mCP40471.0"
FT                   /db_xref="GOA:D3YXJ9"
FT                   /db_xref="InterPro:IPR004031"
FT                   /db_xref="InterPro:IPR006187"
FT                   /db_xref="InterPro:IPR017974"
FT                   /db_xref="MGI:MGI:3712484"
FT                   /db_xref="UniProtKB/TrEMBL:D3YXJ9"
FT                   /protein_id="EDL35614.1"
FT                   /translation="MAFIFRTAMQSVGLSLSLLGWVLAIITTYLPHWKNLNLELNEMEN
FT                   WTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDC
FT                   LRLGETQEGLKKRLLTLGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFG
FT                   EALFLGWFAGFCLVLGGCVLHCAACSSPAPAASSHYAGAGPRDHGSYLENGTVQPKV"
FT   gene            14830032..14831026
FT                   /locus_tag="mCG_51735"
FT                   /note="gene_id=mCG51735.1"
FT   mRNA            14830032..14831026
FT                   /locus_tag="mCG_51735"
FT                   /product="mCG51735"
FT                   /note="gene_id=mCG51735.1 transcript_id=mCT51918.1 created
FT                   on 19-SEP-2002"
FT   CDS             14830080..14830742
FT                   /codon_start=1
FT                   /locus_tag="mCG_51735"
FT                   /product="mCG51735"
FT                   /note="gene_id=mCG51735.1 transcript_id=mCT51918.1
FT                   protein_id=mCP40489.0"
FT                   /protein_id="EDL35615.1"
FT                   /translation="MGLVFRTATQAAALLLSLLGWVLSCLTNYLPHWKNLNLELNEMEN
FT                   WTMGLWKSCVIQEEVGRQCKDFDSFLALPAELQVSRVLMSLCNGLGLLGLLASGCGLDC
FT                   LRLGETQEGLKKRLLTLGGTLLWTSGVMVLVPVSWVAHKTVREFWDETMPEIVPRWEFG
FT                   EALFLGWFAGFCLVLGGCVLHCAACWSPAPAASSHYAVAGPRDHQQHLELKQANPEI"
FT   gene            complement(14831570..14997135)
FT                   /gene="Wwc2"
FT                   /locus_tag="mCG_115484"
FT                   /note="gene_id=mCG115484.1"
FT   mRNA            complement(join(14831570..14834335,14837163..14837290,
FT                   14848263..14848505,14851545..14851637,14852792..14852956,
FT                   14854704..14854887,14857303..14857424,14861582..14861746,
FT                   14864128..14864320,14869251..14869337,14869450..14869530,
FT                   14869903..14870032,14873570..14874189,14875177..14875266,
FT                   14880627..14880869,14884229..14884302,14885502..14885648,
FT                   14888895..14889024,14892473..14892552,14904837..14904913,
FT                   14906055..14906258,14926381..14926490,14996283..14997135))
FT                   /gene="Wwc2"
FT                   /locus_tag="mCG_115484"
FT                   /product="WW, C2 and coiled-coil domain containing 2"
FT                   /note="gene_id=mCG115484.1 transcript_id=mCT116590.1
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(14834269..14834335,14837163..14837290,
FT                   14848263..14848505,14851545..14851637,14852792..14852956,
FT                   14854704..14854887,14857303..14857424,14861582..14861746,
FT                   14864128..14864320,14869251..14869337,14869450..14869530,
FT                   14869903..14870032,14873570..14874189,14875177..14875266,
FT                   14880627..14880869,14884229..14884302,14885502..14885648,
FT                   14888895..14889024,14892473..14892552,14904837..14904913,
FT                   14906055..14906258,14926381..14926490,14996283..14996413))
FT                   /codon_start=1
FT                   /gene="Wwc2"
FT                   /locus_tag="mCG_115484"
FT                   /product="WW, C2 and coiled-coil domain containing 2"
FT                   /note="gene_id=mCG115484.1 transcript_id=mCT116590.1
FT                   protein_id=mCP59949.1"
FT                   /protein_id="EDL35616.1"
FT                   /translation="MPRRAGSGQLPLPRGWEEARDYDGKVFYIDHNTRRTSWIDPRDRL
FT                   TKPLSFADCVGDELPWGWEAGFDPQIGAYYIDHINKTTQIEDPRKQWRGEQEKMLKDYL
FT                   SVAQDALRTQKELYHVKEQRLALALDEYVRLNDAYKEKSSSHTSLFSGSSSSTKYDPDI
FT                   LKAEISTTQLRVKKLKRELSHMKQELLYKQQGFETLQQIDEKMSGGQSGYELNEAKAIL
FT                   TELKSIRKAISSGEKEKQDLMQSLAKLQERFHLDQNMGSSEPDLRSSPVNSHLSLSRQT
FT                   LDAGSQTSISGDIGVRSRSNLAEKVRLSLQYEEAKRSMANLKIELSKLDGEAWPGALDI
FT                   EKEKLMLINEKEELLKELQFITPQKRSQEELERLEAERQHLEEELMAARGSPSRALTER
FT                   LKLEEKRKELLQKLEETTKLTTSLYSQLQSLSSSTLSMSSGSSLGSLASSRGSLNTSSR
FT                   GSLNSLSSSELYYSSQGDQMDTDYQYKLDFLLQEKGGYIPSGPITTIHENEVVKSPSQP
FT                   GQSGLCGVGVTASSHTTPLTEASKSVASLSSRSSLSSLSPPGSPLVLDSVFPGSSHDTS
FT                   PHQFPTDFEDCELSRRFADVGLGENQALLDSDSGGASQPLLEDKGLSDCPGELLCEGAT
FT                   DVEKSLPKRRGLHLRGDKTTRVSAAASDESVAGDSGVYEASMKQPGEMEDVPYSEEDVT
FT                   IVETAQVQIGLRYDTKSSSFMVIIAQLRNLHAFSIPHSSKVYFRVALLPSSADVSCLFR
FT                   TKVHPPTESVLYNDVFRVAVSQAALQQKTLRVDLCSASKHRREECLAGTQISLADLPFS
FT                   NEIFMLWYNLLPSKQMPCKKNEDGNEEPGARSQQPMLDPIDLDAVSALLARTSAELLAV
FT                   EQELAQEEEEEELRPERRGPGRDCLTMLREASDEPAALRESGVPLAEGSRCTEDPKPCP
FT                   RGPETSQCRKEPAEDPGQLPSGLPTLVDKETNTDEVVDSNMAVRPKDRSSLSSRQHPFV
FT                   RNSVIVRSQTFSPGERSQYICRLNRSDSDSSTLAKKSLFVRNSTERRSLRVKRAVCQPT
FT                   LRRTAQECPVRTSLDLELDLQASLTRQSRLNDELQALRGLRQKLEELKAQGETDLPPGV
FT                   LEDERFQKLLKQAEKQAEQTKEEQKQDLNAERLMRQVSKDVCRLREQSQKEPRQVQSFR
FT                   EKIAYFTRAKISIPSLPADDV"
FT   assembly_gap    14837460..14837519
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    14908674..14908841
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    14915773..14916130
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    14940461..14940480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14947207..14947282
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    14961187..14961350
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    14973905..14974600
FT                   /estimated_length=696
FT                   /gap_type="unknown"
FT   assembly_gap    14982043..14982082
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    14997178..14997197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15004371..15004390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15021894..15021913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15043564..15044005
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    15048731..15048750
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15075608..15076836)
FT                   /pseudo
FT                   /locus_tag="mCG_114539"
FT                   /note="gene_id=mCG114539.1"
FT   mRNA            complement(15075608..15076836)
FT                   /pseudo
FT                   /locus_tag="mCG_114539"
FT                   /note="gene_id=mCG114539.1 transcript_id=mCT115631.1
FT                   created on 19-SEP-2002"
FT   assembly_gap    15089176..15089217
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    15092402..15092421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15099750..15099769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15105302..15147836
FT                   /gene="Dctd"
FT                   /locus_tag="mCG_1853"
FT                   /note="gene_id=mCG1853.2"
FT   mRNA            join(15105302..15105379,15117897..15118028,
FT                   15118206..15118341,15143434..15143550,15144958..15145054,
FT                   15146519..15147836)
FT                   /gene="Dctd"
FT                   /locus_tag="mCG_1853"
FT                   /product="dCMP deaminase, transcript variant mCT173506"
FT                   /note="gene_id=mCG1853.2 transcript_id=mCT173506.0 created
FT                   on 19-SEP-2002"
FT   mRNA            join(15116407..15116486,15117897..15118028,
FT                   15118206..15118341,15143434..15143550,15144958..15145054,
FT                   15146519..15147836)
FT                   /gene="Dctd"
FT                   /locus_tag="mCG_1853"
FT                   /product="dCMP deaminase, transcript variant mCT1119"
FT                   /note="gene_id=mCG1853.2 transcript_id=mCT1119.2 created on
FT                   19-SEP-2002"
FT   CDS             join(15117903..15118028,15118206..15118341,
FT                   15143434..15143550,15144958..15145054,15146519..15146597)
FT                   /codon_start=1
FT                   /gene="Dctd"
FT                   /locus_tag="mCG_1853"
FT                   /product="dCMP deaminase, isoform CRA_a"
FT                   /note="gene_id=mCG1853.2 transcript_id=mCT1119.2
FT                   protein_id=mCP20345.2 isoform=CRA_a"
FT                   /db_xref="GOA:G3X908"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="MGI:MGI:2444529"
FT                   /db_xref="UniProtKB/TrEMBL:G3X908"
FT                   /protein_id="EDL35617.1"
FT                   /translation="MTSTPNMSDISCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGA
FT                   CIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADV
FT                   KGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTP
FT                   KYSKIVIDFDSINSRPSQKPQ"
FT   CDS             join(15117903..15118028,15118206..15118341,
FT                   15143434..15143550,15144958..15145054,15146519..15146597)
FT                   /codon_start=1
FT                   /gene="Dctd"
FT                   /locus_tag="mCG_1853"
FT                   /product="dCMP deaminase, isoform CRA_a"
FT                   /note="gene_id=mCG1853.2 transcript_id=mCT173506.0
FT                   protein_id=mCP96425.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X908"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="MGI:MGI:2444529"
FT                   /db_xref="UniProtKB/TrEMBL:G3X908"
FT                   /protein_id="EDL35618.1"
FT                   /translation="MTSTPNMSDISCKKRDDYLEWPEYFMAVAFLSAQRSKDPSSQVGA
FT                   CIVNTENKIVGIGYNGMPNGCSDDLLPWRRTAENKLDTKYPYVCHAELNAIMNKNSADV
FT                   KGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSEETTAARLLFKLAGVTFRKFTP
FT                   KYSKIVIDFDSINSRPSQKPQ"
FT   assembly_gap    15120090..15120404
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    15138413..15138432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15139681..15140891
FT                   /estimated_length=1211
FT                   /gap_type="unknown"
FT   assembly_gap    15142179..15142684
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    15174790..15174992
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    15195440..15196012
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   assembly_gap    15206174..15206193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15212242..15212503
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   gene            complement(15222890..15672298)
FT                   /gene="Odz3"
FT                   /locus_tag="mCG_114540"
FT                   /note="gene_id=mCG114540.2"
FT   mRNA            complement(join(15222890..15226412,15229219..15229349,
FT                   15232501..15234112,15237456..15237752,15251657..15251892,
FT                   15254082..15254257,15273258..15274132,15274895..15275049,
FT                   15276186..15276418,15284254..15284274,15284912..15285161,
FT                   15289240..15289383,15290628..15290895,15295907..15296168,
FT                   15296715..15296834,15297876..15298092,15307744..15307890,
FT                   15310358..15310384,15332725..15332910,15338090..15338290,
FT                   15339393..15339587,15339751..15339852,15340302..15340512,
FT                   15346356..15346570,15364468..15364590,15393308..15393546,
FT                   15415088..15415325,15643899..15644177,15672018..15672298))
FT                   /gene="Odz3"
FT                   /locus_tag="mCG_114540"
FT                   /product="odd Oz/ten-m homolog 3 (Drosophila)"
FT                   /note="gene_id=mCG114540.2 transcript_id=mCT115632.2
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(15225657..15226412,15229219..15229349,
FT                   15232501..15234112,15237456..15237752,15251657..15251892,
FT                   15254082..15254257,15273258..15274132,15274895..15275049,
FT                   15276186..15276418,15284254..15284274,15284912..15285161,
FT                   15289240..15289383,15290628..15290895,15295907..15296168,
FT                   15296715..15296834,15297876..15298092,15307744..15307890,
FT                   15310358..15310384,15332725..15332910,15338090..15338290,
FT                   15339393..15339587,15339751..15339852,15340302..15340512,
FT                   15346356..15346570,15364468..15364590,15393308..15393546,
FT                   15415088..15415325,15643899..15644177,15672018..15672249))
FT                   /codon_start=1
FT                   /gene="Odz3"
FT                   /locus_tag="mCG_114540"
FT                   /product="odd Oz/ten-m homolog 3 (Drosophila)"
FT                   /note="gene_id=mCG114540.2 transcript_id=mCT115632.2
FT                   protein_id=mCP59988.1"
FT                   /db_xref="GOA:G3X907"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR009471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR027689"
FT                   /db_xref="InterPro:IPR028916"
FT                   /db_xref="MGI:MGI:1345183"
FT                   /db_xref="UniProtKB/TrEMBL:G3X907"
FT                   /protein_id="EDL35619.1"
FT                   /translation="MDVKERRPYCSLTKSRREKERRYTNSSADNEECRVPTQKSYSSSE
FT                   TLKAFDHDSSRLLYGNRVKDLVHREADEYTRQGQNFTLRQLGVCESATRRGVAFCAEMG
FT                   LPHRGYSISAGSDADTENEAVMSPEHAMRLWGRGVKSGRSSCLSSRSNSALTLTDTEHE
FT                   NRSDSESEQPSNNPGQPTLQPLPPSHKQHPAQHHPSITSLNRNSLTNRRNQSPAPPAAL
FT                   PAELQTTPESVQLQDSWVLGSNVPLESRHFLFKTGTGTTPLFSTATPGYTMASGSVYSP
FT                   PTRPLPRNTLSRSAFKFKKSSKYCSWRCTALCAVGVSVLLAILLSYFIAMHLFGLNWHL
FT                   QQTENDTFENGKVNSDTVPTNTVSLPSGDNGKLGGFTHENNTIDSGELDIGRRAIQEVP
FT                   PGIFWRSQLFIDQPQFLKFNISLQKDALIGVYGRKGLPPSHTQYDFVELLDGSRLIARE
FT                   QRNLVESERAGRQARSVSLHEAGFIQYLDSGIWHLAFYNDGKNPEQVSFNTIVIESVVE
FT                   CPRNCHGNGECVSGTCHCFPGFLGPDCSRAACPVLCSGNGQYSKGRCLCFSGWKGTECD
FT                   VPTTQCIDPQCGGRGICIMGSCACNSGYKGENCEEADCLDPGCSNHGVCIHGECHCNPG
FT                   WGGSNCEILKTMCADQCSGHGTYLQESGSCTCDPNWTGPDCSNEICSVDCGSHGVCMGG
FT                   SCRCEEGWTGPACNQRACHPRCAEHGTCKDGKCECSQGWNGEHCTIAHYLDKIVKEGCP
FT                   GLCNSNGRCTLDQNGWHCVCQPGWRGAGCDVAMETLCTDSKDNEGDGLIDCMDPDCCLQ
FT                   SSCQNQPYCRGLPDPQDIISQSLQTPSQQAAKSFYDRISFLIGSDSTHVLPGESPFNKS
FT                   LASVIRGQVLTADGTPLIGVNVSFLHYSEYGYTITRQDGMFDLVANGGASLTLVFERSP
FT                   FLTQYHTVWIPWNVFYVMDTLVMKKEENDIPSCDLSGFVRPSPIIVSSPLSTFFRSSPE
FT                   DSPIIPETQVLHEETTIPGTDLKLSYLSSRAAGYKSVLKITMTQAVIPFNLMKVHLMVA
FT                   VVGRLFQKWFPASPNLAYTFIWDKTDAYNQKVYGLSEAVVSVGYEYESCLDLTLWEKRT
FT                   AVLQGYELDASNMGGWTLDKHHVLDVQNGILYKGNGENQFISQQPPVVSSIMGNGRRRS
FT                   ISCPSCNGQADGNKLLAPVALACGIDGSLYVGDFNYVRRIFPSGNVTSVLELRNKDFRH
FT                   SSNPAHRYYLATDPVTGDLYVSDTNTRRIYRPKSLTGAKDLTKNAEVVAGTGEQCLPFD
FT                   EARCGDGGKAVEATLMSPKGMAIDKNGLIYFVDGTMIRKVDQNGIISTLLGSNDLTSAR
FT                   PLTCDTSMHISQVRLEWPTDLAINPMDNSIYVLDNNVVLQITENRQVRIAAGRPMHCQV
FT                   PGVEYPVGKHAVQTTLESATAIAVSYSGVLYITETDEKKINRIRQVTTDGEISLVAGIP
FT                   SECDCKNDANCDCYQSGDGYAKDAKLNAPSSLAASPDGTLYIADLGNIRIRAVSKNKPL
FT                   LNSMNFYEVASPTDQELYIFDINGTHQYTVSLVTGDYLYNFSYSNDNDVTAVTDSNGNT
FT                   LRIRRDPNRMPVRVVSPDNQVIWLTIGTNGCLKSMTAQGLELVLFTYHGNSGLLATKSD
FT                   ETGWTTFFDYDSEGRLTNVTFPTGVVTNLHGDMDKAITVDIESSSREEDVSITSNLSSI
FT                   DSFYTMVQDQLRNSYQIGYDGSLRIFYASGLDSHYQTEPHVLAGTANPTVAKRNMTLPG
FT                   ENGQNLVEWRFRKEQAQGKVNVFGRKLRVNGRNLLSVDFDRTTKTEKIYDDHRKFLLRI
FT                   AYDTSGHPTLWLPSSKLMAVNVTYSSTGQIASIQRGTTSEKVDYDSQGRIVSRVFADGK
FT                   TWSYTYLEKSMVLLLHSQRQYIFEYDMWDRLSAITMPSVARHTMQTIRSIGYYRNIYNP
FT                   PESNASIITDYNEEGLLLQTAFLGTSRRVLFKYRRQTRLSEILYDSTRVSFTYDETAGV
FT                   LKTVNLQSDGFICTIRYRQIGPLIDRQIFRFSEDGMVNARFDYSYDNSFRVTSMQGVIN
FT                   ETPLPIDLYQFDDISGKVEQFGKFGVIYYDINQIISTAVMTYTKHFDAHGRIKEIQYEI
FT                   FRSLMYWITIQYDNMGRVTKREIKIGPFANTTKYAYEYDVDGQLQTVYLNEKIMWRYNY
FT                   DLNGNLHLLNPSSSARLTPLRYDLRDRITRLGDVQYRLDEDGFLRQRGTEIFEYSSKGL
FT                   LTRVYSKGSGWTVIYRYDGLGRRVSSKTSLGQHLQFFYADLTYPTRITHVYNHSSSEIT
FT                   SLYYDLQGHLFAMEISSGDEFYIASDNTGTPLAVFSSNGLMLKQIQYTAYGEIYFDSNV
FT                   DFQLVIGFHGGLYDPLTKLIHFGERDYDILAGRWTTPDIEIWKRIGKDPAPFNLYMFRN
FT                   NNPASKIHDVKDYITDVNSWLVTFGFHLHNAIPGFPVPKFDLTEPSYELVKSQQWEDVP
FT                   PIFGVQQQVARQAKAFLSLGKMAEVQVSRRKAGAEQSWLWFATVKSLIGKGVMLAVSQG
FT                   RVQTNVLNIANEDCIKVAAVLNNAFYLENLHFTIEGKDTHYFIKTTTPESDLGTLRLTS
FT                   GRKALENGINVTVSQSTTVVNGRTRRFADVEMQFGALALHVRYGMTLDEEKARILEQAR
FT                   QRALARAWAREQQRVRDGEEGARLWTEGEKRQLLSAGKVQGYDGYYVLSVEQYPELADS
FT                   ANNIQFLRQSEIGKR"
FT   assembly_gap    15242358..15242377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15244049..15244789
FT                   /estimated_length=741
FT                   /gap_type="unknown"
FT   assembly_gap    15259623..15259678
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    15277426..15277475
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            <15292067..15311126
FT                   /locus_tag="mCG_146081"
FT                   /note="gene_id=mCG146081.0"
FT   mRNA            join(<15292067..15292186,15304916..15305028,
FT                   15306868..15309108,15309358..15309492,15311009..15311126)
FT                   /locus_tag="mCG_146081"
FT                   /product="mCG146081"
FT                   /note="gene_id=mCG146081.0 transcript_id=mCT186184.0
FT                   created on 14-JUL-2003"
FT   CDS             <15307185..15307451
FT                   /codon_start=1
FT                   /locus_tag="mCG_146081"
FT                   /product="mCG146081"
FT                   /note="gene_id=mCG146081.0 transcript_id=mCT186184.0
FT                   protein_id=mCP107774.0"
FT                   /protein_id="EDL35620.1"
FT                   /translation="NTIAWGMCSKGRIIIPSRRLKLGGISQSFHRGVKLRIKRLWNSAS
FT                   RGDCSLWLSSFLLLHPPSPPPLLHRQFSTEEFEKKMSGIVWLV"
FT   assembly_gap    15341403..15341527
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    15387152..15388032
FT                   /estimated_length=881
FT                   /gap_type="unknown"
FT   assembly_gap    15389088..15389256
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    15395289..15395595
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    15402442..15402526
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    15405357..15405427
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    15413760..15413779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15415480..15415499
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15420075..15420094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15469405..15469424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15500498..15500517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15537701..15537770
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    15553371..15553515
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    15562551..15562570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15563792..15563869
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    15570155..15570174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15580770..15581042
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    15594914..15595145
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    15601682..15601701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15604255..15604424
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    15614240..15614646
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    15648084..15649020
FT                   /estimated_length=937
FT                   /gap_type="unknown"
FT   assembly_gap    15722661..15722891
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    15758862..15758881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15761388..15761627
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    15772953..15772972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15794816..15795635
FT                   /estimated_length=820
FT                   /gap_type="unknown"
FT   assembly_gap    15806623..15806642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15840866..15840926
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            <15840967..15842133
FT                   /locus_tag="mCG_1042797"
FT                   /note="gene_id=mCG1042797.0"
FT   mRNA            join(<15840967..15841150,15841398..15841416,
FT                   15841628..15841771,15842094..15842133)
FT                   /locus_tag="mCG_1042797"
FT                   /product="mCG1042797"
FT                   /note="gene_id=mCG1042797.0 transcript_id=mCT160501.1
FT                   created on 14-FEB-2003"
FT   CDS             join(<15840969..15841150,15841398..15841413)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042797"
FT                   /product="mCG1042797"
FT                   /note="gene_id=mCG1042797.0 transcript_id=mCT160501.1
FT                   protein_id=mCP59963.1"
FT                   /protein_id="EDL35621.1"
FT                   /translation="EFTFFFSPARSPSRFPPGPSNLLHRPESRFLGPGSGRMEEAREEG
FT                   EKEKVNRRAGRCAREHHLSR"
FT   assembly_gap    15850956..15850990
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   gene            <15852847..15867322
FT                   /locus_tag="mCG_145540"
FT                   /note="gene_id=mCG145540.0"
FT   mRNA            join(<15852847..15856023,15856644..15856680,
FT                   15861619..15861678,15866063..15867322)
FT                   /locus_tag="mCG_145540"
FT                   /product="mCG145540"
FT                   /note="gene_id=mCG145540.0 transcript_id=mCT184964.0
FT                   created on 05-JUN-2003"
FT   CDS             <15853102..15853407
FT                   /codon_start=1
FT                   /locus_tag="mCG_145540"
FT                   /product="mCG145540"
FT                   /note="gene_id=mCG145540.0 transcript_id=mCT184964.0
FT                   protein_id=mCP106291.0"
FT                   /protein_id="EDL35622.1"
FT                   /translation="TQGIITTHPIINSLYHYFLLYDVTSTRSISTYGYNPISPYSVNVK
FT                   GFIMSNEESMQINLSDLSLVPCHTLPNPHVTPPPPNHISNMSVCLTDRDDWQVDNR"
FT   assembly_gap    15865994..15866013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15896115..15896134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15923841..15923860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15934056..15934200
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    15981912..15987970
FT                   /estimated_length=6059
FT                   /gap_type="unknown"
FT   assembly_gap    16006888..16006920
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    16017912..16017986
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    16030149..16030722
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    16040887..16040906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16069876..16069895
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16072080..16077541
FT                   /estimated_length=5462
FT                   /gap_type="unknown"
FT   assembly_gap    16080606..16080642
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    16085063..16085110
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    16118494..16118513
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16120319..16120338
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16122500..16122905
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    16124781..16124800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16142489..16142708
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   gene            16183509..16183865
FT                   /pseudo
FT                   /locus_tag="mCG_141164"
FT                   /note="gene_id=mCG141164.0"
FT   mRNA            16183509..16183865
FT                   /pseudo
FT                   /locus_tag="mCG_141164"
FT                   /note="gene_id=mCG141164.0 transcript_id=mCT173502.0
FT                   created on 19-SEP-2002"
FT   assembly_gap    16190305..16190324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16192264..16192283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16201588..16201884
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    16214577..16214790
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    16359444..16359631
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   gene            16368320..16515589
FT                   /locus_tag="mCG_1042798"
FT                   /note="gene_id=mCG1042798.1"
FT   mRNA            join(16368320..16368409,16368507..16368536,
FT                   16369382..16369422,16460655..16460821,16492674..16492876,
FT                   16497795..16497854,16499224..16499349)
FT                   /locus_tag="mCG_1042798"
FT                   /product="mCG1042798, transcript variant mCT160502"
FT                   /note="gene_id=mCG1042798.1 transcript_id=mCT160502.0
FT                   created on 19-SEP-2002"
FT   assembly_gap    16374972..16375078
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    16389447..16389466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16427875..16427894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16442674..16442793
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   CDS             join(16460743..16460821,16492674..16492876,
FT                   16497795..16497854,16499224..16499256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042798"
FT                   /product="mCG1042798, isoform CRA_a"
FT                   /note="gene_id=mCG1042798.1 transcript_id=mCT160502.0
FT                   protein_id=mCP59967.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D4V1"
FT                   /db_xref="MGI:MGI:1922609"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4V1"
FT                   /protein_id="EDL35623.1"
FT                   /translation="MEQDQMLQEWEWIVKHIRARGGRCCTGCPSPGNIVSTILIFLLEP
FT                   HRLLGNQFVRAAREDLSKRSPVQLRCQGHETAEHHCAQCHIFSDHLCFVMQCDRLPNVP
FT                   TAMPPLPWWIILENTKIVTQ"
FT   mRNA            join(16482904..16483057,16497795..16497871,
FT                   16515157..16515589)
FT                   /locus_tag="mCG_1042798"
FT                   /product="mCG1042798, transcript variant mCT173501"
FT                   /note="gene_id=mCG1042798.1 transcript_id=mCT173501.0
FT                   created on 19-SEP-2002"
FT   CDS             join(16483050..16483057,16497795..16497871,
FT                   16515157..16515551)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042798"
FT                   /product="mCG1042798, isoform CRA_b"
FT                   /note="gene_id=mCG1042798.1 transcript_id=mCT173501.0
FT                   protein_id=mCP96420.0 isoform=CRA_b"
FT                   /protein_id="EDL35624.1"
FT                   /translation="MLRCSVTGCLMFLLPCLPCHGGLYPFLNGDSRYWQGCGERGILLH
FT                   CWWDCKLVQPLWKSVWLFLRKLDIVLLEDPAIPLLRIYPEDVPTGNKDTCSTVFIAVLF
FT                   IIARRWKEPRCSSTEEWIQKMWYIYTMEYYSALKNNEFMKFLGKWMYLEDNFIVC"
FT   assembly_gap    16492092..16492594
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    16509206..16509400
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    16511187..16511206
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16528904..16528960
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    16540430..16540584
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    16546446..16546465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16574845..16577674
FT                   /estimated_length=2830
FT                   /gap_type="unknown"
FT   assembly_gap    16602262..16602281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16609106..16609125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16656738..16656827
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    16667078..16667097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16707080..16707099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16711273..16712931
FT                   /estimated_length=1659
FT                   /gap_type="unknown"
FT   assembly_gap    16716743..16716782
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    16718219..16718238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16749121..16749205
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    16760621..16760640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16765477..16765693
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   assembly_gap    16787743..16792000
FT                   /estimated_length=4258
FT                   /gap_type="unknown"
FT   assembly_gap    16820042..16820061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16837275..16837294
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16848003..16848022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16851558..16851577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16852601..16852620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16853808..16853827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16938060..16938718)
FT                   /pseudo
FT                   /locus_tag="mCG_16561"
FT                   /note="gene_id=mCG16561.2"
FT   mRNA            complement(16938060..16938718)
FT                   /pseudo
FT                   /locus_tag="mCG_16561"
FT                   /note="gene_id=mCG16561.2 transcript_id=mCT18675.2 created
FT                   on 19-SEP-2002"
FT   gene            complement(16950677..17003986)
FT                   /locus_tag="mCG_148210"
FT                   /note="gene_id=mCG148210.0"
FT   mRNA            complement(join(16950677..16950970,17003868..17003986))
FT                   /locus_tag="mCG_148210"
FT                   /product="mCG148210"
FT                   /note="gene_id=mCG148210.0 transcript_id=mCT188473.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(16950926..16950970,17003868..17003978))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148210"
FT                   /product="mCG148210"
FT                   /note="gene_id=mCG148210.0 transcript_id=mCT188473.0
FT                   protein_id=mCP108789.0"
FT                   /protein_id="EDL35625.1"
FT                   /translation="MRSKSVSSIHPWLLLQPLPPGSCPDRVSVLTSFYEEQTLEAAGKQ
FT                   GCTCWG"
FT   assembly_gap    16979222..16979241
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17015849..17015868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17064075..17064094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17088000..17092255
FT                   /estimated_length=4256
FT                   /gap_type="unknown"
FT   assembly_gap    17114491..17114510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17179116..17179135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17198452..17198471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17232867..17233525
FT                   /estimated_length=659
FT                   /gap_type="unknown"
FT   assembly_gap    17289929..17289962
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    17369887..17369906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17371131..17371259
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   gene            complement(17377226..>17502413)
FT                   /locus_tag="mCG_145542"
FT                   /note="gene_id=mCG145542.0"
FT   mRNA            complement(join(17377226..17377487,17399654..17399689,
FT                   17501858..17501934,17502159..>17502413))
FT                   /locus_tag="mCG_145542"
FT                   /product="mCG145542"
FT                   /note="gene_id=mCG145542.0 transcript_id=mCT184966.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    17440630..17441041
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    17443233..17443252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17454851..17454870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17489056..17489363
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   CDS             complement(join(17501880..17501934,17502159..>17502277))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145542"
FT                   /product="mCG145542"
FT                   /note="gene_id=mCG145542.0 transcript_id=mCT184966.0
FT                   protein_id=mCP106293.0"
FT                   /protein_id="EDL35626.1"
FT                   /translation="PCTCRKHEMTQRVLKKRRELMNLHEKKLLMGNEDVEERKWCYKLG
FT                   NYKKTFLFHVCT"
FT   assembly_gap    17505143..17505393
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    17508478..17508505
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    17520665..17520684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17530146..17530165
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17556554..17556573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17583794..17583813
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17597801..17598504
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    17607207..17608123
FT                   /estimated_length=917
FT                   /gap_type="unknown"
FT   gene            complement(17618968..>17619750)
FT                   /locus_tag="mCG_1042922"
FT                   /note="gene_id=mCG1042922.0"
FT   mRNA            complement(join(17618968..17619230,17619637..>17619750))
FT                   /locus_tag="mCG_1042922"
FT                   /product="mCG1042922"
FT                   /note="gene_id=mCG1042922.0 transcript_id=mCT160626.1
FT                   created on 19-SEP-2002"
FT   CDS             complement(join(17619214..17619230,17619637..>17619748))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042922"
FT                   /product="mCG1042922"
FT                   /note="gene_id=mCG1042922.0 transcript_id=mCT160626.1
FT                   protein_id=mCP59929.1"
FT                   /protein_id="EDL35627.1"
FT                   /translation="LPLHFSVNDIWHPINIVIMLLIVSHLEIVHILPLHAYNLLMW"
FT   assembly_gap    17619231..17619636
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   assembly_gap    17654486..17654505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17688395..17688414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17738988..17739040
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    17751653..17752010
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    17765927..17765958
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   gene            complement(17767236..>17885959)
FT                   /locus_tag="mCG_145543"
FT                   /note="gene_id=mCG145543.0"
FT   mRNA            complement(join(17767236..17769825,17775252..17775289,
FT                   17885948..>17885959))
FT                   /locus_tag="mCG_145543"
FT                   /product="mCG145543"
FT                   /note="gene_id=mCG145543.0 transcript_id=mCT184967.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(17769663..17769825,17775252..17775289,
FT                   17885948..>17885959))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145543"
FT                   /product="mCG145543"
FT                   /note="gene_id=mCG145543.0 transcript_id=mCT184967.0
FT                   protein_id=mCP106294.0"
FT                   /protein_id="EDL35628.1"
FT                   /translation="YIGSDIYIYIYIYIYEKDIQVFSSYYTVSQVKIPVTAASGRPELW
FT                   CPQASALNCTDPHSDAFIYMNMIKI"
FT   assembly_gap    17797359..17797378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17805959..17806101
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    17816810..17816829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17820654..17820934
FT                   /estimated_length=281
FT                   /gap_type="unknown"
FT   assembly_gap    17831062..17831564
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    17873970..17874202
FT                   /estimated_length=233
FT                   /gap_type="unknown"
FT   assembly_gap    17888684..17888703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17942793..17942812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17956504..17956769
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    17957806..17957825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17959646..17959665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17967225..17967244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17973202..17973332
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    17974713..17974967
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    17977493..17977512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17979183..17979202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17981726..17987678
FT                   /estimated_length=5953
FT                   /gap_type="unknown"
FT   assembly_gap    17990223..17997607
FT                   /estimated_length=7385
FT                   /gap_type="unknown"
FT   assembly_gap    17999065..17999084
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18000922..18000941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18002062..18002233
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    18042360..18042379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18053450..18053469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18054674..18054909
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    18055891..18055910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18057108..18057127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18129143..18129162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18130458..18130477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18132313..18132332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18133919..18134456
FT                   /estimated_length=538
FT                   /gap_type="unknown"
FT   assembly_gap    18136787..18136806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18140158..18140791
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   assembly_gap    18142639..18142658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            18143439..18144331
FT                   /locus_tag="mCG_1042829"
FT                   /note="gene_id=mCG1042829.1"
FT   mRNA            18143439..18144331
FT                   /locus_tag="mCG_1042829"
FT                   /product="mCG1042829"
FT                   /note="gene_id=mCG1042829.1 transcript_id=mCT160533.1
FT                   created on 20-SEP-2002"
FT   CDS             18143561..18143824
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042829"
FT                   /product="mCG1042829"
FT                   /note="gene_id=mCG1042829.1 transcript_id=mCT160533.1
FT                   protein_id=mCP59833.1"
FT                   /protein_id="EDL35629.1"
FT                   /translation="MKPTSLFSLITINAMLRSTRNSRILTTPWSDIHLPVHSCSRLGSN
FT                   LIETQLSTAFPLASFFSFQDRCGLELKHCSPVMTIYTPFNGF"
FT   assembly_gap    18145272..18145291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18152190..18152209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18157982..18158621
FT                   /estimated_length=640
FT                   /gap_type="unknown"
FT   assembly_gap    18161089..18161653
FT                   /estimated_length=565
FT                   /gap_type="unknown"
FT   assembly_gap    18181598..18181853
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    18183334..18183353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18185011..18185160
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    18186792..18186811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18188367..18188386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18189985..18190004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18191387..18191406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18193215..18193234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18206680..18206699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18228728..18228747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18290346..18290541
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    18308797..18308816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18309848..18309867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18311869..18311888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18318489..18318718
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    18344347..18344366
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18350729..18350748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18351780..18351799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18352928..18352947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18354026..18354045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18365029..18365048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18377453..18377578
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    18415911..18415930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18416959..18420703
FT                   /estimated_length=3745
FT                   /gap_type="unknown"
FT   assembly_gap    18422788..18422807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18426578..18430039
FT                   /estimated_length=3462
FT                   /gap_type="unknown"
FT   assembly_gap    18447404..18447423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18451261..18451391
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    18462410..18462429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18464431..18464501
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    18465762..18465781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18473538..18473561
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    18498086..18498520
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    18507415..18507539
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    18524246..18524335
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    18576733..18577061
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    18578091..18590939
FT                   /estimated_length=12849
FT                   /gap_type="unknown"
FT   assembly_gap    18603999..18604018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18629449..18629606
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    18639072..18639135
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    18671311..18671777
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    18672693..18672733
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    18674755..18675984
FT                   /estimated_length=1230
FT                   /gap_type="unknown"
FT   assembly_gap    18677642..18677661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18687638..18687706
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    18709451..18709470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18725711..18726163
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   assembly_gap    18736493..18739462
FT                   /estimated_length=2970
FT                   /gap_type="unknown"
FT   assembly_gap    18756099..18756118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18761823..18761842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18778733..18778752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18824107..18824126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18833096..18833115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18836254..18836273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18838115..18838134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18841105..18841283
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    18842591..18842610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18856422..18856441
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18871153..18873262
FT                   /estimated_length=2110
FT                   /gap_type="unknown"
FT   assembly_gap    18898260..18898279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18909836..18909855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18910360..18921945)
FT                   /locus_tag="mCG_1042830"
FT                   /note="gene_id=mCG1042830.1"
FT   mRNA            complement(join(18910360..18910759,18920217..18920461,
FT                   18921357..18921945))
FT                   /locus_tag="mCG_1042830"
FT                   /product="mCG1042830"
FT                   /note="gene_id=mCG1042830.1 transcript_id=mCT160534.1
FT                   created on 20-SEP-2002"
FT   assembly_gap    18910904..18910923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18912032..18912051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(18921575..18921784)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042830"
FT                   /product="mCG1042830"
FT                   /note="gene_id=mCG1042830.1 transcript_id=mCT160534.1
FT                   protein_id=mCP59834.1"
FT                   /protein_id="EDL35630.1"
FT                   /translation="MFSSGSSVTRQLFPLVSMKSCLVMAVGSMWCSRNGWMKAFPTMGR
FT                   STEPTYQHPNVPGRTGSQQQEPLQ"
FT   assembly_gap    18922051..18923315
FT                   /estimated_length=1265
FT                   /gap_type="unknown"
FT   gene            18923330..18924042
FT                   /pseudo
FT                   /locus_tag="mCG_11172"
FT                   /note="gene_id=mCG11172.2"
FT   mRNA            18923330..18924042
FT                   /pseudo
FT                   /locus_tag="mCG_11172"
FT                   /note="gene_id=mCG11172.2 transcript_id=mCT11128.2 created
FT                   on 20-SEP-2002"
FT   assembly_gap    18967684..18967703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18969038..18969057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19007886..19008372
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    19062476..19062572
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   gene            complement(19062935..19069240)
FT                   /locus_tag="mCG_148213"
FT                   /note="gene_id=mCG148213.0"
FT   mRNA            complement(join(19062935..19063244,19066133..19069240))
FT                   /locus_tag="mCG_148213"
FT                   /product="mCG148213"
FT                   /note="gene_id=mCG148213.0 transcript_id=mCT188476.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(19067668..19068030)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148213"
FT                   /product="mCG148213"
FT                   /note="gene_id=mCG148213.0 transcript_id=mCT188476.0
FT                   protein_id=mCP108792.0"
FT                   /protein_id="EDL35631.1"
FT                   /translation="MFSFFTHSVCVCLWCIYEGKYVTSTCVEVKEQLYTIYSFPLRYFT
FT                   FLFFSFLRLLFNYNTSPLLFLPSNMCVCMCVYIFLSTRFQIHWLFILCYFVLIFIACLC
FT                   MYISTCIMINICYLYI"
FT   assembly_gap    19099149..19099244
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    19100681..19101012
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    19134093..19134112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19178095..19178114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19181527..19181546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19182563..19182582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19185968..19185987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19201120..19201139
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19202565..19202863
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    19204088..19204107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19205136..19205155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19208908..19208927
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19237269..19237288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19239928..19239947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19261619..19261638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19269184..19269700
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    19277010..19277029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19280009..19280028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19281183..19281202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19282667..19283154
FT                   /locus_tag="mCG_50594"
FT                   /note="gene_id=mCG50594.1"
FT   mRNA            19282667..19283154
FT                   /locus_tag="mCG_50594"
FT                   /product="mCG50594"
FT                   /note="gene_id=mCG50594.1 transcript_id=mCT50777.1 created
FT                   on 20-SEP-2002"
FT   CDS             19282718..19283134
FT                   /codon_start=1
FT                   /locus_tag="mCG_50594"
FT                   /product="mCG50594"
FT                   /note="gene_id=mCG50594.1 transcript_id=mCT50777.1
FT                   protein_id=mCP36582.0"
FT                   /protein_id="EDL35632.1"
FT                   /translation="MEEIIQRIENVVLDANCSRDVKQMLLKLVELRSSNWGRVHATSTY
FT                   REATPENDPNYFMNEPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSG
FT                   AGDPYLDDIDDEIDPEIEEAYEKFCLESERKRKQ"
FT   assembly_gap    19283400..19283419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19286174..19292445
FT                   /estimated_length=6272
FT                   /gap_type="unknown"
FT   assembly_gap    19295182..19295201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19296938..19296957
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19298189..19298208
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19301522..19301541
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19315614..19315633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19316837..19316970
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   gene            complement(19331708..19332677)
FT                   /pseudo
FT                   /locus_tag="mCG_11171"
FT                   /note="gene_id=mCG11171.1"
FT   mRNA            complement(19331708..19332677)
FT                   /pseudo
FT                   /locus_tag="mCG_11171"
FT                   /note="gene_id=mCG11171.1 transcript_id=mCT11127.2 created
FT                   on 20-SEP-2002"
FT   assembly_gap    19333470..19333489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19334778..19334797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19335873..19335892
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19338513..19339162
FT                   /estimated_length=650
FT                   /gap_type="unknown"
FT   assembly_gap    19344430..19345444
FT                   /estimated_length=1015
FT                   /gap_type="unknown"
FT   assembly_gap    19346211..19346582
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    19347756..19347775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19349446..19349465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19363337..19363356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19408717..19455451
FT                   /locus_tag="mCG_141165"
FT                   /note="gene_id=mCG141165.0"
FT   mRNA            join(19408717..19408914,19410747..19410852,
FT                   19453593..19453687,19455086..19455451)
FT                   /locus_tag="mCG_141165"
FT                   /product="mCG141165"
FT                   /note="gene_id=mCG141165.0 transcript_id=mCT173503.0
FT                   created on 20-SEP-2002"
FT   CDS             join(19408783..19408914,19410747..19410852,
FT                   19453593..19453669)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141165"
FT                   /product="mCG141165"
FT                   /note="gene_id=mCG141165.0 transcript_id=mCT173503.0
FT                   protein_id=mCP96422.0"
FT                   /protein_id="EDL35633.1"
FT                   /translation="MVLHLSCWSGWMQQVVAHKGTSASRERCVSRNSRGQGSRLESSQR
FT                   DSVILMHLRRELLSRRMCWMANGMDQIQCWCRQEGTWMEIFNILIRIYDRHESKYHLFS
FT                   "
FT   assembly_gap    19459400..19459419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19477356..19477375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19497237..19497573
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    19509425..19509616
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    19514617..19515810
FT                   /estimated_length=1194
FT                   /gap_type="unknown"
FT   assembly_gap    19523731..19523906
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    19579889..19580010
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            19580806..19581171
FT                   /pseudo
FT                   /locus_tag="mCG_1042938"
FT                   /note="gene_id=mCG1042938.1"
FT   mRNA            19580806..19581171
FT                   /pseudo
FT                   /locus_tag="mCG_1042938"
FT                   /note="gene_id=mCG1042938.1 transcript_id=mCT160642.1
FT                   created on 20-SEP-2002"
FT   assembly_gap    19597345..19597448
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    19608748..19609042
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    19632321..19632340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19657565..19658523
FT                   /estimated_length=959
FT                   /gap_type="unknown"
FT   assembly_gap    19666073..19666762
FT                   /estimated_length=690
FT                   /gap_type="unknown"
FT   assembly_gap    19722770..19723679
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   assembly_gap    19727756..19727775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19747816..19747941
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    19763745..19764120
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    19789359..19789378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19801359..19802268
FT                   /estimated_length=910
FT                   /gap_type="unknown"
FT   gene            19817978..19818575
FT                   /pseudo
FT                   /locus_tag="mCG_1042800"
FT                   /note="gene_id=mCG1042800.1"
FT   mRNA            19817978..19818575
FT                   /pseudo
FT                   /locus_tag="mCG_1042800"
FT                   /note="gene_id=mCG1042800.1 transcript_id=mCT160504.1
FT                   created on 20-SEP-2002"
FT   assembly_gap    19822811..19827038
FT                   /estimated_length=4228
FT                   /gap_type="unknown"
FT   assembly_gap    19828769..19828788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19829970..19829989
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19831477..19831496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19846917..19846936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19847957..19847976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19851534..19851553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19875773..19875792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19877288..19877307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19894458..19894719
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    19907898..19907917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19934576..19935265
FT                   /estimated_length=690
FT                   /gap_type="unknown"
FT   assembly_gap    19936199..19941309
FT                   /estimated_length=5111
FT                   /gap_type="unknown"
FT   assembly_gap    19945799..19945818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19958959..19959134
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    19996927..19996994
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    19998239..19998258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20003233..20003252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20025451..20026123
FT                   /estimated_length=673
FT                   /gap_type="unknown"
FT   assembly_gap    20038025..20038044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20051964..20052111
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    20080285..20080304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20087792..20087811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20093977..20093996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20098037..20098056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20098587..20098738
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    20133854..20137193
FT                   /estimated_length=3340
FT                   /gap_type="unknown"
FT   assembly_gap    20150640..20150804
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    20199614..20200796
FT                   /estimated_length=1183
FT                   /gap_type="unknown"
FT   assembly_gap    20201882..20206057
FT                   /estimated_length=4176
FT                   /gap_type="unknown"
FT   assembly_gap    20210868..20210887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20215487..20221765
FT                   /estimated_length=6279
FT                   /gap_type="unknown"
FT   assembly_gap    20222958..20222977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20242457..20242476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20252187..20252238
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    20296760..20296779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20313265..20319780
FT                   /estimated_length=6516
FT                   /gap_type="unknown"
FT   assembly_gap    20324048..20324067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20330639..20334765
FT                   /estimated_length=4127
FT                   /gap_type="unknown"
FT   assembly_gap    20337179..20337216
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    20339139..20340297
FT                   /estimated_length=1159
FT                   /gap_type="unknown"
FT   assembly_gap    20380819..20383016
FT                   /estimated_length=2198
FT                   /gap_type="unknown"
FT   assembly_gap    20456620..20456847
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    20490170..20491960
FT                   /estimated_length=1791
FT                   /gap_type="unknown"
FT   assembly_gap    20493689..20495531
FT                   /estimated_length=1843
FT                   /gap_type="unknown"
FT   assembly_gap    20508762..20508781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20509854..20509873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<20534762..>20534911)
FT                   /locus_tag="mCG_48649"
FT                   /note="gene_id=mCG48649.2"
FT   mRNA            complement(<20534762..>20534911)
FT                   /locus_tag="mCG_48649"
FT                   /product="mCG48649"
FT                   /note="gene_id=mCG48649.2 transcript_id=mCT48832.2 created
FT                   on 20-SEP-2002"
FT   CDS             complement(<20534762..20534911)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48649"
FT                   /product="mCG48649"
FT                   /note="gene_id=mCG48649.2 transcript_id=mCT48832.2
FT                   protein_id=mCP31241.2"
FT                   /protein_id="EDL35634.1"
FT                   /translation="MQTFVKTLIGKTIMLEVELLDTIENVKAKIHDKEGIPPDQQNLIF
FT                   VGKHV"
FT   gene            20552350..20564110
FT                   /gene="Aga"
FT                   /locus_tag="mCG_8110"
FT                   /note="gene_id=mCG8110.2"
FT   mRNA            join(20552350..20552576,20554190..20554343,
FT                   20554885..20554997,20556641..20556753,20558451..20558565,
FT                   20559613..20559688,20560934..20561041,20561747..20561880,
FT                   20563865..20564110)
FT                   /gene="Aga"
FT                   /locus_tag="mCG_8110"
FT                   /product="aspartylglucosaminidase, transcript variant
FT                   mCT7153"
FT                   /note="gene_id=mCG8110.2 transcript_id=mCT7153.2 created on
FT                   20-SEP-2002"
FT   mRNA            join(<20552443..20553556,20554190..20554343,
FT                   20554885..20554997,20556641..20556753,20558451..20558565,
FT                   20559313..20559392,20559613..20559688,20560934..20561041,
FT                   20561747..20561880,20563865..20564110)
FT                   /gene="Aga"
FT                   /locus_tag="mCG_8110"
FT                   /product="aspartylglucosaminidase, transcript variant
FT                   mCT193311"
FT                   /note="gene_id=mCG8110.2 transcript_id=mCT193311.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(20552450..20552576,20554190..20554343,
FT                   20554885..20554997,20556641..20556753,20558451..20558565,
FT                   20559613..20559688,20560934..20561041,20561747..20561880,
FT                   20563865..20563965)
FT                   /codon_start=1
FT                   /gene="Aga"
FT                   /locus_tag="mCG_8110"
FT                   /product="aspartylglucosaminidase, isoform CRA_b"
FT                   /note="gene_id=mCG8110.2 transcript_id=mCT7153.2
FT                   protein_id=mCP9013.2 isoform=CRA_b"
FT                   /db_xref="GOA:A2RSS6"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:104873"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSS6"
FT                   /protein_id="EDL35636.1"
FT                   /translation="MERKSNLSLLLLLLVLGMPLVRGSSPLPLVVNTWPFKNATEAAWW
FT                   TLLSGGSALDAVENGCAVCEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVGAVGG
FT                   LRRIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSDWLSRNC
FT                   QPNYWRNVIPDPSKYCGPYKPSGFLKQSISPHKEEVDIHSHDTIGMVVIHKTGHTAAGT
FT                   STNGIKFKIPGRVGDSPIPGAGAYADDTAGAAAATGDGDTLLRFLPSYQAVEYMRGGDD
FT                   PAIACQKVILRIQKYYPNFFGAVICASVNGSYGAACNKLPTFTQFSFMVSNSLHNEPTE
FT                   KKVDCI"
FT   CDS             join(<20553436..20553556,20554190..20554343,
FT                   20554885..20554997,20556641..20556753,20558451..20558565,
FT                   20559313..20559392,20559613..20559624)
FT                   /codon_start=1
FT                   /gene="Aga"
FT                   /locus_tag="mCG_8110"
FT                   /product="aspartylglucosaminidase, isoform CRA_a"
FT                   /note="gene_id=mCG8110.2 transcript_id=mCT193311.0
FT                   protein_id=mCP114296.0 isoform=CRA_a"
FT                   /protein_id="EDL35635.1"
FT                   /translation="NWATSEIYCVALNELLHPCLCFSSENENYNYKILSQKLHEAWWTL
FT                   LSGGSALDAVENGCAVCEKEQCDGTVGFGGSPDEGGETTLDAMIMDGTAMDVGAVGGLR
FT                   RIKNAIGVARRVLEHTTHTLLVGDSATKFAESMGFTNEDLSTKTSRDLHSDWLSRNCQP
FT                   NYWRNVIPDPSKYCGPYKPSGFLKQSISPHKEEVDIHSHDTIVLDVENSKMQTVADSLP
FT                   VAVPFSGSLVAWL"
FT   assembly_gap    20555167..20555186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20588581..20588600
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20596862..20596881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20606745..20606764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20627715..20679999)
FT                   /gene="Neil3"
FT                   /locus_tag="mCG_8111"
FT                   /note="gene_id=mCG8111.2"
FT   mRNA            complement(join(20627715..20628176,20629774..20629948,
FT                   20640070..20640490,20641926..20642095,20646598..20646764,
FT                   20648294..20648368,20649681..20649894,20650374..20650508,
FT                   20664608..20664732,20679753..20679999))
FT                   /gene="Neil3"
FT                   /locus_tag="mCG_8111"
FT                   /product="nei like 3 (E. coli)"
FT                   /note="gene_id=mCG8111.2 transcript_id=mCT7146.2 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(20627994..20628176,20629774..20629948,
FT                   20640070..20640490,20641926..20642095,20646598..20646764,
FT                   20648294..20648368,20649681..20649894,20650374..20650508,
FT                   20664608..20664732,20679753..20679908))
FT                   /codon_start=1
FT                   /gene="Neil3"
FT                   /locus_tag="mCG_8111"
FT                   /product="nei like 3 (E. coli)"
FT                   /note="gene_id=mCG8111.2 transcript_id=mCT7146.2
FT                   protein_id=mCP9004.2"
FT                   /protein_id="EDL35637.1"
FT                   /translation="MVEGPGCTLNGEKIRARVLPGQAVTGVRGTALQSLLGPAMSPAAS
FT                   LADVATSAAPMNAKDSGWKLLRLFNGYVYSGVETLGKELFMYFGPRALRIHFGMKGSIL
FT                   INPREGENRAGASPALAVQLTRDLICFYDSSVELRNSVESQQRVRVMEELDICSPKFSF
FT                   SRAESEVKKQGDRMLCDVLLDQRVLPGVGNIIKNEALFDSGLHPAVKVCQLSDKQACHL
FT                   VKMTRDFSILFYRCCKAGSAISKHCKVYKRPNCDQCHSKITVCRFGENSRMTYFCPHCQ
FT                   KENPQCVQVCQLPTRNTEISWTPRGEDCFTDSVARKSEEQWSCVVCTLINRPSAKACDA
FT                   CLTTRPLDSVLKNRENSIAFNNLVKYPCNNFENTHTEVKINRKTAFGNTTLVLTDLSNK
FT                   SSALARKKRANHTIDGESQMFLPTDIGFSDSQHPSKEGINYITQPSNKVNISPTVCAQS
FT                   KLFSSAHKKFKPAHTSATELKSYNSGLSNSELQTNRTRGHHSKSDGSPLCKMHHRRCVL
FT                   RVVRKDGENKGRQFYACSLPRGAQCGFFEWADLSFPFCRHGKRSIMKTVLKIGPNNGKN
FT                   FFVCPLEKKKQCNFFQWAENGPGMEIVPGC"
FT   assembly_gap    20630114..20630225
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    20637439..20637458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20700084..20700103
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20771286..20771389
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    20780799..20780818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20804950..20805710
FT                   /estimated_length=761
FT                   /gap_type="unknown"
FT   assembly_gap    20808523..20808542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20817878..20817897
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20826985..20827484
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   assembly_gap    20854202..20854221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20855185..20855352
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    20906838..20907166
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    20914051..20914980
FT                   /estimated_length=930
FT                   /gap_type="unknown"
FT   assembly_gap    20945528..20945592
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    20949104..20949227
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   gene            20952431..20953345
FT                   /pseudo
FT                   /locus_tag="mCG_1042801"
FT                   /note="gene_id=mCG1042801.1"
FT   mRNA            20952431..20953345
FT                   /pseudo
FT                   /locus_tag="mCG_1042801"
FT                   /note="gene_id=mCG1042801.1 transcript_id=mCT160505.1
FT                   created on 23-SEP-2002"
FT   assembly_gap    20971084..20971112
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    20971382..20971401
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20993680..20993887
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    20995763..20995890
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    21043064..21043126
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    21057296..21057315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21059702..21059721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21081211..21081230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21086876..21087122
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    21106461..21106480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21117753..21118129
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   gene            21118130..21220819
FT                   /gene="Vegfc"
FT                   /locus_tag="mCG_8109"
FT                   /note="gene_id=mCG8109.3"
FT   mRNA            join(21118130..21118571,21191326..21191527,
FT                   21193653..21193843,21203377..21203528,21215054..21215160,
FT                   21215439..21215772,21220314..21220819)
FT                   /gene="Vegfc"
FT                   /locus_tag="mCG_8109"
FT                   /product="vascular endothelial growth factor C, transcript
FT                   variant mCT7151"
FT                   /note="gene_id=mCG8109.3 transcript_id=mCT7151.3 created on
FT                   14-FEB-2003"
FT   mRNA            join(21118130..21118571,21191326..21191527,
FT                   21193774..21193843,21203377..21203528,21215054..21215160,
FT                   21215439..21215772,21220314..21220819)
FT                   /gene="Vegfc"
FT                   /locus_tag="mCG_8109"
FT                   /product="vascular endothelial growth factor C, transcript
FT                   variant mCT180450"
FT                   /note="gene_id=mCG8109.3 transcript_id=mCT180450.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(21118425..21118571,21191326..21191527,
FT                   21193653..21193843,21203377..21203528,21215054..21215160,
FT                   21215439..21215772,21220314..21220428)
FT                   /codon_start=1
FT                   /gene="Vegfc"
FT                   /locus_tag="mCG_8109"
FT                   /product="vascular endothelial growth factor C, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG8109.3 transcript_id=mCT7151.3
FT                   protein_id=mCP9009.2 isoform=CRA_b"
FT                   /protein_id="EDL35639.1"
FT                   /translation="MHLLCFLSLACSLLAAALIPSPREAPATVAAFESGLGFSEAEPDG
FT                   GEVKAFEGKDLEEQLRSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDSVK
FT                   FAAAHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGAATNTFFKPPCVSVYRCGGCCN
FT                   SEGLQCMNTSTGYLSKTLFEITVPLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIR
FT                   RSLPATLPQCQAANKTCPTNYVWNNYMCRCLAQQDFIFYSNVEDDSTNGFHDVCGPNKE
FT                   LDEDTCQCVCKGGLRPSSCGPHKELDRDSCQCVCKNKLFPNSCGANREFDENTCQCVCK
FT                   RTCPRNQPLNPGKCACECTENTQKCFLKGKKFHHQTCSCYRRPCANRLKHCDPGLSFSE
FT                   EVCRCVPSYWKRPHLN"
FT   CDS             join(21118425..21118571,21191326..21191527,
FT                   21193774..21193814)
FT                   /codon_start=1
FT                   /gene="Vegfc"
FT                   /locus_tag="mCG_8109"
FT                   /product="vascular endothelial growth factor C, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG8109.3 transcript_id=mCT180450.0
FT                   protein_id=mCP103372.0 isoform=CRA_a"
FT                   /db_xref="GOA:P97953"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR004153"
FT                   /db_xref="InterPro:IPR023581"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:109124"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97953"
FT                   /protein_id="EDL35638.1"
FT                   /translation="MHLLCFLSLACSLLAAALIPSPREAPATVAAFESGLGFSEAEPDG
FT                   GEVKAFEGKDLEEQLRSVSSVDELMSVLYPDYWKMYKCQLRKGGWQQPTLNTRTGDSVK
FT                   FAAAHYNTEILKNVGVAATARGCSA"
FT   assembly_gap    21183485..21183504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21225335..21225354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21227204..21227532
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    21253710..21253759
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    21270467..21275320
FT                   /estimated_length=4854
FT                   /gap_type="unknown"
FT   assembly_gap    21277885..21278309
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   assembly_gap    21279726..21279745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21281155..21285905
FT                   /estimated_length=4751
FT                   /gap_type="unknown"
FT   assembly_gap    21288082..21288101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21343497..21343516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21355000..21355048
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    21377536..21377555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21378719..21378823
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    21379937..21379956
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21381225..21381804
FT                   /estimated_length=580
FT                   /gap_type="unknown"
FT   assembly_gap    21409284..21409303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21415363..21415427
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    21432545..21432564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21441449..21441546
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    21487885..21487904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21496215..21496350
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    21529141..21529160
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21535207..21535274
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    21541663..21542874
FT                   /estimated_length=1212
FT                   /gap_type="unknown"
FT   assembly_gap    21546719..21546746
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    21555886..21555984
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    21557528..21558350
FT                   /estimated_length=823
FT                   /gap_type="unknown"
FT   gene            21558985..>21561126
FT                   /locus_tag="mCG_1042940"
FT                   /note="gene_id=mCG1042940.0"
FT   mRNA            join(21558985..21559205,21560578..>21561126)
FT                   /locus_tag="mCG_1042940"
FT                   /product="mCG1042940"
FT                   /note="gene_id=mCG1042940.0 transcript_id=mCT160644.0
FT                   created on 23-SEP-2002"
FT   assembly_gap    21560269..21560301
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   CDS             21560809..>21561126
FT                   /codon_start=1
FT                   /locus_tag="mCG_1042940"
FT                   /product="mCG1042940"
FT                   /note="gene_id=mCG1042940.0 transcript_id=mCT160644.0
FT                   protein_id=mCP59925.1"
FT                   /protein_id="EDL35640.1"
FT                   /translation="MKTWDRVVTDPGATPPIYFYWIIQQSLKRRRRNHECEREKNKSSI
FT                   YKGDSVQGNLCPGHIRHKHFVIYWAPAYQLQDGVLSTGQDTSTTDSLPFEDTNSGNIWV
FT                   AE"
FT   gene            complement(21561284..21570828)
FT                   /locus_tag="mCG_1368"
FT                   /note="gene_id=mCG1368.2"
FT   mRNA            complement(join(21561284..21564239,21565773..21565888,
FT                   21567282..21567423,21570596..21570828))
FT                   /locus_tag="mCG_1368"
FT                   /product="mCG1368, transcript variant mCT173758"
FT                   /note="gene_id=mCG1368.2 transcript_id=mCT173758.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(21561284..21564239,21565773..21565888,
FT                   21567282..21567352,21569168..21569247,21570596..21570828))
FT                   /locus_tag="mCG_1368"
FT                   /product="mCG1368, transcript variant mCT7949"
FT                   /note="gene_id=mCG1368.2 transcript_id=mCT7949.2 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(21564107..21564239,21565773..21565888,
FT                   21567282..21567423,21570596..21570738))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1368"
FT                   /product="mCG1368, isoform CRA_a"
FT                   /note="gene_id=mCG1368.2 transcript_id=mCT173758.0
FT                   protein_id=mCP96677.0 isoform=CRA_a"
FT                   /protein_id="EDL35641.1"
FT                   /translation="MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSR
FT                   IMLIRFVRKLCAAVQSLESLTVGLHLENIFDWNVKQLFLYLSAEYSTKNNALNQVVLWD
FT                   KIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGSGHV
FT                   SVPFPDTYEITKSY"
FT   CDS             complement(join(21564107..21564239,21565773..21565888,
FT                   21567282..21567352,21569168..21569247,21570596..21570738))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1368"
FT                   /product="mCG1368, isoform CRA_b"
FT                   /note="gene_id=mCG1368.2 transcript_id=mCT7949.2
FT                   protein_id=mCP9003.2 isoform=CRA_b"
FT                   /protein_id="EDL35642.1"
FT                   /translation="MNTVLSRANSLFAFSLSVMAALTFGCFITTAFKDRSVPVRLHVSR
FT                   IMLKNVEDFTGPRERSDLGFITFDITADIQNIFDWNVKQLFLYLSAEYSTKNNALNQVV
FT                   LWDKIVLRGDNPKLLLKDMKTKYFFFDDGNGLKGNRNVTLTLSWNVVPNAGILPLVTGS
FT                   GHVSVPFPDTYEITKSY"
FT   gene            21591218..21628675
FT                   /gene="Asb5"
FT                   /locus_tag="mCG_1374"
FT                   /note="gene_id=mCG1374.1"
FT   mRNA            join(21591218..21591529,21621677..21621756,
FT                   21624401..21624508,21625499..21625649,21625819..21625953,
FT                   21626611..21626802,21628074..21628675)
FT                   /gene="Asb5"
FT                   /locus_tag="mCG_1374"
FT                   /product="ankyrin repeat and SOCs box-containing protein 5"
FT                   /note="gene_id=mCG1374.1 transcript_id=mCT7955.2 created on
FT                   23-JUL-2002"
FT   CDS             join(21591334..21591529,21621677..21621756,
FT                   21624401..21624508,21625499..21625649,21625819..21625953,
FT                   21626611..21626802,21628074..21628201)
FT                   /codon_start=1
FT                   /gene="Asb5"
FT                   /locus_tag="mCG_1374"
FT                   /product="ankyrin repeat and SOCs box-containing protein 5"
FT                   /note="gene_id=mCG1374.1 transcript_id=mCT7955.2
FT                   protein_id=mCP9011.1"
FT                   /db_xref="GOA:Q2VPQ8"
FT                   /db_xref="InterPro:IPR001496"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1923544"
FT                   /db_xref="UniProtKB/TrEMBL:Q2VPQ8"
FT                   /protein_id="EDL35643.1"
FT                   /translation="MSVLEESRPFAQQLSNVYFTILSLFCFKLFVKISLAILSHFYIVK
FT                   GNRKEAARIAAEFYGVSQGQGSWADRSPLHEAASQGRLLALRTLLSQGYNVNAVTIDHV
FT                   TPLHEACLGDHVACARTLLEAGANANAITIDGVTPLFNACSQGSASCAELLLEYGAKAQ
FT                   LESCFPSPTHEAASKGHHECLDILIAWGIDVDQDIPHLGTPLYVACMSQQFHCIWKLLY
FT                   AGADVHKGKYWDTPLHAAAQQPSTEIVNLLLEFGADINAKNTDLLRPVDLATSNSAVER
FT                   ILLQHEATPSSLCQLCRLCIRNYIGRQRFHLIPQLQLPTLLQNFLQYR"
FT   assembly_gap    21636700..21636719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21641557..21651320
FT                   /gene="Spata4"
FT                   /locus_tag="mCG_1373"
FT                   /note="gene_id=mCG1373.2"
FT   mRNA            join(21641557..21641793,21642568..21642697,
FT                   21643080..21643198,21643308..21643528,21646729..21646845,
FT                   21650628..21651320)
FT                   /gene="Spata4"
FT                   /locus_tag="mCG_1373"
FT                   /product="spermatogenesis associated 4"
FT                   /note="gene_id=mCG1373.2 transcript_id=mCT7954.2 created on
FT                   24-JUL-2002"
FT   CDS             join(21641579..21641793,21642568..21642697,
FT                   21643080..21643198,21643308..21643528,21646729..21646845,
FT                   21650628..21650713)
FT                   /codon_start=1
FT                   /gene="Spata4"
FT                   /locus_tag="mCG_1373"
FT                   /product="spermatogenesis associated 4"
FT                   /note="gene_id=mCG1373.2 transcript_id=mCT7954.2
FT                   protein_id=mCP9010.1"
FT                   /protein_id="EDL35644.1"
FT                   /translation="MAAAGQAEECLPLPAAESSKTSLPTPPAVPAGKKPKKCLVYPHPP
FT                   RSSRLSRSVLRWLQGLDLSFFPRNVTRDFSNGYLVAEIFCIYYPWDLRLSSFENGTSLK
FT                   VKLDNWAQIEKFLAKKKFKLPKELIHGTIHCKAGVPEILIQEIYTLLTHQEIRSIQDDL
FT                   ANFTDYIYQMRLPLVPRNTVSKSIKNNIRLSELLSNPNVLSNELKIEFLILLQMLQRKL
FT                   SRKLNPGWFDVKPTVGEITIDRLPAHSYKRRYKSRGSKEKAAQPLSKSDNDGNARKEIH
FT                   VKQSGNPCENTENL"
FT   gene            complement(21670391..>21764567)
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /note="gene_id=mCG141204.1"
FT   mRNA            complement(join(21670391..21670679,21673067..21673250,
FT                   21676200..21676298,21679043..21679144,21680206..21680308,
FT                   21680641..21680782,21683919..21684030,21686143..21686163,
FT                   21689025..21689164,21689938..21690037,21692092..21692183,
FT                   21694686..21694818,21698002..21698066,21700391..21700546,
FT                   21701579..21701704,21702023..21702153,21702240..21702389,
FT                   21703656..21703858,21705684..21705848,21709173..21709259,
FT                   21711120..21711202,21713304..21713395,21714349..21714517,
FT                   21722143..21722327,21726195..21726317,21728323..21728574,
FT                   21730801..21731031,21733844..21734027,21737057..21737185,
FT                   21764485..>21764567))
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /product="WD repeat domain 17, transcript variant
FT                   mCT193316"
FT                   /note="gene_id=mCG141204.1 transcript_id=mCT193316.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(21670391..21670679,21673067..21673250,
FT                   21676200..21676298,21679043..21679144,21680206..21680308,
FT                   21680641..21680782,21683919..21684030,21686143..21686163,
FT                   21689025..21689164,21689938..21690037,21692092..21692183,
FT                   21694686..21694818,21698002..21698066,21700391..21700546,
FT                   21701579..21701704,21702023..21702153,21703671..21703858,
FT                   21705684..21705848,21709173..21709301,21711120..21711202,
FT                   21713304..21713395,21714349..21714517,21726220..21726317,
FT                   21728323..21728574,21730801..21730938,21733844..21734027,
FT                   21737057..21737165,21744858..21744963,21764485..21764567))
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /product="WD repeat domain 17, transcript variant
FT                   mCT173757"
FT                   /note="gene_id=mCG141204.1 transcript_id=mCT173757.1
FT                   created on 14-FEB-2003"
FT   mRNA            complement(join(21670391..21670679,21673067..21673250,
FT                   21676200..21676298,21679043..21679144,21680206..21680308,
FT                   21680641..21680782,21683919..21684030,21686143..21686163,
FT                   21689025..21689164,21689938..21690037,21692092..21692183,
FT                   21694686..21694818,21698002..21698066,21700391..21700546,
FT                   21701579..21701704,21702023..21702153,21702240..21702389,
FT                   21703656..21703858,21705684..21705848,21709173..21709259,
FT                   21711120..21711202,21713304..21713395,21714349..21714517,
FT                   21722143..21722327,21726195..21726317,21728323..21728523,
FT                   21730801..21731031,21733844..21734027,21737057..21737185,
FT                   21744858..21744963,21758827..21758880))
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /product="WD repeat domain 17, transcript variant
FT                   mCT180423"
FT                   /note="gene_id=mCG141204.1 transcript_id=mCT180423.0
FT                   created on 14-FEB-2003"
FT   CDS             complement(join(21670560..21670679,21673067..21673250,
FT                   21676200..21676298,21679043..21679144,21680206..21680308,
FT                   21680641..21680782,21683919..21684030,21686143..21686163,
FT                   21689025..21689164,21689938..21690037,21692092..21692183,
FT                   21694686..21694818,21698002..21698066,21700391..21700546,
FT                   21701579..21701704,21702023..21702153,21702240..21702389,
FT                   21703656..21703858,21705684..21705848,21709173..21709259,
FT                   21711120..21711202,21713304..21713395,21714349..21714517,
FT                   21722143..21722327,21726195..21726317,21728323..21728574,
FT                   21730801..21731031,21733844..21734027,21737057..21737185,
FT                   21764485..>21764565))
FT                   /codon_start=1
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /product="WD repeat domain 17, isoform CRA_b"
FT                   /note="gene_id=mCG141204.1 transcript_id=mCT193316.0
FT                   protein_id=mCP114286.0 isoform=CRA_b"
FT                   /protein_id="EDL35646.1"
FT                   /translation="ARARAVPLAGPASAPAVVQSCNCCLLQATMSQVRQVGLLAAGCQP
FT                   WNKDVCAANGDRFAYCATLAIYIYQLDHRYNEFKLHAIMSEHKKTITAISWCPHNPDLF
FT                   ASSSTDNLVIIWNVAEQKVIAKLDNIKETPACLGWCWNTHDAVAFVSQKGPLLIWTISG
FT                   PDSGVSVHKEAHSFASDICIFRWHTQKKGKVAFGHIDGSISIFQPGSKNQKHVLRPDSL
FT                   EGTDEEDPVTALEWDPLSTDYLLVANLHFGIRLLDSESLYCITTFNLPSAAVSVQCLAW
FT                   VPSAPGMFITGDSQVGVLRIWNVSRTTPIDNFKLKKTGFHCFHVVNSPPKKKFSVQSPN
FT                   KNHYISSTSEAVPPPNLTQNQAFSLPPGHVVCCFLDGGVGLYDMGAKKWDFLRELGHVE
FT                   TIFDCKFKPDDPNVLATASFDGTIKVWDINTLTAVYTSPGNEGVIFALSWAPGDLNCIA
FT                   GATSRNGAFIWDIQKGKIIQRFNEHGKNGIFYIAWSHKDSKRIATCSGDGFCIIRTVDG
FT                   KLLHKYKHPAAVFGCDWSQNNKDMIATGCEDKNIRVFYVATSSNQPLKVFSGHTARVFH
FT                   VKWSPLREGILCSGSDDGSVRIWDYTQDACVSTLNGHTAPVRGLMWNTEIPYLLISGSW
FT                   DYTIKVWDTRGGVCLDTVYDHGADVYGLTCHPSRPFTMASCSRDSTVRLWSLIPLITPL
FT                   QINILADRSWDEVIGNTDNAIRQDCPPLLCGKVSRDIKQEVEKLTCNPRAKKLRLFSEC
FT                   LSPPGGSDNLWNLVSVIKGQDDSLLPQNYCKGMMHLKHLIKFRTSEAQELTTIKMSKFG
FT                   GGVGAPTKEKKLKEAAEIHLRLGQIQRYCELMVELGEWDKALSVAPGVSVKYWRKLMQR
FT                   RADQLIQEDKDDVIPYCIATGDVKKLVNFFVSRGQLKEALLVAQAACEGNMQNAHVSTP
FT                   KGASNSDDIHKEDFNELLHKVINELAEWYFQDGQAVLAACCHLAVDDIELAMAYLIRGN
FT                   ELELAVSVGTVLGEPAAPAMHYALQLLATKCMMIPMCFPSVVYRNLAADLLLMTPGSEV
FT                   HLVKLCAFYPGCIEEINDLHKKCNLPPAEECTQLAETARADGNVFETIKYYLLSQEPEK
FT                   ALPIGIDFVKGCISNSNWTLDTVYPVLDLMSYIRTEKLLLHTCTEARNELLILCGYIGA
FT                   LLAIRRQYQSIVPSLYEYTSQLLKRRVVSVPLKIEHLSEELDAWRACTQSTKQSSEDSP
FT                   YTPPSDSQRTVYETLLKRLKEEPLKGITGLDYVTGSNLPSHSDIHISCLTGLKIQGPVY
FT                   FLEDGKSTISLNDALMWAKVNPFSPLGTGIRLNPF"
FT   CDS             complement(join(21670560..21670679,21673067..21673250,
FT                   21676200..21676298,21679043..21679144,21680206..21680308,
FT                   21680641..21680782,21683919..21684030,21686143..21686163,
FT                   21689025..21689164,21689938..21690037,21692092..21692183,
FT                   21694686..21694818,21698002..21698066,21700391..21700546,
FT                   21701579..21701704,21702023..21702153,21702240..21702389,
FT                   21703656..21703858,21705684..21705848,21709173..21709259,
FT                   21711120..21711202,21713304..21713395,21714349..21714517,
FT                   21722143..21722327,21726195..21726317,21728323..21728523,
FT                   21730801..21731031,21733844..21734027,21737057..21737185,
FT                   21744858..21744923))
FT                   /codon_start=1
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /product="WD repeat domain 17, isoform CRA_d"
FT                   /note="gene_id=mCG141204.1 transcript_id=mCT180423.0
FT                   protein_id=mCP103345.0 isoform=CRA_d"
FT                   /db_xref="GOA:G3UVU7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="MGI:MGI:1924662"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVU7"
FT                   /protein_id="EDL35648.1"
FT                   /translation="MAWMTYVSHWFEQDDWYEGLQRATMSQVRQVGLLAAGCQPWNKDV
FT                   CAANGDRFAYCATLAIYIYQLDHRYNEFKLHAIMSEHKKTITAISWCPHNPDLFASSST
FT                   DNLVIIWNVAEQKVIAKLDNIKETPACLGWCWNTHDAVAFVSQKGPLLIWTISGPDSGV
FT                   SVHKEAHSFASDICIFRWHTQKKGKVAFGHIDGSISIFQPDEEDPVTALEWDPLSTDYL
FT                   LVANLHFGIRLLDSESLYCITTFNLPSAAVSVQCLAWVPSAPGMFITGDSQVGVLRIWN
FT                   VSRTTPIDNFKLKKTGFHCFHVVNSPPKKKFSVQSPNKNHYISSTSEAVPPPNLTQNQA
FT                   FSLPPGHVVCCFLDGGVGLYDMGAKKWDFLRELGHVETIFDCKFKPDDPNVLATASFDG
FT                   TIKVWDINTLTAVYTSPGNEGVIFALSWAPGDLNCIAGATSRNGAFIWDIQKGKIIQRF
FT                   NEHGKNGIFYIAWSHKDSKRIATCSGDGFCIIRTVDGKLLHKYKHPAAVFGCDWSQNNK
FT                   DMIATGCEDKNIRVFYVATSSNQPLKVFSGHTARVFHVKWSPLREGILCSGSDDGSVRI
FT                   WDYTQDACVSTLNGHTAPVRGLMWNTEIPYLLISGSWDYTIKVWDTRGGVCLDTVYDHG
FT                   ADVYGLTCHPSRPFTMASCSRDSTVRLWSLIPLITPLQINILADRSWDEVIGNTDNAIR
FT                   QDCPPLLCGKVSRDIKQEVEKLTCNPRAKKLRLFSECLSPPGGSDNLWNLVSVIKGQDD
FT                   SLLPQNYCKGMMHLKHLIKFRTSEAQELTTIKMSKFGGGVGAPTKEKKLKEAAEIHLRL
FT                   GQIQRYCELMVELGEWDKALSVAPGVSVKYWRKLMQRRADQLIQEDKDDVIPYCIATGD
FT                   VKKLVNFFVSRGQLKEALLVAQAACEGNMQNAHVSTPKGASNSDDIHKEDFNELLHKVI
FT                   NELAEWYFQDGQAVLAACCHLAVDDIELAMAYLIRGNELELAVSVGTVLGEPAAPAMHY
FT                   ALQLLATKCMMIPMCFPSVVYRNLAADLLLMTPGSEVHLVKLCAFYPGCIEEINDLHKK
FT                   CNLPPAEECTQLAETARADGNVFETIKYYLLSQEPEKALPIGIDFVKGCISNSNWTLDT
FT                   VYPVLDLMSYIRTEKLLLHTCTEARNELLILCGYIGALLAIRRQYQSIVPSLYEYTSQL
FT                   LKRRVVSVPLKIEHLSEELDAWRACTQSTKQSSEDSPYTPPSDSQRTVYETLLKRLKEE
FT                   PLKGITGLDYVTGSNLPSHSDIHISCLTGLKIQGPVYFLEDGKSTISLNDALMWAKVNP
FT                   FSPLGTGIRLNPF"
FT   CDS             complement(join(21670560..21670679,21673067..21673250,
FT                   21676200..21676298,21679043..21679144,21680206..21680308,
FT                   21680641..21680782,21683919..21684030,21686143..21686163,
FT                   21689025..21689164,21689938..21690037,21692092..21692183,
FT                   21694686..21694818,21698002..21698066,21700391..21700546,
FT                   21701579..21701704,21702023..21702153,21703671..21703858,
FT                   21705684..21705848,21709173..21709301,21711120..21711202,
FT                   21713304..21713395,21714349..21714517,21726220..21726317,
FT                   21728323..21728574,21730801..21730938,21733844..21734027,
FT                   21737057..21737165,21744858..21744883))
FT                   /codon_start=1
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /product="WD repeat domain 17, isoform CRA_c"
FT                   /note="gene_id=mCG141204.1 transcript_id=mCT173757.1
FT                   protein_id=mCP96676.1 isoform=CRA_c"
FT                   /protein_id="EDL35647.1"
FT                   /translation="MIGMKDSKEQVGLLAAGCQPWNKDVCAANGDRFAYCATLAIYIYQ
FT                   LDHRYNEFKLHAIMSEHKKTITAISWCPHNPDLFASSSTDNLVIIWNVAEQKVIAKLDN
FT                   IKGPDSGVSVHKEAHSFASDICIFRWHTQKKGKVAFGHIDGSISIFQPGSKNQKHVLRP
FT                   DSLEGTDEEDPVTALEWDPLSTDYLLVANLHFGIRLLDSESLYCITTFNLPSAAVSVQC
FT                   LAWVPSAPGMFITGDSQVGVLRIWNVSRTTPIDNFKLKKTGFHCFHVGHVETIFDCKFK
FT                   PDDPNVLATASFDGTIKVWDINTLTAVYTSPGNEGVIFALSWAPGDLNCIAGATSRNGA
FT                   FIWDIQKGKIIQRFNEHGKNGIFYIAWSHKDSKRIATCSGDGFCTDLCILQLCLCHFSI
FT                   IRTVDGKLLHKYKHPAAVFGCDWSQNNKDMIATGCEDKNIRVFYVATSSNQPLKVFSGH
FT                   TARVFHVKWSPLREGILCSGSDDGSVRIWDYTQDACVSTLNGHTAPVRGLMWNTEIPYL
FT                   LISGSWDYTIKVWDTRGGVCLDTVYDHDNAIRQDCPPLLCGKVSRDIKQEVEKLTCNPR
FT                   AKKLRLFSECLSPPGGSDNLWNLVSVIKGQDDSLLPQNYCKGMMHLKHLIKFRTSEAQE
FT                   LTTIKMSKFGGGVGAPTKEKKLKEAAEIHLRLGQIQRYCELMVELGEWDKALSVAPGVS
FT                   VKYWRKLMQRRADQLIQEDKDDVIPYCIATGDVKKLVNFFVSRGQLKEALLVAQAACEG
FT                   NMQNAHVSTPKGASNSDDIHKEDFNELLHKVINELAEWYFQDGQAVLAACCHLAVDDIE
FT                   LAMAYLIRGNELELAVSVGTVLGEPAAPAMHYALQLLATKCMMIPMCFPSVVYRNLAAD
FT                   LLLMTPGSEVHLVKLCAFYPGCIEEINDLHKKCNLPPAEECTQLAETARADGNVFETIK
FT                   YYLLSQEPEKALPIGIDFVKGCISNSNWTLDTVYPVLDLMSYIRTEKLLLHTCTEARNE
FT                   LLILCGYIGALLAIRRQYQSIVPSLYEYTSQLLKRRVVSVPLKIEHLSEELDAWRACTQ
FT                   STKQSSEDSPYTPPSDSQRTVYETLLKRLKEEPLKGITGLDYVTGSNLPSHSDIHISCL
FT                   TGLKIQGPVYFLEDGKSTISLNDALMWAKVNPFSPLGTGIRLNPF"
FT   assembly_gap    21679305..21679324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21704462..21704493
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   mRNA            complement(join(21728138..21728574,21730801..21731031,
FT                   21733844..21734027,21737057..21737185,21764485..21764567))
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /product="WD repeat domain 17, transcript variant
FT                   mCT173756"
FT                   /note="gene_id=mCG141204.1 transcript_id=mCT173756.1
FT                   created on 14-FEB-2003"
FT   CDS             complement(join(21728273..21728574,21730801..21731031,
FT                   21733844..21734027,21737057..21737179))
FT                   /codon_start=1
FT                   /gene="Wdr17"
FT                   /locus_tag="mCG_141204"
FT                   /product="WD repeat domain 17, isoform CRA_a"
FT                   /note="gene_id=mCG141204.1 transcript_id=mCT173756.1
FT                   protein_id=mCP96675.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9CXX5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="MGI:MGI:1924662"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CXX5"
FT                   /protein_id="EDL35645.1"
FT                   /translation="MSQVRQVGLLAAGCQPWNKDVCAANGDRFAYCATLAIYIYQLDHR
FT                   YNEFKLHAIMSEHKKTITAISWCPHNPDLFASSSTDNLVIIWNVAEQKVIAKLDNIKET
FT                   PACLGWCWNTHDAVAFVSQKGPLLIWTISGPDSGVSVHKEAHSFASDICIFRWHTQKKG
FT                   KVAFGHIDGSISIFQPGSKNQKHVLRPDSLEGTDEEDPVTALEWDPLSTDYLLVANLHF
FT                   GIRLLDSESLYCITTFNLPSAAVSVQCLAWVPSAPGMFITGGKCVHIPESFKYGNFP"
FT   assembly_gap    21742582..21742601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21749594..21749613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21751501..21751520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21773323..21773342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21774761..21774831
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    21788245..21788676
FT                   /estimated_length=432
FT                   /gap_type="unknown"
FT   assembly_gap    21803755..21803774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <21818948..22083832
FT                   /gene="Gpm6a"
FT                   /locus_tag="mCG_1375"
FT                   /note="gene_id=mCG1375.2"
FT   mRNA            join(<21818948..21818984,22060119..22060311,
FT                   22070026..22070182,22072895..22073048,22077561..22077637,
FT                   22078165..22078230,22081570..22083832)
FT                   /gene="Gpm6a"
FT                   /locus_tag="mCG_1375"
FT                   /product="glycoprotein m6a, transcript variant mCT173759"
FT                   /note="gene_id=mCG1375.2 transcript_id=mCT173759.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(<21818948..21818984,22060119..22060311,
FT                   22070026..22070182,22072895..22073048,22077561..22077637,
FT                   22078165..22078230,22081570..22081722)
FT                   /codon_start=1
FT                   /gene="Gpm6a"
FT                   /locus_tag="mCG_1375"
FT                   /product="glycoprotein m6a, isoform CRA_a"
FT                   /note="gene_id=mCG1375.2 transcript_id=mCT173759.0
FT                   protein_id=mCP96678.0 isoform=CRA_a"
FT                   /protein_id="EDL35649.1"
FT                   /translation="GTSGEEGRLLDMGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
FT   assembly_gap    21838070..21838235
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    21843200..21843238
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    21912223..21912242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21914300..21914513
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    21915802..21915886
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    21946465..21946709
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    21959856..21961920
FT                   /estimated_length=2065
FT                   /gap_type="unknown"
FT   assembly_gap    21967505..21967524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(21977876..21978293,22060119..22060311,
FT                   22070026..22070182,22072895..22073048,22077561..22077637,
FT                   22078165..22078230,22081570..22083832)
FT                   /gene="Gpm6a"
FT                   /locus_tag="mCG_1375"
FT                   /product="glycoprotein m6a, transcript variant mCT7956"
FT                   /note="gene_id=mCG1375.2 transcript_id=mCT7956.2 created on
FT                   23-SEP-2002"
FT   CDS             join(21978257..21978293,22060119..22060311,
FT                   22070026..22070182,22072895..22073048,22077561..22077637,
FT                   22078165..22078230,22081570..22081722)
FT                   /codon_start=1
FT                   /gene="Gpm6a"
FT                   /locus_tag="mCG_1375"
FT                   /product="glycoprotein m6a, isoform CRA_b"
FT                   /note="gene_id=mCG1375.2 transcript_id=mCT7956.2
FT                   protein_id=mCP9012.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q542P2"
FT                   /db_xref="InterPro:IPR001614"
FT                   /db_xref="InterPro:IPR018237"
FT                   /db_xref="MGI:MGI:107671"
FT                   /db_xref="UniProtKB/TrEMBL:Q542P2"
FT                   /protein_id="EDL35650.1"
FT                   /translation="MEENMEEGQTQKGCFECCIKCLGGIPYASLIATILLYAGVALFCG
FT                   CGHEALSGTVNILQTYFELARTAGDTLDVFTMIDIFKYVIYGIAAAFFVYGILLMVEGF
FT                   FTTGAIKDLYGDFKITTCGRCVSAWFIMLTYLFMLAWLGVTAFTSLPVYMYFNVWTICR
FT                   NTTLVEGANLCLDLRQFGIVTIGEEKKICTASENFLRMCESTELNMTFHLFIVALAGAG
FT                   AAVIAMVHYLMVLSANWAYVKDACRMQKYEDIKSKEEQELHDIHSTRSKERLNAYT"
FT   assembly_gap    21990264..21990283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22054666..22056212
FT                   /estimated_length=1547
FT                   /gap_type="unknown"
FT   gene            complement(22102768..22104820)
FT                   /pseudo
FT                   /locus_tag="mCG_1042802"
FT                   /note="gene_id=mCG1042802.1"
FT   mRNA            complement(22102768..22104820)
FT                   /pseudo
FT                   /locus_tag="mCG_1042802"
FT                   /note="gene_id=mCG1042802.1 transcript_id=mCT160506.1
FT                   created on 23-SEP-2002"
FT   assembly_gap    22109386..22109695
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    22117485..22117504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22127547..22127768
FT                   /estimated_length=222
FT                   /gap_type="unknown"
XX
CO   join(AAHY01069261.1:1..1120,gap(5059),AAHY01069262.1:1..4113,gap(5353),
CO   complement(AAHY01069263.1:1..3850),gap(5737),
CO   complement(AAHY01069264.1:1..2281),gap(9764),AAHY01069265.1:1..13341,
CO   gap(780),AAHY01069266.1:1..22153,gap(348),AAHY01069267.1:1..16916,gap(20),
CO   AAHY01069268.1:1..18835,gap(203),complement(AAHY01069269.1:1..1924),
CO   gap(1121),AAHY01069270.1:1..1582,gap(1945),
CO   complement(AAHY01069271.1:1..1540),gap(689),AAHY01069272.1:1..2118,gap(83),
CO   complement(AAHY01069273.1:1..2352),gap(20),AAHY01069274.1:1..8575,
CO   gap(1299),AAHY01069275.1:1..3054,gap(750),AAHY01069276.1:1..4031,gap(5718),
CO   AAHY01069277.1:1..2556,gap(20),complement(AAHY01069278.1:1..1954),gap(20),
CO   AAHY01069279.1:1..1411,gap(20),AAHY01069280.1:1..3159,gap(393),
CO   AAHY01069281.1:1..5556,gap(463),AAHY01069282.1:1..5052,gap(20),
CO   AAHY01069283.1:1..2389,gap(14439),AAHY01069284.1:1..2528,gap(917),
CO   AAHY01069285.1:1..602,gap(233),AAHY01069286.1:1..2755,gap(119),
CO   AAHY01069287.1:1..12748,gap(20),complement(AAHY01069288.1:1..1368),gap(20),
CO   complement(AAHY01069289.1:1..2528),gap(20),
CO   complement(AAHY01069290.1:1..2468),gap(20),AAHY01069291.1:1..1141,gap(20),
CO   AAHY01069292.1:1..2292,gap(20),AAHY01069293.1:1..1790,gap(20),
CO   AAHY01069294.1:1..1272,gap(1962),AAHY01069295.1:1..1919,gap(20),
CO   complement(AAHY01069296.1:1..1235),gap(20),AAHY01069297.1:1..6140,gap(20),
CO   complement(AAHY01069298.1:1..1341),gap(20),AAHY01069299.1:1..1959,gap(281),
CO   AAHY01069300.1:1..10140,gap(20),AAHY01069301.1:1..61221,gap(20),
CO   AAHY01069302.1:1..3484,gap(20),AAHY01069303.1:1..44059,gap(196),
CO   AAHY01069304.1:1..3732,gap(20),complement(AAHY01069305.1:1..30685),gap(20),
CO   complement(AAHY01069306.1:1..18072),gap(244),AAHY01069307.1:1..8168,
CO   gap(206),complement(AAHY01069308.1:1..11560),gap(89),
CO   AAHY01069309.1:1..25079,gap(20),AAHY01069310.1:1..2233,gap(650),
CO   complement(AAHY01069311.1:1..14781),gap(20),AAHY01069312.1:1..53059,
CO   gap(20),AAHY01069313.1:1..16569,gap(20),AAHY01069314.1:1..24005,gap(1126),
CO   AAHY01069315.1:1..7024,gap(20),AAHY01069316.1:1..20086,gap(20),
CO   AAHY01069317.1:1..5901,gap(42),complement(AAHY01069318.1:1..7413),gap(20),
CO   complement(AAHY01069319.1:1..2300),gap(20),
CO   complement(AAHY01069320.1:1..12753),gap(476),
CO   complement(AAHY01069321.1:1..14024),gap(20),
CO   complement(AAHY01069322.1:1..1023),gap(1622),AAHY01069323.1:1..34498,
CO   gap(20),AAHY01069324.1:1..3330,gap(5329),
CO   complement(AAHY01069325.1:1..5721),gap(191),
CO   complement(AAHY01069326.1:1..18262),gap(128),AAHY01069327.1:1..1083,
CO   gap(20),AAHY01069328.1:1..2105,gap(145),complement(AAHY01069329.1:1..2214),
CO   gap(20),AAHY01069330.1:1..24277,gap(20),AAHY01069331.1:1..22163,gap(20),
CO   AAHY01069332.1:1..23373,gap(20),AAHY01069333.1:1..13166,gap(20),
CO   complement(AAHY01069334.1:1..2106),gap(20),AAHY01069335.1:1..3999,gap(363),
CO   AAHY01069336.1:1..1030,gap(88),AAHY01069337.1:1..1596,gap(20),
CO   AAHY01069338.1:1..1667,gap(2508),AAHY01069339.1:1..1079,gap(20),
CO   complement(AAHY01069340.1:1..4047),gap(20),
CO   complement(AAHY01069341.1:1..1298),gap(20),AAHY01069342.1:1..8530,gap(209),
CO   AAHY01069343.1:1..23125,gap(20),complement(AAHY01069344.1:1..2595),
CO   gap(370),complement(AAHY01069345.1:1..4155),gap(86),
CO   complement(AAHY01069346.1:1..18604),gap(141),AAHY01069347.1:1..14090,
CO   gap(170),complement(AAHY01069348.1:1..19703),gap(20),
CO   complement(AAHY01069349.1:1..1335),gap(905),
CO   complement(AAHY01069350.1:1..5253),gap(232),
CO   complement(AAHY01069351.1:1..12593),gap(134),AAHY01069352.1:1..2020,
CO   gap(167),AAHY01069353.1:1..10691,gap(57),AAHY01069354.1:1..3499,gap(228),
CO   AAHY01069355.1:1..2169,gap(340),complement(AAHY01069356.1:1..4721),
CO   gap(839),AAHY01069357.1:1..2275,gap(1164),
CO   complement(AAHY01069358.1:1..6648),gap(78),
CO   complement(AAHY01069359.1:1..2472),gap(20),
CO   complement(AAHY01069360.1:1..12449),gap(1309),
CO   complement(AAHY01069361.1:1..1643),gap(20),
CO   complement(AAHY01069362.1:1..5509),gap(17151),
CO   complement(AAHY01069363.1:1..3771),gap(88),
CO   complement(AAHY01069364.1:1..13539),gap(515),
CO   complement(AAHY01069365.1:1..10362),gap(20),AAHY01069366.1:1..12277,
CO   gap(20),complement(AAHY01069367.1:1..767),gap(67),
CO   complement(AAHY01069368.1:1..7550),gap(20),AAHY01069369.1:1..3656,
CO   gap(1989),complement(AAHY01069370.1:1..7836),gap(383),
CO   complement(AAHY01069371.1:1..3521),gap(20),AAHY01069372.1:1..13381,gap(20),
CO   AAHY01069373.1:1..15425,gap(549),AAHY01069374.1:1..4494,gap(250),
CO   AAHY01069375.1:1..10564,gap(239),AAHY01069376.1:1..8152,gap(235),
CO   AAHY01069377.1:1..6395,gap(20),AAHY01069378.1:1..1007,gap(890),
CO   AAHY01069379.1:1..3801,gap(5588),complement(AAHY01069380.1:1..6228),
CO   gap(417),complement(AAHY01069381.1:1..19330),gap(113),
CO   complement(AAHY01069382.1:1..13309),gap(20),AAHY01069383.1:1..8992,gap(20),
CO   AAHY01069384.1:1..28978,gap(20),AAHY01069385.1:1..4516,gap(20),
CO   complement(AAHY01069386.1:1..7358),gap(108),
CO   complement(AAHY01069387.1:1..15997),gap(87),AAHY01069388.1:1..5455,
CO   gap(453),AAHY01069389.1:1..9966,gap(134),
CO   complement(AAHY01069390.1:1..5693),gap(400),
CO   complement(AAHY01069391.1:1..5872),gap(150),
CO   complement(AAHY01069392.1:1..2588),gap(312),
CO   complement(AAHY01069393.1:1..4137),gap(58),
CO   complement(AAHY01069394.1:1..11874),gap(22),
CO   complement(AAHY01069395.1:1..2039),gap(20),
CO   complement(AAHY01069396.1:1..22695),gap(201),AAHY01069397.1:1..20429,
CO   gap(3095),AAHY01069398.1:1..6430,gap(20),
CO   complement(AAHY01069399.1:1..25760),gap(20),
CO   complement(AAHY01069400.1:1..6577),gap(119),
CO   complement(AAHY01069401.1:1..6879),gap(20),AAHY01069402.1:1..4217,gap(262),
CO   AAHY01069403.1:1..9558,gap(1306),complement(AAHY01069404.1:1..2098),
CO   gap(348),complement(AAHY01069405.1:1..3176),gap(107),
CO   complement(AAHY01069406.1:1..18510),gap(669),AAHY01069407.1:1..17651,
CO   gap(129),AAHY01069408.1:1..676,gap(5417),AAHY01069409.1:1..10516,gap(687),
CO   AAHY01069410.1:1..4672,gap(20),AAHY01069411.1:1..2353,gap(134),
CO   AAHY01069412.1:1..6774,gap(1502),AAHY01069413.1:1..11626,gap(20),
CO   AAHY01069414.1:1..7635,gap(3013),complement(AAHY01069415.1:1..595),
CO   gap(306),AAHY01069416.1:1..23305,gap(23),
CO   complement(AAHY01069417.1:1..1936),gap(20),
CO   complement(AAHY01069418.1:1..24893),gap(20),
CO   complement(AAHY01069419.1:1..1246),gap(20),AAHY01069420.1:1..1055,gap(20),
CO   AAHY01069421.1:1..2170,gap(20),AAHY01069422.1:1..4479,gap(652),
CO   AAHY01069423.1:1..15465,gap(20),AAHY01069424.1:1..9049,gap(20),
CO   AAHY01069425.1:1..3841,gap(20),complement(AAHY01069426.1:1..6347),gap(494),
CO   AAHY01069427.1:1..1542,gap(248),AAHY01069428.1:1..22827,gap(20),
CO   AAHY01069429.1:1..1436,gap(20),complement(AAHY01069430.1:1..4501),gap(20),
CO   complement(AAHY01069431.1:1..7436),gap(310),
CO   complement(AAHY01069432.1:1..879),gap(292),
CO   complement(AAHY01069433.1:1..8630),gap(32),AAHY01069434.1:1..4905,gap(20),
CO   AAHY01069435.1:1..24991,gap(124),complement(AAHY01069436.1:1..3033),
CO   gap(120),AAHY01069437.1:1..4977,gap(20),AAHY01069438.1:1..12235,gap(314),
CO   AAHY01069439.1:1..15699,gap(898),AAHY01069440.1:1..1581,gap(879),
CO   AAHY01069441.1:1..3142,gap(20),AAHY01069442.1:1..7819,gap(20),
CO   AAHY01069443.1:1..1620,gap(1532),complement(AAHY01069444.1:1..1348),
CO   gap(20),AAHY01069445.1:1..1020,gap(20),AAHY01069446.1:1..1990,gap(3576),
CO   AAHY01069447.1:1..4948,gap(5520),AAHY01069448.1:1..49479,gap(20),
CO   complement(AAHY01069449.1:1..3668),gap(20),AAHY01069450.1:1..30160,gap(20),
CO   AAHY01069451.1:1..1349,gap(20),AAHY01069452.1:1..48244,gap(112),
CO   AAHY01069453.1:1..41682,gap(20),AAHY01069454.1:1..9899,gap(20),
CO   AAHY01069455.1:1..6939,gap(24),AAHY01069456.1:1..22082,gap(22),
CO   AAHY01069457.1:1..1724,gap(20),AAHY01069458.1:1..24210,gap(20),
CO   complement(AAHY01069459.1:1..1416),gap(20),AAHY01069460.1:1..1039,gap(20),
CO   AAHY01069461.1:1..9209,gap(509),AAHY01069462.1:1..5757,gap(253),
CO   AAHY01069463.1:1..17429,gap(139),AAHY01069464.1:1..2715,gap(20),
CO   complement(AAHY01069465.1:1..5194),gap(20),AAHY01069466.1:1..2570,gap(558),
CO   AAHY01069467.1:1..9627,gap(20),AAHY01069468.1:1..3164,gap(20),
CO   AAHY01069469.1:1..23864,gap(195),AAHY01069470.1:1..13831,gap(1174),
CO   complement(AAHY01069471.1:1..2194),gap(165),AAHY01069472.1:1..13354,
CO   gap(120),AAHY01069473.1:1..1555,gap(4298),AAHY01069474.1:1..4648,gap(20),
CO   AAHY01069475.1:1..5862,gap(2923),AAHY01069476.1:1..1437,gap(179),
CO   complement(AAHY01069477.1:1..24767),gap(20),AAHY01069478.1:1..1539,
CO   gap(1251),AAHY01069479.1:1..3999,gap(1015),AAHY01069480.1:1..854,gap(498),
CO   AAHY01069481.1:1..4555,gap(20),complement(AAHY01069482.1:1..1268),
CO   gap(6314),complement(AAHY01069483.1:1..8258),gap(178),
CO   complement(AAHY01069484.1:1..11106),gap(20),AAHY01069485.1:1..12372,
CO   gap(370),AAHY01069486.1:1..4825,gap(20),complement(AAHY01069487.1:1..8329),
CO   gap(20),AAHY01069488.1:1..11644,gap(159),
CO   complement(AAHY01069489.1:1..2620),gap(147),AAHY01069490.1:1..2741,gap(20),
CO   AAHY01069491.1:1..1647,gap(237),AAHY01069492.1:1..10944,gap(20),
CO   AAHY01069493.1:1..3728,gap(259),AAHY01069494.1:1..8424,gap(152),
CO   AAHY01069495.1:1..16286,gap(227),AAHY01069496.1:1..22031,gap(20),
CO   AAHY01069497.1:1..6296,gap(224),AAHY01069498.1:1..4436,gap(634),
CO   AAHY01069499.1:1..2182,gap(231),AAHY01069500.1:1..1170,gap(312),
CO   AAHY01069501.1:1..21873,gap(651),AAHY01069502.1:1..11386,gap(56),
CO   AAHY01069503.1:1..5086,gap(351),complement(AAHY01069504.1:1..3754),gap(20),
CO   AAHY01069505.1:1..9820,gap(162),AAHY01069506.1:1..8880,gap(20),
CO   complement(AAHY01069507.1:1..3950),gap(20),
CO   complement(AAHY01069508.1:1..3219),gap(20),AAHY01069509.1:1..20644,
CO   gap(430),complement(AAHY01069510.1:1..6016),gap(339),
CO   AAHY01069511.1:1..6960,gap(20),AAHY01069512.1:1..53399,gap(3151),
CO   AAHY01069513.1:1..37289,gap(20),AAHY01069514.1:1..2045,gap(20),
CO   AAHY01069515.1:1..2612,gap(4705),AAHY01069516.1:1..2129,gap(911),
CO   AAHY01069517.1:1..32816,gap(223),AAHY01069518.1:1..10262,gap(65),
CO   complement(AAHY01069519.1:1..7369),gap(20),AAHY01069520.1:1..4251,gap(104),
CO   AAHY01069521.1:1..21001,gap(533),AAHY01069522.1:1..12662,gap(20),
CO   AAHY01069523.1:1..46924,gap(20),AAHY01069524.1:1..14624,gap(20),
CO   AAHY01069525.1:1..13235,gap(20),AAHY01069526.1:1..2417,gap(659),
CO   complement(AAHY01069527.1:1..4826),gap(20),AAHY01069528.1:1..6973,gap(107),
CO   AAHY01069529.1:1..7075,gap(20),AAHY01069530.1:1..20019,gap(132),
CO   complement(AAHY01069531.1:1..41384),gap(20),AAHY01069532.1:1..2174,
CO   gap(1113),complement(AAHY01069533.1:1..1009),gap(29),
CO   complement(AAHY01069534.1:1..26003),gap(241),AAHY01069535.1:1..5760,
CO   gap(20),complement(AAHY01069536.1:1..3680),gap(61),
CO   complement(AAHY01069537.1:1..8487),gap(20),AAHY01069538.1:1..23283,gap(25),
CO   AAHY01069539.1:1..28453,gap(279),AAHY01069540.1:1..24941,gap(5328),
CO   AAHY01069541.1:1..1664,gap(924),AAHY01069542.1:1..32857,gap(373),
CO   AAHY01069543.1:1..7817,gap(20),AAHY01069544.1:1..6271,gap(637),
CO   AAHY01069545.1:1..38771,gap(82),AAHY01069546.1:1..39131,gap(20),
CO   AAHY01069547.1:1..7806,gap(70),AAHY01069548.1:1..50333,gap(217),
CO   complement(AAHY01069549.1:1..16524),gap(20),AAHY01069550.1:1..1224,
CO   gap(1568),complement(AAHY01069551.1:1..3780),gap(20),
CO   AAHY01069552.1:1..46525,gap(454),complement(AAHY01069553.1:1..4374),
CO   gap(20),AAHY01069554.1:1..19474,gap(549),AAHY01069555.1:1..32020,gap(20),
CO   AAHY01069556.1:1..7811,gap(135),complement(AAHY01069557.1:1..20602),
CO   gap(20),complement(AAHY01069558.1:1..1838),gap(175),AAHY01069559.1:1..7463,
CO   gap(20),complement(AAHY01069560.1:1..22937),gap(80),
CO   complement(AAHY01069561.1:1..11912),gap(71),AAHY01069562.1:1..4595,gap(42),
CO   complement(AAHY01069563.1:1..7036),gap(473),
CO   complement(AAHY01069564.1:1..1722),gap(721),
CO   complement(AAHY01069565.1:1..17806),gap(20),
CO   complement(AAHY01069566.1:1..2116),gap(20),AAHY01069567.1:1..18825,
CO   gap(281),complement(AAHY01069568.1:1..3892),gap(20),
CO   complement(AAHY01069569.1:1..1110),gap(14265),AAHY01069570.1:1..1936,
CO   gap(157),complement(AAHY01069571.1:1..861),gap(49),AAHY01069572.1:1..20861,
CO   gap(220),AAHY01069573.1:1..27885,gap(20),AAHY01069574.1:1..5714,gap(100),
CO   AAHY01069575.1:1..8819,gap(20),complement(AAHY01069576.1:1..1104),gap(20),
CO   AAHY01069577.1:1..26723,gap(297),complement(AAHY01069578.1:1..1125),
CO   gap(73),complement(AAHY01069579.1:1..15461),gap(20),AAHY01069580.1:1..5553,
CO   gap(20),AAHY01069581.1:1..5215,gap(20),AAHY01069582.1:1..3523,gap(20),
CO   complement(AAHY01069583.1:1..1138),gap(20),AAHY01069584.1:1..31447,
CO   gap(1452),complement(AAHY01069585.1:1..1608),gap(128),
CO   AAHY01069586.1:1..4539,gap(71),AAHY01069587.1:1..27508,gap(20),
CO   AAHY01069588.1:1..3656,gap(20),AAHY01069589.1:1..6068,gap(103),
CO   AAHY01069590.1:1..6905,gap(77),AAHY01069591.1:1..9296,gap(88),
CO   AAHY01069592.1:1..6522,gap(38),complement(AAHY01069593.1:1..1563),gap(261),
CO   AAHY01069594.1:1..2750,gap(20),AAHY01069595.1:1..6544,gap(5412),
CO   AAHY01069596.1:1..17082,gap(20),AAHY01069597.1:1..2072,gap(269),
CO   AAHY01069598.1:1..12402,gap(20),AAHY01069599.1:1..1109,gap(188),
CO   AAHY01069600.1:1..25412,gap(20),AAHY01069601.1:1..23318,gap(20),
CO   AAHY01069602.1:1..2761,gap(20),complement(AAHY01069603.1:1..2254),gap(46),
CO   AAHY01069604.1:1..12830,gap(170),complement(AAHY01069605.1:1..3587),
CO   gap(20),complement(AAHY01069606.1:1..1120),gap(20),AAHY01069607.1:1..19453,
CO   gap(20),AAHY01069608.1:1..1068,gap(20),complement(AAHY01069609.1:1..1154),
CO   gap(20),complement(AAHY01069610.1:1..1101),gap(20),
CO   complement(AAHY01069611.1:1..2987),gap(20),AAHY01069612.1:1..32468,gap(20),
CO   AAHY01069613.1:1..44345,gap(654),complement(AAHY01069614.1:1..3206),
CO   gap(359),AAHY01069615.1:1..13939,gap(80),
CO   complement(AAHY01069616.1:1..2986),gap(315),
CO   complement(AAHY01069617.1:1..995),gap(64),
CO   complement(AAHY01069618.1:1..16528),gap(20),AAHY01069619.1:1..13568,
CO   gap(20),AAHY01069620.1:1..888,gap(153),complement(AAHY01069621.1:1..2750),
CO   gap(86),complement(AAHY01069622.1:1..19876),gap(182),
CO   AAHY01069623.1:1..55134,gap(97),AAHY01069624.1:1..61523,gap(5470),
CO   AAHY01069625.1:1..26491,gap(20),AAHY01069626.1:1..11827,gap(20),
CO   AAHY01069627.1:1..8021,gap(20),AAHY01069628.1:1..1236,gap(607),
CO   AAHY01069629.1:1..4225,gap(20),AAHY01069630.1:1..4766,gap(116),
CO   complement(AAHY01069631.1:1..1054),gap(849),AAHY01069632.1:1..9820,
CO   gap(1531),AAHY01069633.1:1..29145,gap(20),AAHY01069634.1:1..7492,gap(20),
CO   AAHY01069635.1:1..1068,gap(20),AAHY01069636.1:1..33946,gap(2115),
CO   AAHY01069637.1:1..39937,gap(20),AAHY01069638.1:1..1703,gap(20),
CO   AAHY01069639.1:1..5479,gap(20),complement(AAHY01069640.1:1..6279),gap(20),
CO   complement(AAHY01069641.1:1..1196),gap(20),
CO   complement(AAHY01069642.1:1..3143),gap(165),
CO   complement(AAHY01069643.1:1..3374),gap(20),AAHY01069644.1:1..21900,gap(20),
CO   AAHY01069645.1:1..3611,gap(20),AAHY01069646.1:1..46245,gap(44),
CO   AAHY01069647.1:1..15708,gap(20),complement(AAHY01069648.1:1..3068),gap(20),
CO   complement(AAHY01069649.1:1..12899),gap(87),AAHY01069650.1:1..13535,
CO   gap(4250),AAHY01069651.1:1..5109,gap(20),AAHY01069652.1:1..35749,gap(20),
CO   AAHY01069653.1:1..1745,gap(994),AAHY01069654.1:1..1479,gap(1571),
CO   AAHY01069655.1:1..964,gap(277),complement(AAHY01069656.1:1..1357),gap(20),
CO   AAHY01069657.1:1..5762,gap(503),complement(AAHY01069658.1:1..4422),gap(20),
CO   AAHY01069659.1:1..1653,gap(20),AAHY01069660.1:1..1420,gap(20),
CO   AAHY01069661.1:1..46140,gap(20),AAHY01069662.1:1..17773,gap(3074),
CO   AAHY01069663.1:1..18519,gap(199),AAHY01069664.1:1..61511,gap(214),
CO   AAHY01069665.1:1..29114,gap(20),AAHY01069666.1:1..7419,gap(4337),
CO   complement(AAHY01069667.1:1..2656),gap(20),AAHY01069668.1:1..1290,gap(20),
CO   complement(AAHY01069669.1:1..2723),gap(5956),AAHY01069670.1:1..4226,
CO   gap(30),AAHY01069671.1:1..8761,gap(20),AAHY01069672.1:1..3227,gap(20),
CO   AAHY01069673.1:1..1031,gap(20),complement(AAHY01069674.1:1..1637),gap(20),
CO   AAHY01069675.1:1..21306,gap(20),AAHY01069676.1:1..7801,gap(20),
CO   AAHY01069677.1:1..1841,gap(20),AAHY01069678.1:1..7866,gap(104),
CO   AAHY01069679.1:1..4976,gap(20),AAHY01069680.1:1..3820,gap(20),
CO   complement(AAHY01069681.1:1..1198),gap(20),
CO   complement(AAHY01069682.1:1..16381),gap(230),AAHY01069683.1:1..76606,
CO   gap(114),AAHY01069684.1:1..33372,gap(20),AAHY01069685.1:1..18005,gap(312),
CO   complement(AAHY01069686.1:1..7975),gap(99),AAHY01069687.1:1..11756,gap(20),
CO   AAHY01069688.1:1..6463,gap(20),AAHY01069689.1:1..8056,gap(3204),
CO   AAHY01069690.1:1..16262,gap(20),AAHY01069691.1:1..9781,gap(211),
CO   AAHY01069692.1:1..13893,gap(20),AAHY01069693.1:1..1073,gap(20),
CO   complement(AAHY01069694.1:1..2396),gap(2147),AAHY01069695.1:1..1737,
CO   gap(20),AAHY01069696.1:1..2835,gap(1009),AAHY01069697.1:1..2708,gap(20),
CO   AAHY01069698.1:1..6787,gap(20),complement(AAHY01069699.1:1..1062),gap(20),
CO   AAHY01069700.1:1..1313,gap(20),AAHY01069701.1:1..1358,gap(20),
CO   complement(AAHY01069702.1:1..1208),gap(20),AAHY01069703.1:1..1773,
CO   gap(1629),AAHY01069704.1:1..6846,gap(20),AAHY01069705.1:1..1023,gap(20),
CO   complement(AAHY01069706.1:1..5114),gap(20),AAHY01069707.1:1..15225,
CO   gap(4844),AAHY01069708.1:1..4897,gap(20),AAHY01069709.1:1..5347,gap(20),
CO   AAHY01069710.1:1..1770,gap(655),complement(AAHY01069711.1:1..1827),
CO   gap(1257),AAHY01069712.1:1..31264,gap(188),AAHY01069713.1:1..5737,gap(20),
CO   complement(AAHY01069714.1:1..5309),gap(414),AAHY01069715.1:1..7756,
CO   gap(626),AAHY01069716.1:1..1213,gap(20),AAHY01069717.1:1..6062,gap(20),
CO   AAHY01069718.1:1..1971,gap(812),AAHY01069719.1:1..8366,gap(20),
CO   AAHY01069720.1:1..4943,gap(81),AAHY01069721.1:1..11518,gap(20),
CO   complement(AAHY01069722.1:1..1032),gap(20),AAHY01069723.1:1..4694,gap(20),
CO   complement(AAHY01069724.1:1..2867),gap(20),AAHY01069725.1:1..7620,gap(20),
CO   AAHY01069726.1:1..1899,gap(20),AAHY01069727.1:1..1134,gap(20),
CO   AAHY01069728.1:1..1676,gap(20),complement(AAHY01069729.1:1..2765),gap(20),
CO   complement(AAHY01069730.1:1..1306),gap(20),AAHY01069731.1:1..3538,gap(20),
CO   AAHY01069732.1:1..8375,gap(1056),AAHY01069733.1:1..1867,gap(20),
CO   complement(AAHY01069734.1:1..1435),gap(20),
CO   complement(AAHY01069735.1:1..2069),gap(20),AAHY01069736.1:1..1039,gap(20),
CO   AAHY01069737.1:1..7641,gap(20),AAHY01069738.1:1..35767,gap(20),
CO   AAHY01069739.1:1..1617,gap(255),AAHY01069740.1:1..14690,gap(524),
CO   AAHY01069741.1:1..9336,gap(20),complement(AAHY01069742.1:1..1767),gap(20),
CO   AAHY01069743.1:1..1288,gap(20),complement(AAHY01069744.1:1..1945),gap(939),
CO   complement(AAHY01069745.1:1..5106),gap(20),AAHY01069746.1:1..1530,gap(20),
CO   complement(AAHY01069747.1:1..1889),gap(20),AAHY01069748.1:1..1608,gap(20),
CO   complement(AAHY01069749.1:1..2943),gap(20),AAHY01069750.1:1..2000,
CO   gap(2759),AAHY01069751.1:1..19619,gap(186),AAHY01069752.1:1..8925,gap(800),
CO   AAHY01069753.1:1..2267,gap(20),AAHY01069754.1:1..1613,gap(20),
CO   AAHY01069755.1:1..1111,gap(20),AAHY01069756.1:1..2534,gap(20),
CO   complement(AAHY01069757.1:1..2958),gap(20),
CO   complement(AAHY01069758.1:1..25824),gap(20),
CO   complement(AAHY01069759.1:1..20473),gap(428),AAHY01069760.1:1..65476,
CO   gap(20),AAHY01069761.1:1..1476,gap(20),AAHY01069762.1:1..1518,gap(20),
CO   AAHY01069763.1:1..1098,gap(20),AAHY01069764.1:1..33577,gap(227),
CO   AAHY01069765.1:1..20565,gap(125),AAHY01069766.1:1..19039,gap(115),
CO   AAHY01069767.1:1..2393,gap(2490),AAHY01069768.1:1..2802,gap(20),
CO   complement(AAHY01069769.1:1..1441),gap(20),
CO   complement(AAHY01069770.1:1..1871),gap(115),AAHY01069771.1:1..21094,
CO   gap(2413),AAHY01069772.1:1..1423,gap(5571),AAHY01069773.1:1..1558,gap(20),
CO   AAHY01069774.1:1..18441,gap(1808),AAHY01069775.1:1..1144,gap(20),
CO   complement(AAHY01069776.1:1..1060),gap(20),
CO   complement(AAHY01069777.1:1..1059),gap(20),
CO   complement(AAHY01069778.1:1..1045),gap(20),
CO   complement(AAHY01069779.1:1..1985),gap(1330),
CO   complement(AAHY01069780.1:1..2807),gap(275),
CO   complement(AAHY01069781.1:1..7022),gap(20),
CO   complement(AAHY01069782.1:1..7326),gap(20),AAHY01069783.1:1..27357,
CO   gap(143),AAHY01069784.1:1..59861,gap(209),
CO   complement(AAHY01069785.1:1..56918),gap(20),AAHY01069786.1:1..1328,gap(20),
CO   complement(AAHY01069787.1:1..3727),gap(20),AAHY01069788.1:1..6994,gap(232),
CO   AAHY01069789.1:1..14001,gap(105),AAHY01069790.1:1..12401,gap(20),
CO   AAHY01069791.1:1..11301,gap(258),AAHY01069792.1:1..17472,gap(546),
CO   complement(AAHY01069793.1:1..5346),gap(20),AAHY01069794.1:1..1600,
CO   gap(1024),complement(AAHY01069795.1:1..1196),gap(1362),
CO   AAHY01069796.1:1..6329,gap(1465),AAHY01069797.1:1..19999,gap(276),
CO   AAHY01069798.1:1..5609,gap(20),AAHY01069799.1:1..1862,gap(20),
CO   AAHY01069800.1:1..1240,gap(20),complement(AAHY01069801.1:1..1410),gap(20),
CO   complement(AAHY01069802.1:1..840),gap(333),AAHY01069803.1:1..2185,
CO   gap(2043),AAHY01069804.1:1..1562,gap(20),AAHY01069805.1:1..4447,gap(1105),
CO   AAHY01069806.1:1..2558,gap(20),AAHY01069807.1:1..25916,gap(20),
CO   AAHY01069808.1:1..2841,gap(293),complement(AAHY01069809.1:1..1586),gap(20),
CO   AAHY01069810.1:1..9423,gap(20),AAHY01069811.1:1..1600,gap(20),
CO   AAHY01069812.1:1..6989,gap(205),AAHY01069813.1:1..19000,gap(539),
CO   AAHY01069814.1:1..3273,gap(1011),complement(AAHY01069815.1:1..17277),
CO   gap(20),complement(AAHY01069816.1:1..2294),gap(20),
CO   complement(AAHY01069817.1:1..15039),gap(112),AAHY01069818.1:1..30228,
CO   gap(20),AAHY01069819.1:1..18291,gap(20),complement(AAHY01069820.1:1..3472),
CO   gap(572),AAHY01069821.1:1..1072,gap(1434),AAHY01069822.1:1..1714,gap(1418),
CO   complement(AAHY01069823.1:1..873),gap(20),AAHY01069824.1:1..26560,gap(977),
CO   AAHY01069825.1:1..20889,gap(2878),complement(AAHY01069826.1:1..788),
CO   gap(2831),AAHY01069827.1:1..1386,gap(20),
CO   complement(AAHY01069828.1:1..1262),gap(2194),AAHY01069829.1:1..16232,
CO   gap(77),AAHY01069830.1:1..914,gap(640),AAHY01069831.1:1..5275,gap(114),
CO   AAHY01069832.1:1..14400,gap(20),AAHY01069833.1:1..36459,gap(123),
CO   AAHY01069834.1:1..27314,gap(262),AAHY01069835.1:1..8689,gap(2645),
CO   complement(AAHY01069836.1:1..1002),gap(20),AAHY01069837.1:1..1553,gap(272),
CO   AAHY01069838.1:1..42901,gap(587),complement(AAHY01069839.1:1..18393),
CO   gap(20),AAHY01069840.1:1..1661,gap(20),AAHY01069841.1:1..37439,gap(957),
CO   AAHY01069842.1:1..1119,gap(20),complement(AAHY01069843.1:1..1466),gap(20),
CO   AAHY01069844.1:1..5846,gap(20),AAHY01069845.1:1..12270,gap(193),
CO   AAHY01069846.1:1..6849,gap(20),AAHY01069847.1:1..9308,gap(20),
CO   AAHY01069848.1:1..1001,gap(20),AAHY01069849.1:1..1071,gap(20),
CO   AAHY01069850.1:1..16509,gap(420),AAHY01069851.1:1..4565,gap(311),
CO   complement(AAHY01069852.1:1..10135),gap(20),
CO   complement(AAHY01069853.1:1..2392),gap(384),
CO   complement(AAHY01069854.1:1..7803),gap(20),AAHY01069855.1:1..2662,gap(112),
CO   AAHY01069856.1:1..31957,gap(204),AAHY01069857.1:1..26277,gap(184),
CO   AAHY01069858.1:1..8908,gap(20),AAHY01069859.1:1..1492,gap(803),
CO   complement(AAHY01069860.1:1..23869),gap(20),AAHY01069861.1:1..11743,
CO   gap(154),AAHY01069862.1:1..6379,gap(239),AAHY01069863.1:1..23063,gap(20),
CO   AAHY01069864.1:1..8491,gap(20),complement(AAHY01069865.1:1..19684),gap(20),
CO   AAHY01069866.1:1..1075,gap(917),AAHY01069867.1:1..1744,gap(926),
CO   AAHY01069868.1:1..2856,gap(20),AAHY01069869.1:1..1287,gap(20),
CO   AAHY01069870.1:1..1082,gap(20),AAHY01069871.1:1..34483,gap(20),
CO   AAHY01069872.1:1..1487,gap(20),complement(AAHY01069873.1:1..1688),gap(20),
CO   AAHY01069874.1:1..2371,gap(20),AAHY01069875.1:1..5619,gap(20),
CO   AAHY01069876.1:1..1030,gap(20),AAHY01069877.1:1..1228,gap(2304),
CO   complement(AAHY01069878.1:1..5848),gap(20),AAHY01069879.1:1..3268,gap(502),
CO   AAHY01069880.1:1..12755,gap(20),AAHY01069881.1:1..29872,gap(482),
CO   AAHY01069882.1:1..28440,gap(153),AAHY01069883.1:1..16864,gap(703),
CO   AAHY01069884.1:1..1050,gap(106),AAHY01069885.1:1..17522,gap(20),
CO   complement(AAHY01069886.1:1..1885),gap(20),AAHY01069887.1:1..27050,gap(20),
CO   AAHY01069888.1:1..7723,gap(43),complement(AAHY01069889.1:1..5794),gap(20),
CO   AAHY01069890.1:1..54377,gap(114),AAHY01069891.1:1..25813,gap(20),
CO   AAHY01069892.1:1..3185,gap(20),AAHY01069893.1:1..13851,gap(20),
CO   AAHY01069894.1:1..20638,gap(20),complement(AAHY01069895.1:1..1144),
CO   gap(1110),complement(AAHY01069896.1:1..1230),gap(20),
CO   complement(AAHY01069897.1:1..5636),gap(467),AAHY01069898.1:1..25352,
CO   gap(135),AAHY01069899.1:1..27765,gap(115),AAHY01069900.1:1..2741,gap(2287),
CO   AAHY01069901.1:1..25600,gap(147),AAHY01069902.1:1..32948,gap(20),
CO   AAHY01069903.1:1..12545,gap(834),complement(AAHY01069904.1:1..6107),
CO   gap(222),AAHY01069905.1:1..6916,gap(376),AAHY01069906.1:1..38975,gap(283),
CO   AAHY01069907.1:1..2120,gap(20),AAHY01069908.1:1..7422,gap(256),
CO   AAHY01069909.1:1..16389,gap(20),AAHY01069910.1:1..1551,gap(20),
CO   AAHY01069911.1:1..1026,gap(20),complement(AAHY01069912.1:1..1741),gap(20),
CO   AAHY01069913.1:1..1733,gap(927),AAHY01069914.1:1..3997,gap(20),
CO   complement(AAHY01069915.1:1..1446),gap(20),AAHY01069916.1:1..9013,gap(20),
CO   complement(AAHY01069917.1:1..1841),gap(20),AAHY01069918.1:1..33479,gap(71),
CO   AAHY01069919.1:1..73385,gap(20),complement(AAHY01069920.1:1..1123),gap(20),
CO   AAHY01069921.1:1..1505,gap(20),AAHY01069922.1:1..31836,gap(20),
CO   AAHY01069923.1:1..13300,gap(20),complement(AAHY01069924.1:1..25500),
CO   gap(197),AAHY01069925.1:1..17745,gap(638),
CO   complement(AAHY01069926.1:1..12582),gap(135),
CO   complement(AAHY01069927.1:1..9710),gap(20),
CO   complement(AAHY01069928.1:1..1198),gap(20),AAHY01069929.1:1..5113,gap(423),
CO   AAHY01069930.1:1..2213,gap(22),AAHY01069931.1:1..83060,gap(494),
CO   AAHY01069932.1:1..3367,gap(1397),AAHY01069933.1:1..4231,gap(20),
CO   AAHY01069934.1:1..2765,gap(20),AAHY01069935.1:1..4133,gap(604),
CO   complement(AAHY01069936.1:1..3109),gap(20),
CO   complement(AAHY01069937.1:1..5629),gap(20),
CO   complement(AAHY01069938.1:1..9200),gap(20),
CO   complement(AAHY01069939.1:1..24568),gap(409),AAHY01069940.1:1..60314,
CO   gap(2283),AAHY01069941.1:1..55305,gap(20),
CO   complement(AAHY01069942.1:1..8579),gap(20),
CO   complement(AAHY01069943.1:1..15404),gap(20),
CO   complement(AAHY01069944.1:1..3542),gap(369),AAHY01069945.1:1..4072,gap(20),
CO   AAHY01069946.1:1..1054,gap(20),AAHY01069947.1:1..6999,gap(20),
CO   AAHY01069948.1:1..46678,gap(75),AAHY01069949.1:1..23127,gap(8023),
CO   AAHY01069950.1:1..6665,gap(1201),AAHY01069951.1:1..4987,gap(20),
CO   complement(AAHY01069952.1:1..1900),gap(27598),AAHY01069953.1:1..6201,
CO   gap(20),AAHY01069954.1:1..4124,gap(20),AAHY01069955.1:1..3103,gap(698),
CO   AAHY01069956.1:1..9388,gap(20),complement(AAHY01069957.1:1..1405),gap(20),
CO   AAHY01069958.1:1..1329,gap(20),AAHY01069959.1:1..3462,gap(712),
CO   AAHY01069960.1:1..32940,gap(20),AAHY01069961.1:1..15736,gap(225),
CO   AAHY01069962.1:1..11258,gap(78),AAHY01069963.1:1..52524,gap(337),
CO   AAHY01069964.1:1..1647,gap(20),AAHY01069965.1:1..4467,gap(192),
CO   AAHY01069966.1:1..3775,gap(30),AAHY01069967.1:1..17906,gap(58),
CO   AAHY01069968.1:1..16260,gap(368),AAHY01069969.1:1..6388,gap(150),
CO   AAHY01069970.1:1..27097,gap(20),AAHY01069971.1:1..1256,gap(20),
CO   AAHY01069972.1:1..7612,gap(1380),AAHY01069973.1:1..20208,gap(20),
CO   complement(AAHY01069974.1:1..1095),gap(20),
CO   complement(AAHY01069975.1:1..3741),gap(141),AAHY01069976.1:1..1017,gap(20),
CO   AAHY01069977.1:1..27304,gap(20),AAHY01069978.1:1..11938,gap(20),
CO   AAHY01069979.1:1..7414,gap(20),AAHY01069980.1:1..22326,gap(53),
CO   AAHY01069981.1:1..15743,gap(20),AAHY01069982.1:1..2000,gap(20),
CO   complement(AAHY01069983.1:1..1081),gap(20),AAHY01069984.1:1..14301,gap(20),
CO   AAHY01069985.1:1..13677,gap(136),AAHY01069986.1:1..32053,gap(20),
CO   AAHY01069987.1:1..10159,gap(383),AAHY01069988.1:1..1582,gap(20),
CO   complement(AAHY01069989.1:1..19161),gap(20),
CO   complement(AAHY01069990.1:1..1090),gap(542),AAHY01069991.1:1..37074,
CO   gap(934),complement(AAHY01069992.1:1..2272),gap(20),
CO   complement(AAHY01069993.1:1..3468),gap(20),AAHY01069994.1:1..187114,
CO   gap(20),AAHY01069995.1:1..2467,gap(20),complement(AAHY01069996.1:1..1101),
CO   gap(20),complement(AAHY01069997.1:1..8861),gap(20),AAHY01069998.1:1..2701,
CO   gap(20),AAHY01069999.1:1..16771,gap(20),AAHY01070000.1:1..14367,gap(20),
CO   AAHY01070001.1:1..16512,gap(20),complement(AAHY01070002.1:1..1137),
CO   gap(2776),AAHY01070003.1:1..3379,gap(20),
CO   complement(AAHY01070004.1:1..3047),gap(20),
CO   complement(AAHY01070005.1:1..1771),gap(4294),AAHY01070006.1:1..1993,
CO   gap(20),complement(AAHY01070007.1:1..1401),gap(2903),
CO   complement(AAHY01070008.1:1..1248),gap(20),AAHY01070009.1:1..1484,gap(20),
CO   AAHY01070010.1:1..1096,gap(20),complement(AAHY01070011.1:1..17556),gap(20),
CO   AAHY01070012.1:1..27702,gap(20),AAHY01070013.1:1..26891,gap(20),
CO   AAHY01070014.1:1..11499,gap(312),complement(AAHY01070015.1:1..4371),
CO   gap(20),AAHY01070016.1:1..745,gap(20),AAHY01070017.1:1..2150,gap(1717),
CO   AAHY01070018.1:1..21169,gap(1640),AAHY01070019.1:1..7686,gap(563),
CO   AAHY01070020.1:1..1193,gap(91),AAHY01070021.1:1..7039,gap(4469),
CO   AAHY01070022.1:1..13730,gap(39),AAHY01070023.1:1..2795,gap(912),
CO   AAHY01070024.1:1..978,gap(1255),AAHY01070025.1:1..1442,gap(20),
CO   AAHY01070026.1:1..22143,gap(20),AAHY01070027.1:1..20633,gap(20),
CO   AAHY01070028.1:1..2489,gap(1099),AAHY01070029.1:1..7968,gap(20),
CO   AAHY01070030.1:1..4240,gap(20),AAHY01070031.1:1..4070,gap(530),
CO   AAHY01070032.1:1..3253,gap(266),AAHY01070033.1:1..4663,gap(52),
CO   AAHY01070034.1:1..13267,gap(20),complement(AAHY01070035.1:1..1257),gap(20),
CO   complement(AAHY01070036.1:1..1296),gap(441),AAHY01070037.1:1..5877,gap(20),
CO   AAHY01070038.1:1..8878,gap(20),AAHY01070039.1:1..12338,gap(20),
CO   AAHY01070040.1:1..19975,gap(20),AAHY01070041.1:1..1220,gap(20),
CO   complement(AAHY01070042.1:1..1071),gap(20),AAHY01070043.1:1..1108,gap(421),
CO   complement(AAHY01070044.1:1..3087),gap(20),AAHY01070045.1:1..1057,
CO   gap(6319),complement(AAHY01070046.1:1..3224),gap(20),
CO   AAHY01070047.1:1..1274,gap(1768),AAHY01070048.1:1..10805,gap(45),
CO   AAHY01070049.1:1..18362,gap(20),AAHY01070050.1:1..1107,gap(20),
CO   AAHY01070051.1:1..2414,gap(20),complement(AAHY01070052.1:1..4755),gap(20),
CO   AAHY01070053.1:1..11568,gap(6262),AAHY01070054.1:1..37213,gap(3224),
CO   AAHY01070055.1:1..22647,gap(20),AAHY01070056.1:1..1060,gap(20),
CO   complement(AAHY01070057.1:1..1951),gap(20),AAHY01070058.1:1..10365,
CO   gap(31909),AAHY01070059.1:1..2555,gap(20),AAHY01070060.1:1..2779,gap(7076),
CO   complement(AAHY01070061.1:1..2213),gap(20),
CO   complement(AAHY01070062.1:1..4239),gap(770),
CO   complement(AAHY01070063.1:1..3289),gap(20),AAHY01070064.1:1..2707,gap(20),
CO   AAHY01070065.1:1..1036,gap(20),AAHY01070066.1:1..5280,gap(20),
CO   AAHY01070067.1:1..6972,gap(169),AAHY01070068.1:1..9577,gap(20),
CO   AAHY01070069.1:1..1783,gap(20),AAHY01070070.1:1..9175,gap(129),
CO   AAHY01070071.1:1..7313,gap(20),AAHY01070072.1:1..2881,gap(43),
CO   AAHY01070073.1:1..1120,gap(557),complement(AAHY01070074.1:1..8334),gap(20),
CO   complement(AAHY01070075.1:1..1912),gap(20),
CO   complement(AAHY01070076.1:1..2649),gap(20),AAHY01070077.1:1..6046,gap(240),
CO   AAHY01070078.1:1..28432,gap(20),AAHY01070079.1:1..4488,gap(1724),
CO   AAHY01070080.1:1..1644,gap(290),AAHY01070081.1:1..16188,gap(29908),
CO   AAHY01070082.1:1..4381,gap(59),AAHY01070083.1:1..1777,gap(289),
CO   complement(AAHY01070084.1:1..4027),gap(20),AAHY01070085.1:1..14015,gap(20),
CO   complement(AAHY01070086.1:1..3790),gap(147),
CO   complement(AAHY01070087.1:1..22594),gap(20),
CO   complement(AAHY01070088.1:1..1657),gap(20),AAHY01070089.1:1..1056,gap(20),
CO   complement(AAHY01070090.1:1..1412),gap(20),
CO   complement(AAHY01070091.1:1..1739),gap(20),
CO   complement(AAHY01070092.1:1..8059),gap(73),AAHY01070093.1:1..4556,gap(189),
CO   AAHY01070094.1:1..16226,gap(3385),complement(AAHY01070095.1:1..2095),
CO   gap(5603),AAHY01070096.1:1..3251,gap(2733),AAHY01070097.1:1..1368,
CO   gap(2563),AAHY01070098.1:1..1488,gap(20),
CO   complement(AAHY01070099.1:1..1297),gap(205),
CO   complement(AAHY01070100.1:1..998),gap(861),AAHY01070101.1:1..9323,gap(20),
CO   complement(AAHY01070102.1:1..8292),gap(20),
CO   complement(AAHY01070103.1:1..1074),gap(20),AAHY01070104.1:1..1115,gap(20),
CO   AAHY01070105.1:1..41133,gap(20),AAHY01070106.1:1..28825,gap(1133),
CO   complement(AAHY01070107.1:1..1574),gap(20),AAHY01070108.1:1..1456,gap(20),
CO   complement(AAHY01070109.1:1..3278),gap(20),
CO   complement(AAHY01070110.1:1..1367),gap(20),AAHY01070111.1:1..3623,gap(20),
CO   AAHY01070112.1:1..1616,gap(20),complement(AAHY01070113.1:1..1788),gap(20),
CO   AAHY01070114.1:1..1039,gap(20),AAHY01070115.1:1..11778,gap(21389),
CO   AAHY01070116.1:1..24921,gap(20),complement(AAHY01070117.1:1..3992),gap(43),
CO   complement(AAHY01070118.1:1..25320),gap(20),
CO   complement(AAHY01070119.1:1..1862),gap(20),
CO   complement(AAHY01070120.1:1..3239),gap(20),
CO   complement(AAHY01070121.1:1..12687),gap(1219),AAHY01070122.1:1..6016,
CO   gap(20),AAHY01070123.1:1..32513,gap(20),AAHY01070124.1:1..36588,gap(490),
CO   AAHY01070125.1:1..8502,gap(20),complement(AAHY01070126.1:1..24589),
CO   gap(912),AAHY01070127.1:1..1520,gap(20),complement(AAHY01070128.1:1..1121),
CO   gap(1820),AAHY01070129.1:1..2840,gap(20),
CO   complement(AAHY01070130.1:1..1267),gap(20),
CO   complement(AAHY01070131.1:1..2575),gap(20),AAHY01070132.1:1..3886,gap(867),
CO   AAHY01070133.1:1..12082,gap(266),AAHY01070134.1:1..10092,gap(68),
CO   complement(AAHY01070135.1:1..883),gap(2503),AAHY01070136.1:1..7879,gap(20),
CO   AAHY01070137.1:1..13390,gap(20),AAHY01070138.1:1..15827,gap(24),
CO   AAHY01070139.1:1..10240,gap(272),AAHY01070140.1:1..40299,gap(20),
CO   AAHY01070141.1:1..8951,gap(20),AAHY01070142.1:1..12495,gap(159),
CO   AAHY01070143.1:1..4457,gap(20),complement(AAHY01070144.1:1..2007),gap(20),
CO   complement(AAHY01070145.1:1..1511),gap(20),AAHY01070146.1:1..10497,
CO   gap(318),AAHY01070147.1:1..6981,gap(117),AAHY01070148.1:1..35706,gap(786),
CO   AAHY01070149.1:1..13425,gap(2237),complement(AAHY01070150.1:1..15640),
CO   gap(3472),complement(AAHY01070151.1:1..9101),gap(4420),
CO   AAHY01070152.1:1..4411,gap(20),complement(AAHY01070153.1:1..1246),gap(20),
CO   AAHY01070154.1:1..1438,gap(20),complement(AAHY01070155.1:1..5205),gap(20),
CO   AAHY01070156.1:1..3570,gap(20),complement(AAHY01070157.1:1..1100),gap(20),
CO   AAHY01070158.1:1..43954,gap(20),complement(AAHY01070159.1:1..1111),gap(20),
CO   AAHY01070160.1:1..1613,gap(20),complement(AAHY01070161.1:1..1895),gap(108),
CO   complement(AAHY01070162.1:1..1308),gap(20),AAHY01070163.1:1..7819,
CO   gap(1573),AAHY01070164.1:1..1750,gap(574),AAHY01070165.1:1..6411,gap(20),
CO   AAHY01070166.1:1..17345,gap(20),AAHY01070167.1:1..1145,gap(20),
CO   AAHY01070168.1:1..3258,gap(2112),AAHY01070169.1:1..4070,gap(4057),
CO   AAHY01070170.1:1..2913,gap(20),complement(AAHY01070171.1:1..1420),gap(20),
CO   complement(AAHY01070172.1:1..1064),gap(20),
CO   complement(AAHY01070173.1:1..2187),gap(20),AAHY01070174.1:1..1212,
CO   gap(2993),complement(AAHY01070175.1:1..2978),gap(20),
CO   complement(AAHY01070176.1:1..10212),gap(846),
CO   complement(AAHY01070177.1:1..1254),gap(5018),
CO   complement(AAHY01070178.1:1..2759),gap(20),AAHY01070179.1:1..14965,gap(20),
CO   AAHY01070180.1:1..1766,gap(20),complement(AAHY01070181.1:1..1581),gap(20),
CO   AAHY01070182.1:1..1541,gap(20),complement(AAHY01070183.1:1..1020),gap(20),
CO   complement(AAHY01070184.1:1..1481),gap(20),
CO   complement(AAHY01070185.1:1..1344),gap(20),AAHY01070186.1:1..8983,gap(175),
CO   AAHY01070187.1:1..32563,gap(20),complement(AAHY01070188.1:1..3870),gap(56),
CO   AAHY01070189.1:1..13025,gap(147),AAHY01070190.1:1..4158,gap(1170),
CO   complement(AAHY01070191.1:1..1082),gap(20),
CO   complement(AAHY01070192.1:1..2021),gap(6610),AAHY01070193.1:1..3495,
CO   gap(5079),AAHY01070194.1:1..3247,gap(20),AAHY01070195.1:1..1811,gap(331),
CO   AAHY01070196.1:1..1542,gap(20),complement(AAHY01070197.1:1..4445),gap(20),
CO   AAHY01070198.1:1..2294,gap(20),complement(AAHY01070199.1:1..1216),gap(20),
CO   AAHY01070200.1:1..1045,gap(656),AAHY01070201.1:1..3751,gap(20),
CO   complement(AAHY01070202.1:1..1352),gap(20),
CO   complement(AAHY01070203.1:1..1232),gap(20),AAHY01070204.1:1..6086,
CO   gap(6094),AAHY01070205.1:1..1212,gap(20),AAHY01070206.1:1..5901,gap(20),
CO   AAHY01070207.1:1..1251,gap(20),AAHY01070208.1:1..1982,gap(20),
CO   AAHY01070209.1:1..13258,gap(347),AAHY01070210.1:1..15266,gap(20),
CO   complement(AAHY01070211.1:1..1488),gap(20),
CO   complement(AAHY01070212.1:1..1392),gap(1521),AAHY01070213.1:1..2354,
CO   gap(20),AAHY01070214.1:1..1186,gap(20),AAHY01070215.1:1..6039,gap(82),
CO   AAHY01070216.1:1..17501,gap(20),AAHY01070217.1:1..11654,gap(20),
CO   AAHY01070218.1:1..5372,gap(810),complement(AAHY01070219.1:1..3595),gap(20),
CO   complement(AAHY01070220.1:1..1181),gap(20),AAHY01070221.1:1..1040,gap(20),
CO   AAHY01070222.1:1..2407,gap(3646),AAHY01070223.1:1..5577,gap(706),
CO   complement(AAHY01070224.1:1..7214),gap(20),AAHY01070225.1:1..20563,
CO   gap(2286),AAHY01070226.1:1..1959,gap(2341),AAHY01070227.1:1..7107,gap(20),
CO   AAHY01070228.1:1..1044,gap(20),AAHY01070229.1:1..7028,gap(161),
CO   AAHY01070230.1:1..2762,gap(20),AAHY01070231.1:1..18842,gap(84),
CO   AAHY01070232.1:1..20641,gap(20),AAHY01070233.1:1..8182,gap(172),
CO   AAHY01070234.1:1..5083,gap(413),complement(AAHY01070235.1:1..1042),
CO   gap(806),AAHY01070236.1:1..3485,gap(3980),AAHY01070237.1:1..2985,gap(20),
CO   AAHY01070238.1:1..4566,gap(79),AAHY01070239.1:1..10620,gap(20),
CO   AAHY01070240.1:1..9487,gap(265),AAHY01070241.1:1..4118,gap(161),
CO   AAHY01070242.1:1..4284,gap(169),AAHY01070243.1:1..20068,gap(1796),
CO   AAHY01070244.1:1..1992,gap(20),AAHY01070245.1:1..80674,gap(20),
CO   AAHY01070246.1:1..11335,gap(27),AAHY01070247.1:1..13459,gap(20),
CO   AAHY01070248.1:1..16319,gap(20),complement(AAHY01070249.1:1..13298),
CO   gap(1820),AAHY01070250.1:1..20085,gap(1661),AAHY01070251.1:1..9931,gap(20),
CO   complement(AAHY01070252.1:1..12811),gap(20),AAHY01070253.1:1..5263,
CO   gap(174),complement(AAHY01070254.1:1..12299),gap(90),
CO   AAHY01070255.1:1..8510,gap(2787),AAHY01070256.1:1..1349,gap(506),
CO   AAHY01070257.1:1..7700,gap(20),AAHY01070258.1:1..17830,gap(20),
CO   AAHY01070259.1:1..5399,gap(644),AAHY01070260.1:1..19326,gap(20),
CO   AAHY01070261.1:1..14585,gap(730),complement(AAHY01070262.1:1..1059),
CO   gap(20),AAHY01070263.1:1..11160,gap(134),AAHY01070264.1:1..50663,gap(136),
CO   AAHY01070265.1:1..13713,gap(20),AAHY01070266.1:1..57965,gap(886),
CO   AAHY01070267.1:1..19821,gap(134),complement(AAHY01070268.1:1..8273),
CO   gap(20),complement(AAHY01070269.1:1..5748),gap(20),AAHY01070270.1:1..46664,
CO   gap(20),AAHY01070271.1:1..40318,gap(1260),AAHY01070272.1:1..26725,gap(20),
CO   complement(AAHY01070273.1:1..1293),gap(20),AAHY01070274.1:1..8865,gap(25),
CO   complement(AAHY01070275.1:1..7263),gap(6117),
CO   complement(AAHY01070276.1:1..3229),gap(174),AAHY01070277.1:1..701,
CO   gap(4134),AAHY01070278.1:1..32254,gap(20),
CO   complement(AAHY01070279.1:1..31814),gap(20),
CO   complement(AAHY01070280.1:1..24363),gap(21),AAHY01070281.1:1..145402,
CO   gap(1918),complement(AAHY01070282.1:1..1001),gap(122),
CO   AAHY01070283.1:1..21222,gap(5749),AAHY01070284.1:1..6367,gap(306),
CO   AAHY01070285.1:1..28241,gap(705),AAHY01070286.1:1..5262,gap(724),
CO   AAHY01070287.1:1..23917,gap(20),complement(AAHY01070288.1:1..3710),gap(20),
CO   complement(AAHY01070289.1:1..13122),gap(192),
CO   complement(AAHY01070290.1:1..17753),gap(150),AAHY01070291.1:1..23708,
CO   gap(20),AAHY01070292.1:1..17087,gap(20),AAHY01070293.1:1..19047,gap(28),
CO   AAHY01070294.1:1..5074,gap(45),AAHY01070295.1:1..21406,gap(233),
CO   AAHY01070296.1:1..8847,gap(125),AAHY01070297.1:1..14808,gap(279),
CO   AAHY01070298.1:1..53319,gap(20),complement(AAHY01070299.1:1..5595),
CO   gap(189),AAHY01070300.1:1..74245,gap(3257),AAHY01070301.1:1..1972,gap(20),
CO   complement(AAHY01070302.1:1..4499),gap(837),AAHY01070303.1:1..12538,
CO   gap(20),AAHY01070304.1:1..2305,gap(20),complement(AAHY01070305.1:1..24275),
CO   gap(298),AAHY01070306.1:1..10704,gap(554),AAHY01070307.1:1..30512,gap(361),
CO   complement(AAHY01070308.1:1..40654),gap(1208),AAHY01070309.1:1..710,
CO   gap(21),complement(AAHY01070310.1:1..26245),gap(20),
CO   AAHY01070311.1:1..68163,gap(47),AAHY01070312.1:1..16256,gap(103),
CO   AAHY01070313.1:1..13611,gap(71),AAHY01070314.1:1..8598,gap(68),
CO   AAHY01070315.1:1..3344,gap(201),AAHY01070316.1:1..1513,gap(2837),
CO   AAHY01070317.1:1..768,gap(536),AAHY01070318.1:1..6546,gap(397),
CO   complement(AAHY01070319.1:1..11377),gap(186),AAHY01070320.1:1..25948,
CO   gap(20),AAHY01070321.1:1..19766,gap(115),AAHY01070322.1:1..520,gap(1039),
CO   complement(AAHY01070323.1:1..3582),gap(77),
CO   complement(AAHY01070324.1:1..14361),gap(20),
CO   complement(AAHY01070325.1:1..10980),gap(20),AAHY01070326.1:1..5195,gap(27),
CO   AAHY01070327.1:1..2433,gap(20),complement(AAHY01070328.1:1..25752),gap(56),
CO   complement(AAHY01070329.1:1..17094),gap(20),
CO   complement(AAHY01070330.1:1..4244),gap(209),AAHY01070331.1:1..50449,
CO   gap(316),complement(AAHY01070332.1:1..2642),gap(127),AAHY01070333.1:1..659,
CO   gap(59),complement(AAHY01070334.1:1..18609),gap(20),
CO   AAHY01070335.1:1..15692,gap(278),complement(AAHY01070336.1:1..7811),
CO   gap(20),complement(AAHY01070337.1:1..19428),gap(295),
CO   complement(AAHY01070338.1:1..1475),gap(20),
CO   complement(AAHY01070339.1:1..1243),gap(64),AAHY01070340.1:1..10092,gap(20),
CO   complement(AAHY01070341.1:1..8180),gap(25),
CO   complement(AAHY01070342.1:1..22480),gap(283),
CO   complement(AAHY01070343.1:1..4544),gap(20),AAHY01070344.1:1..8130,gap(709),
CO   complement(AAHY01070345.1:1..7098),gap(20),AAHY01070346.1:1..4156,gap(274),
CO   complement(AAHY01070347.1:1..46046),gap(397),AAHY01070348.1:1..655,
CO   gap(308),AAHY01070349.1:1..7110,gap(91),
CO   complement(AAHY01070350.1:1..17782),gap(45),AAHY01070351.1:1..11634,
CO   gap(213),complement(AAHY01070352.1:1..33568),gap(20),
CO   AAHY01070353.1:1..5514,gap(28),AAHY01070354.1:1..20764,gap(637),
CO   complement(AAHY01070355.1:1..4055),gap(196),
CO   complement(AAHY01070356.1:1..34971),gap(115),AAHY01070357.1:1..1152,
CO   gap(1266),complement(AAHY01070358.1:1..21953),gap(125),
CO   complement(AAHY01070359.1:1..4864),gap(20),
CO   complement(AAHY01070360.1:1..12045),gap(5347),AAHY01070361.1:1..2840,
CO   gap(466),complement(AAHY01070362.1:1..7877),gap(245),
CO   complement(AAHY01070363.1:1..4365),gap(20),
CO   complement(AAHY01070364.1:1..1152),gap(20),
CO   complement(AAHY01070365.1:1..10160),gap(20),AAHY01070366.1:1..1980,gap(97),
CO   complement(AAHY01070367.1:1..2401),gap(1158),AAHY01070368.1:1..950,gap(21),
CO   complement(AAHY01070369.1:1..90716),gap(195),AAHY01070370.1:1..22573,
CO   gap(738),complement(AAHY01070371.1:1..13865),gap(20),
CO   complement(AAHY01070372.1:1..24143),gap(694),
CO   complement(AAHY01070373.1:1..12943),gap(59),
CO   complement(AAHY01070374.1:1..9375),gap(108),
CO   complement(AAHY01070375.1:1..14883),gap(62),
CO   complement(AAHY01070376.1:1..22740),gap(20),
CO   complement(AAHY01070377.1:1..42489),gap(20),AAHY01070378.1:1..5508,gap(96),
CO   AAHY01070379.1:1..109037,gap(672),complement(AAHY01070380.1:1..19644),
CO   gap(102),complement(AAHY01070381.1:1..11931),gap(544),
CO   AAHY01070382.1:1..10123,gap(268),complement(AAHY01070383.1:1..11370),
CO   gap(681),complement(AAHY01070384.1:1..7079),gap(279),
CO   AAHY01070385.1:1..24456,gap(261),AAHY01070386.1:1..7777,gap(20),
CO   complement(AAHY01070387.1:1..48377),gap(37),
CO   complement(AAHY01070388.1:1..8751),gap(20),
CO   complement(AAHY01070389.1:1..16480),gap(40),AAHY01070390.1:1..1645,gap(20),
CO   complement(AAHY01070391.1:1..5430),gap(129),AAHY01070392.1:1..4446,
CO   gap(3108),complement(AAHY01070393.1:1..3760),gap(20),
CO   AAHY01070394.1:1..6701,gap(430),complement(AAHY01070395.1:1..18797),
CO   gap(379),complement(AAHY01070396.1:1..3281),gap(260),
CO   complement(AAHY01070397.1:1..2061),gap(112),
CO   complement(AAHY01070398.1:1..11763),gap(81),AAHY01070399.1:1..14709,
CO   gap(397),AAHY01070400.1:1..19277,gap(20),
CO   complement(AAHY01070401.1:1..2659),gap(54),AAHY01070402.1:1..45803,
CO   gap(790),AAHY01070403.1:1..18891,gap(91),AAHY01070404.1:1..51581,gap(175),
CO   complement(AAHY01070405.1:1..21832),gap(20),AAHY01070406.1:1..15915,
CO   gap(20),complement(AAHY01070407.1:1..5964),gap(20),AAHY01070408.1:1..11767,
CO   gap(206),AAHY01070409.1:1..18552,gap(1370),
CO   complement(AAHY01070410.1:1..6255),gap(20),
CO   complement(AAHY01070411.1:1..13850),gap(53),
CO   complement(AAHY01070412.1:1..15497),gap(195),
CO   complement(AAHY01070413.1:1..2929),gap(169),AAHY01070414.1:1..13592,
CO   gap(20),complement(AAHY01070415.1:1..1183),gap(20),AAHY01070416.1:1..22161,
CO   gap(28),AAHY01070417.1:1..6541,gap(3725),AAHY01070418.1:1..32912,gap(691),
CO   AAHY01070419.1:1..12544,gap(20),AAHY01070420.1:1..8869,gap(129),
CO   complement(AAHY01070421.1:1..1519),gap(110),AAHY01070422.1:1..3772,
CO   gap(109),AAHY01070423.1:1..10449,gap(434),
CO   complement(AAHY01070424.1:1..885),gap(20),AAHY01070425.1:1..2592,gap(20),
CO   AAHY01070426.1:1..33479,gap(3141),complement(AAHY01070427.1:1..73443),
CO   gap(121),AAHY01070428.1:1..1570,gap(20),
CO   complement(AAHY01070429.1:1..18769),gap(110),
CO   complement(AAHY01070430.1:1..30848),gap(20),
CO   complement(AAHY01070431.1:1..18334),gap(20),AAHY01070432.1:1..47098,
CO   gap(204),complement(AAHY01070433.1:1..15042),gap(20),
CO   complement(AAHY01070434.1:1..7010),gap(286),AAHY01070435.1:1..2839,
CO   gap(171),AAHY01070436.1:1..334,gap(66),complement(AAHY01070437.1:1..3404),
CO   gap(20),complement(AAHY01070438.1:1..25109),gap(156),
CO   AAHY01070439.1:1..13407,gap(100),complement(AAHY01070440.1:1..4349),
CO   gap(328),complement(AAHY01070441.1:1..9832),gap(120),
CO   complement(AAHY01070442.1:1..17340),gap(409),AAHY01070443.1:1..16354,
CO   gap(20),complement(AAHY01070444.1:1..35689),gap(138),
CO   complement(AAHY01070445.1:1..29336),gap(184),
CO   complement(AAHY01070446.1:1..44055),gap(93),
CO   complement(AAHY01070447.1:1..18042),gap(120),
CO   complement(AAHY01070448.1:1..7375),gap(20),AAHY01070449.1:1..21944,
CO   gap(792),AAHY01070450.1:1..5959,gap(127),
CO   complement(AAHY01070451.1:1..50719),gap(271),
CO   complement(AAHY01070452.1:1..2228),gap(20),AAHY01070453.1:1..1069,gap(20),
CO   AAHY01070454.1:1..5169,gap(227),AAHY01070455.1:1..20540,gap(1253),
CO   AAHY01070456.1:1..7518,gap(71),complement(AAHY01070457.1:1..1822),gap(20),
CO   AAHY01070458.1:1..16715,gap(20),AAHY01070459.1:1..2469,gap(20),
CO   complement(AAHY01070460.1:1..1583),gap(20),AAHY01070461.1:1..8852,gap(20),
CO   AAHY01070462.1:1..36951,gap(245),AAHY01070463.1:1..4083,gap(20),
CO   AAHY01070464.1:1..919,gap(20),AAHY01070465.1:1..10715,gap(20),
CO   AAHY01070466.1:1..1801,gap(1139),AAHY01070467.1:1..1046,gap(20),
CO   AAHY01070468.1:1..6548,gap(290),AAHY01070469.1:1..49629,gap(997),
CO   AAHY01070470.1:1..1738,gap(1072),AAHY01070471.1:1..1389,gap(104),
CO   complement(AAHY01070472.1:1..18253),gap(20),
CO   complement(AAHY01070473.1:1..53942),gap(291),
CO   complement(AAHY01070474.1:1..50531),gap(121),AAHY01070475.1:1..8310,
CO   gap(20),AAHY01070476.1:1..25820,gap(408),AAHY01070477.1:1..25359,gap(50),
CO   AAHY01070478.1:1..15797,gap(157),complement(AAHY01070479.1:1..6547),
CO   gap(20),AAHY01070480.1:1..2162,gap(216),complement(AAHY01070481.1:1..1839),
CO   gap(97),complement(AAHY01070482.1:1..5182),gap(20),AAHY01070483.1:1..9421,
CO   gap(190),AAHY01070484.1:1..36016,gap(20),AAHY01070485.1:1..8269,gap(92),
CO   AAHY01070486.1:1..2411,gap(339),AAHY01070487.1:1..51496,gap(84),
CO   AAHY01070488.1:1..2735,gap(339),AAHY01070489.1:1..45917,gap(20),
CO   complement(AAHY01070490.1:1..11341),gap(20),AAHY01070491.1:1..1154,gap(20),
CO   AAHY01070492.1:1..536,gap(407),AAHY01070493.1:1..31696,gap(20),
CO   complement(AAHY01070494.1:1..6312),gap(137),
CO   complement(AAHY01070495.1:1..17612),gap(20),
CO   complement(AAHY01070496.1:1..20300),gap(500),AAHY01070497.1:1..5278,
CO   gap(237),complement(AAHY01070498.1:1..13287),gap(20),
CO   AAHY01070499.1:1..25639,gap(720),AAHY01070500.1:1..14802,gap(44),
CO   complement(AAHY01070501.1:1..5000),gap(463),
CO   complement(AAHY01070502.1:1..859),gap(20),
CO   complement(AAHY01070503.1:1..9924),gap(37),
CO   complement(AAHY01070504.1:1..23350),gap(38),
CO   complement(AAHY01070505.1:1..1153),gap(20),AAHY01070506.1:1..319,gap(498),
CO   AAHY01070507.1:1..29554,gap(143),AAHY01070508.1:1..14895,gap(1194),
CO   AAHY01070509.1:1..11014,gap(60),AAHY01070510.1:1..71154,gap(168),
CO   complement(AAHY01070511.1:1..6931),gap(358),AAHY01070512.1:1..24330,
CO   gap(20),complement(AAHY01070513.1:1..6726),gap(76),AAHY01070514.1:1..13904,
CO   gap(164),AAHY01070515.1:1..12554,gap(696),
CO   complement(AAHY01070516.1:1..7442),gap(40),
CO   complement(AAHY01070517.1:1..15095),gap(20),AAHY01070518.1:1..7173,gap(20),
CO   complement(AAHY01070519.1:1..17503),gap(20),
CO   complement(AAHY01070520.1:1..21650),gap(442),
CO   complement(AAHY01070521.1:1..4725),gap(20),
CO   complement(AAHY01070522.1:1..40425),gap(42),AAHY01070523.1:1..3184,gap(20),
CO   AAHY01070524.1:1..7328,gap(20),complement(AAHY01070525.1:1..20320),
CO   gap(315),AAHY01070526.1:1..18008,gap(20),AAHY01070527.1:1..1248,gap(1211),
CO   complement(AAHY01070528.1:1..1287),gap(506),
CO   complement(AAHY01070529.1:1..32105),gap(203),
CO   complement(AAHY01070530.1:1..20447),gap(573),AAHY01070531.1:1..10161,
CO   gap(20),complement(AAHY01070532.1:1..6048),gap(262),
CO   complement(AAHY01070533.1:1..29854),gap(20),
CO   complement(AAHY01070534.1:1..1671),gap(741),AAHY01070535.1:1..14833,
CO   gap(56),AAHY01070536.1:1..17747,gap(50),AAHY01070537.1:1..63927,gap(125),
CO   complement(AAHY01070538.1:1..45624),gap(881),AAHY01070539.1:1..1055,
CO   gap(169),complement(AAHY01070540.1:1..6032),gap(307),
CO   AAHY01070541.1:1..6846,gap(85),complement(AAHY01070542.1:1..2830),gap(71),
CO   AAHY01070543.1:1..8332,gap(20),complement(AAHY01070544.1:1..1700),gap(20),
CO   complement(AAHY01070545.1:1..4575),gap(20),
CO   complement(AAHY01070546.1:1..49310),gap(20),
CO   complement(AAHY01070547.1:1..31073),gap(20),
CO   complement(AAHY01070548.1:1..37183),gap(70),
CO   complement(AAHY01070549.1:1..15600),gap(145),AAHY01070550.1:1..9035,
CO   gap(20),complement(AAHY01070551.1:1..1221),gap(78),AAHY01070552.1:1..6285,
CO   gap(20),complement(AAHY01070553.1:1..10595),gap(273),
CO   complement(AAHY01070554.1:1..13871),gap(232),
CO   complement(AAHY01070555.1:1..6536),gap(20),
CO   complement(AAHY01070556.1:1..2553),gap(170),AAHY01070557.1:1..9815,
CO   gap(407),complement(AAHY01070558.1:1..33437),gap(937),
CO   AAHY01070559.1:1..73640,gap(231),complement(AAHY01070560.1:1..35970),
CO   gap(20),AAHY01070561.1:1..2506,gap(240),
CO   complement(AAHY01070562.1:1..11325),gap(20),
CO   complement(AAHY01070563.1:1..21843),gap(820),
CO   complement(AAHY01070564.1:1..10987),gap(20),AAHY01070565.1:1..34223,
CO   gap(61),AAHY01070566.1:1..10029,gap(35),
CO   complement(AAHY01070567.1:1..15003),gap(20),
CO   complement(AAHY01070568.1:1..30101),gap(20),
CO   complement(AAHY01070569.1:1..27706),gap(20),AAHY01070570.1:1..10195,
CO   gap(145),AAHY01070571.1:1..47711,gap(6059),AAHY01070572.1:1..18917,gap(33),
CO   complement(AAHY01070573.1:1..10991),gap(75),
CO   complement(AAHY01070574.1:1..12162),gap(574),AAHY01070575.1:1..10164,
CO   gap(20),AAHY01070576.1:1..28969,gap(20),AAHY01070577.1:1..2184,gap(5462),
CO   complement(AAHY01070578.1:1..3064),gap(37),
CO   complement(AAHY01070579.1:1..4420),gap(48),AAHY01070580.1:1..33383,gap(20),
CO   AAHY01070581.1:1..1805,gap(20),AAHY01070582.1:1..2161,gap(406),
CO   AAHY01070583.1:1..1875,gap(20),AAHY01070584.1:1..17688,gap(220),
CO   AAHY01070585.1:1..47596,gap(20),AAHY01070586.1:1..1939,gap(20),
CO   complement(AAHY01070587.1:1..9304),gap(297),AAHY01070588.1:1..12692,
CO   gap(214),AAHY01070589.1:1..144653,gap(188),AAHY01070590.1:1..15340,
CO   gap(107),AAHY01070591.1:1..14368,gap(20),
CO   complement(AAHY01070592.1:1..38408),gap(20),
CO   complement(AAHY01070593.1:1..14779),gap(120),
CO   complement(AAHY01070594.1:1..49298),gap(503),
CO   complement(AAHY01070595.1:1..16611),gap(195),AAHY01070596.1:1..1786,
CO   gap(20),AAHY01070597.1:1..17697,gap(57),
CO   complement(AAHY01070598.1:1..11469),gap(155),
CO   complement(AAHY01070599.1:1..5861),gap(20),AAHY01070600.1:1..28379,
CO   gap(2830),AAHY01070601.1:1..24587,gap(20),AAHY01070602.1:1..6824,gap(20),
CO   AAHY01070603.1:1..47612,gap(90),complement(AAHY01070604.1:1..10250),
CO   gap(20),AAHY01070605.1:1..39982,gap(20),complement(AAHY01070606.1:1..4173),
CO   gap(1659),AAHY01070607.1:1..3811,gap(40),
CO   complement(AAHY01070608.1:1..1436),gap(20),AAHY01070609.1:1..30882,gap(85),
CO   AAHY01070610.1:1..11415,gap(20),AAHY01070611.1:1..4836,gap(217),
CO   AAHY01070612.1:1..22049,gap(4258),AAHY01070613.1:1..28041,gap(20),
CO   AAHY01070614.1:1..17213,gap(20),AAHY01070615.1:1..10708,gap(20),
CO   AAHY01070616.1:1..3535,gap(20),AAHY01070617.1:1..1023,gap(20),
CO   complement(AAHY01070618.1:1..1187),gap(20),AAHY01070619.1:1..125394,
CO   gap(20),complement(AAHY01070620.1:1..36607),gap(20),
CO   complement(AAHY01070621.1:1..48206),gap(20),AAHY01070622.1:1..23905,
CO   gap(4256),AAHY01070623.1:1..22235,gap(20),AAHY01070624.1:1..64605,gap(20),
CO   AAHY01070625.1:1..19316,gap(20),AAHY01070626.1:1..34395,gap(659),
CO   complement(AAHY01070627.1:1..56403),gap(34),AAHY01070628.1:1..79924,
CO   gap(20),AAHY01070629.1:1..1224,gap(129),AAHY01070630.1:1..69370,gap(412),
CO   AAHY01070631.1:1..2191,gap(20),AAHY01070632.1:1..11598,gap(20),
CO   AAHY01070633.1:1..34185,gap(308),AAHY01070634.1:1..15779,gap(251),
CO   AAHY01070635.1:1..3084,gap(28),AAHY01070636.1:1..12159,gap(20),
CO   AAHY01070637.1:1..9461,gap(20),AAHY01070638.1:1..26388,gap(20),
CO   AAHY01070639.1:1..27220,gap(20),AAHY01070640.1:1..13987,gap(704),
CO   AAHY01070641.1:1..8702,gap(917),complement(AAHY01070642.1:1..11107),
CO   gap(406),complement(AAHY01070643.1:1..34849),gap(20),
CO   AAHY01070644.1:1..33889,gap(20),AAHY01070645.1:1..50573,gap(53),
CO   AAHY01070646.1:1..12612,gap(358),complement(AAHY01070647.1:1..13916),
CO   gap(32),AAHY01070648.1:1..31400,gap(20),AAHY01070649.1:1..8580,gap(143),
CO   AAHY01070650.1:1..10708,gap(20),AAHY01070651.1:1..3824,gap(281),
CO   AAHY01070652.1:1..10127,gap(503),AAHY01070653.1:1..42405,gap(233),
CO   AAHY01070654.1:1..14481,gap(20),AAHY01070655.1:1..54089,gap(20),
CO   AAHY01070656.1:1..13691,gap(266),AAHY01070657.1:1..1036,gap(20),
CO   AAHY01070658.1:1..1820,gap(20),AAHY01070659.1:1..7559,gap(20),
CO   AAHY01070660.1:1..5957,gap(131),AAHY01070661.1:1..1380,gap(255),
CO   AAHY01070662.1:1..2525,gap(20),complement(AAHY01070663.1:1..1670),gap(20),
CO   AAHY01070664.1:1..2523,gap(5953),AAHY01070665.1:1..2544,gap(7385),
CO   AAHY01070666.1:1..1457,gap(20),AAHY01070667.1:1..1837,gap(20),
CO   complement(AAHY01070668.1:1..1120),gap(172),AAHY01070669.1:1..40126,
CO   gap(20),AAHY01070670.1:1..11070,gap(20),AAHY01070671.1:1..1204,gap(236),
CO   complement(AAHY01070672.1:1..981),gap(20),
CO   complement(AAHY01070673.1:1..1197),gap(20),AAHY01070674.1:1..72015,gap(20),
CO   complement(AAHY01070675.1:1..1295),gap(20),
CO   complement(AAHY01070676.1:1..1835),gap(20),AAHY01070677.1:1..1586,gap(538),
CO   AAHY01070678.1:1..2330,gap(20),AAHY01070679.1:1..3351,gap(634),
CO   AAHY01070680.1:1..1847,gap(20),AAHY01070681.1:1..2613,gap(20),
CO   AAHY01070682.1:1..6898,gap(20),AAHY01070683.1:1..5772,gap(640),
CO   complement(AAHY01070684.1:1..2467),gap(565),AAHY01070685.1:1..19944,
CO   gap(256),AAHY01070686.1:1..1480,gap(20),AAHY01070687.1:1..1657,gap(150),
CO   complement(AAHY01070688.1:1..1631),gap(20),AAHY01070689.1:1..1555,gap(20),
CO   complement(AAHY01070690.1:1..1598),gap(20),
CO   complement(AAHY01070691.1:1..1382),gap(20),
CO   complement(AAHY01070692.1:1..1808),gap(20),AAHY01070693.1:1..13445,gap(20),
CO   AAHY01070694.1:1..22028,gap(20),AAHY01070695.1:1..61598,gap(196),
CO   AAHY01070696.1:1..18255,gap(20),complement(AAHY01070697.1:1..1031),gap(20),
CO   AAHY01070698.1:1..2001,gap(20),complement(AAHY01070699.1:1..6600),gap(230),
CO   AAHY01070700.1:1..25628,gap(20),AAHY01070701.1:1..6362,gap(20),
CO   AAHY01070702.1:1..1031,gap(20),AAHY01070703.1:1..1128,gap(20),
CO   AAHY01070704.1:1..1078,gap(20),AAHY01070705.1:1..10983,gap(20),
CO   AAHY01070706.1:1..12404,gap(126),AAHY01070707.1:1..38332,gap(20),
CO   AAHY01070708.1:1..1028,gap(3745),AAHY01070709.1:1..2084,gap(20),
CO   complement(AAHY01070710.1:1..3770),gap(3462),AAHY01070711.1:1..17364,
CO   gap(20),AAHY01070712.1:1..3837,gap(131),AAHY01070713.1:1..11018,gap(20),
CO   complement(AAHY01070714.1:1..2001),gap(71),AAHY01070715.1:1..1260,gap(20),
CO   complement(AAHY01070716.1:1..7756),gap(24),AAHY01070717.1:1..24524,
CO   gap(435),AAHY01070718.1:1..8894,gap(125),AAHY01070719.1:1..16706,gap(90),
CO   AAHY01070720.1:1..52397,gap(329),complement(AAHY01070721.1:1..1029),
CO   gap(12849),AAHY01070722.1:1..13059,gap(20),AAHY01070723.1:1..25430,
CO   gap(158),AAHY01070724.1:1..9465,gap(64),AAHY01070725.1:1..32175,gap(467),
CO   complement(AAHY01070726.1:1..915),gap(41),AAHY01070727.1:1..2021,gap(1230),
CO   AAHY01070728.1:1..1657,gap(20),AAHY01070729.1:1..9976,gap(69),
CO   AAHY01070730.1:1..21744,gap(20),AAHY01070731.1:1..16240,gap(453),
CO   AAHY01070732.1:1..10329,gap(2970),AAHY01070733.1:1..16636,gap(20),
CO   AAHY01070734.1:1..5704,gap(20),AAHY01070735.1:1..16890,gap(20),
CO   AAHY01070736.1:1..45354,gap(20),complement(AAHY01070737.1:1..8969),gap(20),
CO   complement(AAHY01070738.1:1..3138),gap(20),
CO   complement(AAHY01070739.1:1..1841),gap(20),AAHY01070740.1:1..2970,gap(179),
CO   AAHY01070741.1:1..1307,gap(20),AAHY01070742.1:1..13811,gap(20),
CO   AAHY01070743.1:1..14711,gap(2110),AAHY01070744.1:1..24997,gap(20),
CO   complement(AAHY01070745.1:1..11556),gap(20),AAHY01070746.1:1..1048,gap(20),
CO   AAHY01070747.1:1..1108,gap(20),AAHY01070748.1:1..9999,gap(1265),
CO   AAHY01070749.1:1..44368,gap(20),AAHY01070750.1:1..1334,gap(20),
CO   AAHY01070751.1:1..38828,gap(487),AAHY01070752.1:1..54103,gap(97),
CO   AAHY01070753.1:1..36576,gap(96),AAHY01070754.1:1..1436,gap(332),
CO   AAHY01070755.1:1..33080,gap(20),AAHY01070756.1:1..43982,gap(20),
CO   AAHY01070757.1:1..3412,gap(20),AAHY01070758.1:1..1016,gap(20),
CO   complement(AAHY01070759.1:1..3385),gap(20),AAHY01070760.1:1..15132,gap(20),
CO   complement(AAHY01070761.1:1..1425),gap(299),
CO   complement(AAHY01070762.1:1..1224),gap(20),AAHY01070763.1:1..1028,gap(20),
CO   AAHY01070764.1:1..3752,gap(20),AAHY01070765.1:1..28341,gap(20),
CO   complement(AAHY01070766.1:1..2639),gap(20),AAHY01070767.1:1..21671,gap(20),
CO   AAHY01070768.1:1..7545,gap(517),AAHY01070769.1:1..7309,gap(20),
CO   complement(AAHY01070770.1:1..2979),gap(20),AAHY01070771.1:1..1154,gap(20),
CO   complement(AAHY01070772.1:1..2197),gap(20),AAHY01070773.1:1..2754,
CO   gap(6272),complement(AAHY01070774.1:1..2736),gap(20),
CO   AAHY01070775.1:1..1736,gap(20),complement(AAHY01070776.1:1..1231),gap(20),
CO   AAHY01070777.1:1..3313,gap(20),AAHY01070778.1:1..14072,gap(20),
CO   AAHY01070779.1:1..1203,gap(134),complement(AAHY01070780.1:1..16499),
CO   gap(20),AAHY01070781.1:1..1288,gap(20),AAHY01070782.1:1..1075,gap(20),
CO   AAHY01070783.1:1..2620,gap(650),AAHY01070784.1:1..5267,gap(1015),
CO   AAHY01070785.1:1..766,gap(372),complement(AAHY01070786.1:1..1173),gap(20),
CO   AAHY01070787.1:1..1670,gap(20),AAHY01070788.1:1..13871,gap(20),
CO   AAHY01070789.1:1..96043,gap(20),AAHY01070790.1:1..17936,gap(20),
CO   AAHY01070791.1:1..19861,gap(337),AAHY01070792.1:1..11851,gap(192),
CO   complement(AAHY01070793.1:1..5000),gap(1194),AAHY01070794.1:1..7920,
CO   gap(176),AAHY01070795.1:1..55982,gap(122),
CO   complement(AAHY01070796.1:1..17334),gap(104),
CO   complement(AAHY01070797.1:1..11299),gap(295),
CO   complement(AAHY01070798.1:1..23278),gap(20),AAHY01070799.1:1..25224,
CO   gap(959),AAHY01070800.1:1..7549,gap(690),
CO   complement(AAHY01070801.1:1..56007),gap(910),
CO   complement(AAHY01070802.1:1..4076),gap(20),
CO   complement(AAHY01070803.1:1..20040),gap(126),
CO   complement(AAHY01070804.1:1..15803),gap(376),
CO   complement(AAHY01070805.1:1..25238),gap(20),AAHY01070806.1:1..11980,
CO   gap(910),AAHY01070807.1:1..20542,gap(4228),
CO   complement(AAHY01070808.1:1..1730),gap(20),
CO   complement(AAHY01070809.1:1..1181),gap(20),AAHY01070810.1:1..1487,gap(20),
CO   complement(AAHY01070811.1:1..15420),gap(20),AAHY01070812.1:1..1020,gap(20),
CO   complement(AAHY01070813.1:1..3557),gap(20),AAHY01070814.1:1..24219,gap(20),
CO   AAHY01070815.1:1..1495,gap(20),AAHY01070816.1:1..17150,gap(262),
CO   complement(AAHY01070817.1:1..13178),gap(20),AAHY01070818.1:1..26658,
CO   gap(690),complement(AAHY01070819.1:1..933),gap(5111),
CO   complement(AAHY01070820.1:1..4489),gap(20),
CO   complement(AAHY01070821.1:1..13140),gap(176),AAHY01070822.1:1..37792,
CO   gap(68),complement(AAHY01070823.1:1..1244),gap(20),AAHY01070824.1:1..4974,
CO   gap(20),AAHY01070825.1:1..22198,gap(673),
CO   complement(AAHY01070826.1:1..11901),gap(20),
CO   complement(AAHY01070827.1:1..13919),gap(148),
CO   complement(AAHY01070828.1:1..28173),gap(20),
CO   complement(AAHY01070829.1:1..7487),gap(20),AAHY01070830.1:1..6165,gap(20),
CO   AAHY01070831.1:1..4040,gap(20),complement(AAHY01070832.1:1..530),gap(152),
CO   AAHY01070833.1:1..35115,gap(3340),AAHY01070834.1:1..13446,gap(165),
CO   complement(AAHY01070835.1:1..48809),gap(1183),
CO   complement(AAHY01070836.1:1..1085),gap(4176),
CO   complement(AAHY01070837.1:1..4810),gap(20),
CO   complement(AAHY01070838.1:1..4599),gap(6279),AAHY01070839.1:1..1192,
CO   gap(20),complement(AAHY01070840.1:1..19479),gap(20),AAHY01070841.1:1..9710,
CO   gap(52),AAHY01070842.1:1..44521,gap(20),AAHY01070843.1:1..16485,gap(6516),
CO   AAHY01070844.1:1..4267,gap(20),AAHY01070845.1:1..6571,gap(4127),
CO   AAHY01070846.1:1..2413,gap(38),complement(AAHY01070847.1:1..1922),
CO   gap(1159),AAHY01070848.1:1..40521,gap(2198),AAHY01070849.1:1..73603,
CO   gap(228),AAHY01070850.1:1..33322,gap(1791),AAHY01070851.1:1..1728,
CO   gap(1843),AAHY01070852.1:1..13230,gap(20),
CO   complement(AAHY01070853.1:1..1072),gap(20),AAHY01070854.1:1..45293,gap(20),
CO   complement(AAHY01070855.1:1..33394),gap(20),AAHY01070856.1:1..8261,gap(20),
CO   AAHY01070857.1:1..9863,gap(20),AAHY01070858.1:1..23349,gap(112),
CO   AAHY01070859.1:1..7213,gap(20),AAHY01070860.1:1..62625,gap(20),
CO   AAHY01070861.1:1..71182,gap(104),AAHY01070862.1:1..9409,gap(20),
CO   AAHY01070863.1:1..24131,gap(761),AAHY01070864.1:1..2812,gap(20),
CO   AAHY01070865.1:1..9335,gap(20),AAHY01070866.1:1..9087,gap(500),
CO   AAHY01070867.1:1..26717,gap(20),complement(AAHY01070868.1:1..963),gap(168),
CO   AAHY01070869.1:1..51485,gap(329),AAHY01070870.1:1..6884,gap(930),
CO   AAHY01070871.1:1..30547,gap(65),AAHY01070872.1:1..3511,gap(124),
CO   AAHY01070873.1:1..21856,gap(29),complement(AAHY01070874.1:1..269),gap(20),
CO   AAHY01070875.1:1..22278,gap(208),AAHY01070876.1:1..1875,gap(128),
CO   AAHY01070877.1:1..47173,gap(63),AAHY01070878.1:1..14169,gap(20),
CO   complement(AAHY01070879.1:1..2386),gap(20),AAHY01070880.1:1..21489,gap(20),
CO   complement(AAHY01070881.1:1..5645),gap(247),AAHY01070882.1:1..19338,
CO   gap(20),complement(AAHY01070883.1:1..11272),gap(377),
CO   AAHY01070884.1:1..65355,gap(20),AAHY01070885.1:1..41830,gap(20),
CO   complement(AAHY01070886.1:1..1849),gap(329),AAHY01070887.1:1..26177,
CO   gap(50),AAHY01070888.1:1..16707,gap(4854),AAHY01070889.1:1..2564,gap(425),
CO   complement(AAHY01070890.1:1..1416),gap(20),
CO   complement(AAHY01070891.1:1..1409),gap(4751),AAHY01070892.1:1..2176,
CO   gap(20),AAHY01070893.1:1..55395,gap(20),AAHY01070894.1:1..11483,gap(49),
CO   AAHY01070895.1:1..22487,gap(20),AAHY01070896.1:1..1163,gap(105),
CO   complement(AAHY01070897.1:1..1113),gap(20),
CO   complement(AAHY01070898.1:1..1268),gap(580),AAHY01070899.1:1..27479,
CO   gap(20),complement(AAHY01070900.1:1..6059),gap(65),AAHY01070901.1:1..17117,
CO   gap(20),AAHY01070902.1:1..8884,gap(98),AAHY01070903.1:1..46338,gap(20),
CO   AAHY01070904.1:1..8310,gap(136),AAHY01070905.1:1..32790,gap(20),
CO   AAHY01070906.1:1..6046,gap(68),complement(AAHY01070907.1:1..6388),
CO   gap(1212),complement(AAHY01070908.1:1..3844),gap(28),
CO   AAHY01070909.1:1..9139,gap(99),AAHY01070910.1:1..1543,gap(823),
CO   AAHY01070911.1:1..1918,gap(33),AAHY01070912.1:1..76398,gap(20),
CO   AAHY01070913.1:1..42585,gap(20),complement(AAHY01070914.1:1..25137),
CO   gap(32),complement(AAHY01070915.1:1..38088),gap(20),
CO   complement(AAHY01070916.1:1..6992),gap(20),AAHY01070917.1:1..1887,gap(20),
CO   complement(AAHY01070918.1:1..21802),gap(20),AAHY01070919.1:1..1418,gap(71),
CO   complement(AAHY01070920.1:1..13413),gap(432),AAHY01070921.1:1..15078,
CO   gap(20),AAHY01070922.1:1..34295,gap(166),AAHY01070923.1:1..4964,gap(39),
CO   AAHY01070924.1:1..68984,gap(20),AAHY01070925.1:1..2057,gap(214),
CO   AAHY01070926.1:1..1288,gap(85),complement(AAHY01070927.1:1..30578),
CO   gap(245),AAHY01070928.1:1..13146,gap(2065),AAHY01070929.1:1..5584,gap(20),
CO   AAHY01070930.1:1..22739,gap(20),AAHY01070931.1:1..64382,gap(1547),
CO   AAHY01070932.1:1..53173,gap(310),AAHY01070933.1:1..7789,gap(20),
CO   complement(AAHY01070934.1:1..10042),gap(222),AAHY01070935.1:1..5813)
//


spacer
spacer