spacer

EBI Dbfetch

ID   CH466553; SV 2; linear; genomic DNA; CON; MUS; 23075134 BP.
XX
AC   CH466553;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009814720 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-23075134
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-23075134
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-23075134
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 79aad2f48a2e2d6bb027896271d72af2.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000218.
DR   Ensembl-Gn; ENSMUSG00000000290; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000731; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000901; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000902; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000903; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001663; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001665; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001666; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003072; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003345; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004665; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004667; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004931; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004933; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004934; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004937; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005357; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006344; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006345; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009070; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009092; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009114; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009115; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009292; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009293; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013833; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014329; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019927; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019933; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020069; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020070; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020075; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020081; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020086; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020091; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020096; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020100; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020107; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020108; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020109; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020135; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020163; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020178; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020226; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020230; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020232; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020235; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020262; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020265; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020277; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020284; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020308; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020310; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020325; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020329; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023175; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032714; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032977; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033208; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033318; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033416; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034758; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034781; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034881; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034917; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034974; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035011; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035027; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035242; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035262; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035397; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035595; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035773; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035781; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035863; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036764; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037031; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037171; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037202; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037868; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042774; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043259; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043822; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045193; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046687; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048240; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049422; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049764; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051190; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051652; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052151; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053603; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054206; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054452; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055515; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057337; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059901; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060205; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061780; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069565; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069584; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071185; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078439; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078441; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078442; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090439; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091468; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094146; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095721; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095970; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096421; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000746; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000926; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001240; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001712; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001713; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002518; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004784; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004786; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005067; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006508; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009259; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020101; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020263; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020283; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020288; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020308; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020372; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020493; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020496; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020552; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036016; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038169; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038558; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039836; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041882; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043317; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043604; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045529; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045628; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045744; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047883; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048128; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049339; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053865; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054167; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056086; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058906; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062883; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079235; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079883; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092370; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092371; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095426; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095446; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099501; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105323; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105352; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105389; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105397; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105414; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105420; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119492; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119606; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120281; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121138; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130422; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000137841; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147914; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164034; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164428; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166088; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167481; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170048; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170596; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170795; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171416; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172282; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174510; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178422; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178581; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179726; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179781; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181039; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182152; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182439; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182912; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980136.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23075134
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            156932..480713
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /note="gene_id=mCG19013.2"
FT   mRNA            join(156932..157699,327721..327996,350894..350989,
FT                   392665..393024,393067..393137,426904..427039,
FT                   474439..474773,479288..480713)
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /product="RIKEN cDNA 4831416G18, transcript variant
FT                   mCT16903"
FT                   /note="gene_id=mCG19013.2 transcript_id=mCT16903.2 created
FT                   on 19-NOV-2002"
FT   mRNA            join(<157031..157699,327721..327996,350894..350989,
FT                   392665..393024,415392..415492,426904..427074,
FT                   430116..430372,447629..447948,474439..474773,
FT                   479288..480221)
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /product="RIKEN cDNA 4831416G18, transcript variant
FT                   mCT192947"
FT                   /note="gene_id=mCG19013.2 transcript_id=mCT192947.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<157115..157699,327721..327996,350894..350989,
FT                   392665..393024,415392..415492,426904..427074,
FT                   430116..430372,447629..447948,474439..474773,
FT                   479288..479456)
FT                   /codon_start=1
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /product="RIKEN cDNA 4831416G18, isoform CRA_b"
FT                   /note="gene_id=mCG19013.2 transcript_id=mCT192947.0
FT                   protein_id=mCP113918.0 isoform=CRA_b"
FT                   /protein_id="EDL32211.1"
FT                   /translation="AARWARAGASPMLLGASWLCASKAAATAARGEGEDRQGEQQRGAQ
FT                   ARTEEDMDESSLLDLLECSVCLERLDTTAKVLPCQHTFCRRCLESIVCSRHELRCPECR
FT                   ILVGCGVDELPANILLVRLLDGIRQRPRTGASPGSSPPARPGPGTFSALAGGAGGATGS
FT                   PPCSPVFLSAAAGSSTSSLCDVATNRSVPVAKTLSQLPYAKALYSYEGKEPGDLKFNKG
FT                   DIIILRRKVDENWYHGELQGMHGFLPASYIQCVRPLPQALPQGKALYDFEMKDRDQDKD
FT                   CLTFTKDEVLTVIRRVDDNWAEGMLGDKIGIFPLLYVELNDSAKQLIEMDKLCPAATTA
FT                   YNYDALLSSDPSTVASVAPGPTLSSSGAVSAFQRRVDSKKNAKKRHSFTALSVTHKSSQ
FT                   AASHRHSMEISAPVLISSSDPRAAARIGELAHLSCTVPTQDSSSAGPVPTALPRAAAVA
FT                   GEQGMSPKVQLPLNVYLALYAYKPQKNDELELRKGEMYRVLEKCQDGWFKGASLKTGVS
FT                   GVFPGNYVTPVSRVPGGGAGLPWNNVLGGSPLAKGMATIMHPGGGSLSSPATAARSALP
FT                   LTTLQDHMQHPATSLPTGSCLRHSAQPTASQAGDTTIPTATHASAQALDRPTATVSPLR
FT                   TQTSPSRLPSTGLRPRSVASPQHGQQSPAQMCPRPAIPFTSAASAITPPNVSAANLSGE
FT                   VGGTPISGLSTPSLINTGFKPDDKKNEKKEKKSGLLKLLAGASTKKKSRSPPSVSPTHD
FT                   PQSAMDTSLQGAMGPEVSPLTVHGRAGSCPIESEMQGAIGLEPLHRKAGSLDLNFSLSP
FT                   SRQATLSMASIRPEPKPLPRERYRVVVSYPPQSEAEIELKEGDIVFVHKKHEDGWFKGT
FT                   LQRNGRTGLFPGSFVESF"
FT   CDS             join(157148..157699,327721..327996,350894..350989,
FT                   392665..393024,393067..393137,426904..427039,
FT                   474439..474773,479288..479456)
FT                   /codon_start=1
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /product="RIKEN cDNA 4831416G18, isoform CRA_a"
FT                   /note="gene_id=mCG19013.2 transcript_id=mCT16903.2
FT                   protein_id=mCP1515.2 isoform=CRA_a"
FT                   /protein_id="EDL32210.1"
FT                   /translation="MLLGASWLCASKAAATAARGEGEDRQGEQQRGAQARTEEDMDESS
FT                   LLDLLECSVCLERLDTTAKVLPCQHTFCRRCLESIVCSRHELRCPECRILVGCGVDELP
FT                   ANILLVRLLDGIRQRPRTGASPGSSPPARPGPGTFSALAGGAGGATGSPPCSPVFLSAA
FT                   AGSSTSSLCDVATNRSVPVAKTLSQLPYAKALYSYEGKEPGDLKFNKGDIIILRRKVDE
FT                   NWYHGELQGMHGFLPASYIQCVRPLPQALPQGKALYDFEMKDRDQDKDCLTFTKDEVLT
FT                   VIRRVDDNWAEGMLGDKIGIFPLLYVELNDSAKQLIEMDKLCPAATTAYNYDALLSSDP
FT                   STVASVAPGPTLSSSGAVSAFQRRVDSKKNAKKRHSFTALSVTHKSSQAASHRHSMEIS
FT                   APVLISSSDPRAAARIGELAHLSCTVPTQFLFYLYTLSPGFLSYPEGSYTRTRYLALYA
FT                   YKPQKNDELELRKGEMYRVLEKCQDGWFKGASLKTGVSGKEKKSGLLKLLAGASTKKKS
FT                   RSPPSVSPTHDPQSAMDTSLQGAMGPEVSPLTVHGRAGSCPIESEMQGAIGLEPLHRKA
FT                   GSLDLNFSLSPSRQATLSMASIRPEPKPLPRERYRVVVSYPPQSEAEIELKEGDIVFVH
FT                   KKHEDGWFKGTLQRNGRTGLFPGSFVESF"
FT   gene            complement(485095..565494)
FT                   /gene="Sept10"
FT                   /locus_tag="mCG_19014"
FT                   /note="gene_id=mCG19014.2"
FT   mRNA            complement(join(485095..485208,510148..510335,
FT                   514458..514590,520492..520660,522405..522501,
FT                   524664..524825,527169..527355,535810..536005,
FT                   536342..536459,565040..565494))
FT                   /gene="Sept10"
FT                   /locus_tag="mCG_19014"
FT                   /product="septin 10"
FT                   /note="gene_id=mCG19014.2 transcript_id=mCT16904.2 created
FT                   on 19-NOV-2002"
FT   CDS             complement(join(485118..485208,510148..510335,
FT                   514458..514590,520492..520660,522405..522501,
FT                   524664..524825,527169..527355,535810..536005,
FT                   536342..536459,565040..565057))
FT                   /codon_start=1
FT                   /gene="Sept10"
FT                   /locus_tag="mCG_19014"
FT                   /product="septin 10"
FT                   /note="gene_id=mCG19014.2 transcript_id=mCT16904.2
FT                   protein_id=mCP1444.2"
FT                   /protein_id="EDL32209.1"
FT                   /translation="MASCDEIKEHPRSLSMCGHVGFESLPDQLVDRSIEQGFCFNILCV
FT                   GETGIGKSTLINTLFNTNFEELESSHFCPCVRLRAQTYELQESNVRLKLTIVNTVGFGD
FT                   QINKEDSYQPIVDYIDDQFEAYLQEELKIKRALFNYHDSRIHVCLYFIAPTGHSLRTLD
FT                   LLTMKSLDNKVNIIPLIAKADTISKSELQKFKMKLMNELVINGVQIYQFPTDDDTTSKI
FT                   NGAMNGHLPFAVVGSMDEIKVGNKMVKGRQYPWGIVQVENENHCDFVKLREMLICTNME
FT                   DLREQTHMRHYELYRRCKLQEMGFVDMGPENKPLSLQETYEAKRHEFYGERQRKEEQMK
FT                   QMFVQRVKEKEAILKEAERELQAKFEHLKRIHQEERMKLEEKRRMLEEESVAFAKKKAT
FT                   CELFPNQSFLASGSSIRKDKDRKKADGASAFCDCLTAQESVRLCISSPRKDMD"
FT   gene            667057..717064
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /note="gene_id=mCG11297.2"
FT   mRNA            join(667057..667237,680815..680917,683057..683153,
FT                   686445..686596,687418..687555,691942..692181,
FT                   694165..694361,695844..696020,698101..698171,
FT                   705622..705721,709050..709103,711050..711115,
FT                   713002..713070,713348..713444,714765..717064)
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha 1 polypeptide, transcript
FT                   variant mCT11585"
FT                   /note="gene_id=mCG11297.2 transcript_id=mCT11585.2 created
FT                   on 19-NOV-2002"
FT   mRNA            join(667057..667237,680815..680917,683057..683153,
FT                   686445..686596,687418..687555,691942..692181,
FT                   694165..694361,695844..696020,699111..699181,
FT                   705622..705721,709050..709103,711050..711115,
FT                   713002..713070,713348..713444,714765..717064)
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha 1 polypeptide, transcript
FT                   variant mCT176004"
FT                   /note="gene_id=mCG11297.2 transcript_id=mCT176004.0 created
FT                   on 19-NOV-2002"
FT   CDS             join(680842..680917,683057..683153,686445..686596,
FT                   687418..687555,691942..692181,694165..694361,
FT                   695844..696020,698101..698171,705622..705721,
FT                   709050..709103,711050..711115,713002..713070,
FT                   713348..713444,714765..714835)
FT                   /codon_start=1
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha 1 polypeptide, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11297.2 transcript_id=mCT11585.2
FT                   protein_id=mCP1441.2 isoform=CRA_a"
FT                   /protein_id="EDL32207.1"
FT                   /translation="MIWVVLMMAILLPQSLAHPGFFTSIGQMTDLIHNEKDLVTSLKDY
FT                   IKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLILK
FT                   DMSDGFISNLTIQRQYFPNDEDQVGAAKALFRLQDTYNLDTNTISKGNLPGVQHKSFLT
FT                   AEDCFELGKVAYTEADYYHTELWMEQALTQLEEGELSTVDKVSVLDYLSYAVYQQGDLD
FT                   KALLLTKKLLELDPEHQRANGNLVYFEYIMSKEKDANKSASGDQSDQKTAPKKKGIAVD
FT                   YLPERQKYEMLCRGEGIKMTPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRF
FT                   HDIISDAEIEIVKDLAKPRLRRATISNPVTGALETVHYRISKSAWLSGYEDPVVSRINM
FT                   RIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMS
FT                   DVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWL
FT                   HERGQEFRRPCTLSELE"
FT   CDS             join(680842..680917,683057..683153,686445..686596,
FT                   687418..687555,691942..692181,694165..694361,
FT                   695844..696020,699111..699181,705622..705721,
FT                   709050..709103,711050..711115,713002..713070,
FT                   713348..713444,714765..714835)
FT                   /codon_start=1
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha 1 polypeptide, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11297.2 transcript_id=mCT176004.0
FT                   protein_id=mCP98926.0 isoform=CRA_b"
FT                   /protein_id="EDL32208.1"
FT                   /translation="MIWVVLMMAILLPQSLAHPGFFTSIGQMTDLIHNEKDLVTSLKDY
FT                   IKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLILK
FT                   DMSDGFISNLTIQRQYFPNDEDQVGAAKALFRLQDTYNLDTNTISKGNLPGVQHKSFLT
FT                   AEDCFELGKVAYTEADYYHTELWMEQALTQLEEGELSTVDKVSVLDYLSYAVYQQGDLD
FT                   KALLLTKKLLELDPEHQRANGNLVYFEYIMSKEKDANKSASGDQSDQKTAPKKKGIAVD
FT                   YLPERQKYEMLCRGEGIKMTPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRF
FT                   HDIISDAEIEIVKDLAKPRLSRATVHDPETGKLTTAQYRVSKSAWLSGYEDPVVSRINM
FT                   RIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMS
FT                   DVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWL
FT                   HERGQEFRRPCTLSELE"
FT   gene            739387..740530
FT                   /locus_tag="mCG_11298"
FT                   /note="gene_id=mCG11298.1"
FT   mRNA            739387..740530
FT                   /locus_tag="mCG_11298"
FT                   /product="mCG11298"
FT                   /note="gene_id=mCG11298.1 transcript_id=mCT11584.1 created
FT                   on 19-NOV-2002"
FT   CDS             739519..740148
FT                   /codon_start=1
FT                   /locus_tag="mCG_11298"
FT                   /product="mCG11298"
FT                   /note="gene_id=mCG11298.1 transcript_id=mCT11584.1
FT                   protein_id=mCP1481.1"
FT                   /db_xref="GOA:Q9CXU4"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="InterPro:IPR005681"
FT                   /db_xref="MGI:MGI:1858317"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CXU4"
FT                   /protein_id="EDL32206.1"
FT                   /translation="MEGGGGSSNKSTSGLAGFFGAGGAGYSNADLAGVPLTGMNPLSPY
FT                   LNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQ
FT                   SMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTM
FT                   TGMLYKCTGGLRGIARGGLAGLTLTSLYALYNNWEHMKGSLLQQSL"
FT   gene            747424..765732
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /note="gene_id=mCG11300.2"
FT   mRNA            join(747424..747746,754734..754822,760103..760268,
FT                   765127..765732)
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /product="phospholipase A2, group XIIB, transcript variant
FT                   mCT173950"
FT                   /note="gene_id=mCG11300.2 transcript_id=mCT173950.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(747424..747746,754734..754822,760103..760268,
FT                   765218..765732)
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /product="phospholipase A2, group XIIB, transcript variant
FT                   mCT11587"
FT                   /note="gene_id=mCG11300.2 transcript_id=mCT11587.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(747536..747746,754734..754822,760103..760268,
FT                   765218..765339)
FT                   /codon_start=1
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /product="phospholipase A2, group XIIB, isoform CRA_a"
FT                   /note="gene_id=mCG11300.2 transcript_id=mCT11587.1
FT                   protein_id=mCP1496.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VC81"
FT                   /db_xref="InterPro:IPR010711"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="MGI:MGI:1917086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VC81"
FT                   /protein_id="EDL32204.1"
FT                   /translation="MKLLCGFFLLWLGLVGNLAQSDPSPKEEESYSDWGLRQLRGSFES
FT                   VNSYVDSFMELLGGKNGVCQYRCRYGKAPMPRPGYKAQEPNGCSSYFLGIKVPGSMDLG
FT                   IPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEAACDSLAD
FT                   TVFNTVWTLGCRPFMNSQRAACICAEEEKEEL"
FT   CDS             join(747536..747746,754734..754822,760103..760268,
FT                   765127..765227)
FT                   /codon_start=1
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /product="phospholipase A2, group XIIB, isoform CRA_b"
FT                   /note="gene_id=mCG11300.2 transcript_id=mCT173950.0
FT                   protein_id=mCP96869.0 isoform=CRA_b"
FT                   /protein_id="EDL32205.1"
FT                   /translation="MKLLCGFFLLWLGLVGNLAQSDPSPKEEESYSDWGLRQLRGSFES
FT                   VNSYVDSFMELLGGKNGVCQYRCRYGKAPMPRPGYKAQEPNGCSSYFLGIKVPGSMDLG
FT                   IPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEALCSSPWK
FT                   YPASPAPGVVCAGSLRFYSSFSSSL"
FT   gene            complement(766713..785533)
FT                   /gene="Oit3"
FT                   /locus_tag="mCG_122796"
FT                   /note="gene_id=mCG122796.1"
FT   mRNA            complement(join(766713..767867,769132..769231,
FT                   771699..772114,773246..773406,774648..774770,
FT                   779622..779744,781465..781572,782296..782670,
FT                   785378..785533))
FT                   /gene="Oit3"
FT                   /locus_tag="mCG_122796"
FT                   /product="oncoprotein induced transcript 3"
FT                   /note="gene_id=mCG122796.1 transcript_id=mCT124024.1
FT                   created on 18-NOV-2002"
FT   CDS             complement(join(767694..767867,769132..769231,
FT                   771699..772114,773246..773406,774648..774770,
FT                   779622..779744,781465..781572,782296..782670,
FT                   785378..785438))
FT                   /codon_start=1
FT                   /gene="Oit3"
FT                   /locus_tag="mCG_122796"
FT                   /product="oncoprotein induced transcript 3"
FT                   /note="gene_id=mCG122796.1 transcript_id=mCT124024.1
FT                   protein_id=mCP54880.1"
FT                   /protein_id="EDL32203.1"
FT                   /translation="MPLSLLLTCLSTTVTLVSPAVLDPCSAYISLNEPWRNTDHQFDES
FT                   QNQPLCDNHMNGEWYRFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEEDGIVQRQA
FT                   CASFKGNCCLWNATVEVKACPRGYYVYRLARPSVCFHVYCGHFYDICDEDCHGNCLDTT
FT                   ECACSPGTSLGPDGQTCFDENECEHNNGGCSEICVNLKNSHRCACGVGRVLRSDGKTCE
FT                   DIEGCHNNNGGCSHSCLGSEEGYQCECPRGLVLSEDNHTCQVPVLCKSSAIEVSVPREL
FT                   VGGLELFLTNTSCRGVSNGTHVNIVFSLKTCGTVVDVVNDKIVASNIVTGLPKETPGSS
FT                   GDIIIRTSKLLIPVTCEFPRLYTISEGYVPNLRNAPLEIRSRNHGIFPFTLEIFKDHEF
FT                   EEPYRETLPTLKLRDSLYFGIEPLVHVNGLESLVESCFATPTAKMDEILKYYLIQDGCV
FT                   SDDSVKQYSSRDHLAKHFQAPVFKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRV
FT                   RREVGEDEDSAGLQSQTLTGGPIAIDWED"
FT   gene            complement(792234..959892)
FT                   /locus_tag="mCG_11304"
FT                   /note="gene_id=mCG11304.2"
FT   mRNA            complement(join(792234..792611,794959..795075,
FT                   798699..798902,800402..800562,810208..810312,
FT                   811380..811550,834698..834767,959736..959892))
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, transcript variant mCT11591"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT11591.2 created
FT                   on 18-NOV-2002"
FT   CDS             complement(join(792534..792611,794959..795075,
FT                   798699..798902,800402..800562,810208..810312,
FT                   811380..811550,834698..834767,959736..959882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, isoform CRA_a"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT11591.2
FT                   protein_id=mCP1436.1 isoform=CRA_a"
FT                   /protein_id="EDL32200.1"
FT                   /translation="MAAAAGRSLLLLLCSRGGGGGAGGCGALTAGCFPGLGVSRHRPHQ
FT                   QHRTAHQRPASWQSVGAAYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPIS
FT                   DSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPK
FT                   RDLLSHEDAATLNDVKTLVQQLYTTLCIEQHQLNKERELVERLEDLKQQLAPLEKVRIE
FT                   ISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYF
FT                   VMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVH
FT                   LPLRQIGEKE"
FT   mRNA            complement(join(945879..946305,959736..959892))
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, transcript variant mCT161890"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT161890.1 created
FT                   on 18-NOV-2002"
FT   mRNA            complement(join(945879..946305,949345..949389,
FT                   959736..959892))
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, transcript variant mCT176017"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT176017.0 created
FT                   on 18-NOV-2002"
FT   CDS             complement(join(946297..946305,959736..959882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, isoform CRA_b"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT161890.1
FT                   protein_id=mCP55349.1 isoform=CRA_b"
FT                   /protein_id="EDL32201.1"
FT                   /translation="MAAAAGRSLLLLLCSRGGGGGAGGCGALTAGCFPGLGVSRHRPHQ
FT                   QHRTTS"
FT   CDS             complement(join(949363..949389,959736..959882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, isoform CRA_c"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT176017.0
FT                   protein_id=mCP98939.0 isoform=CRA_c"
FT                   /protein_id="EDL32202.1"
FT                   /translation="MAAAAGRSLLLLLCSRGGGGGAGGCGALTAGCFPGLGVSRHRPHQ
FT                   QHRTLNVQVLSS"
FT   gene            1045143..1205269
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /note="gene_id=mCG141510.0"
FT   mRNA            join(1045143..1045269,1045728..1045812,1048712..1048781,
FT                   1070539..1070700,1075565..1075739,1083242..1083404,
FT                   1093086..1093129,1110720..1110834,1130892..1130974,
FT                   1131830..1132027,1170390..1170527,1182873..1182981,
FT                   1202507..1202596,1204123..1205269)
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   transcript variant mCT175740"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT175740.0
FT                   created on 14-NOV-2002"
FT   mRNA            join(<1045179..1045269,1070539..1070700,1075565..1075739,
FT                   1083242..1083404,1093086..1093141,1110720..1110834,
FT                   1130892..1130974,1131830..1132027,1170390..1170527,
FT                   1182873..1182981,1202507..1202596,1204123..1205074)
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   transcript variant mCT192941"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT192941.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<1045217..1045269,1070539..1070700,1075565..1075739,
FT                   1083242..1083404,1093086..1093129,1110720..1110834,
FT                   1130892..1130974,1131830..1132027,1170390..1170527,
FT                   1182873..1182981,1202507..1202596,1204123..1205064)
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   transcript variant mCT192940"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT192940.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1045253..1045269,1070539..1070700,1075565..1075739,
FT                   1083242..1083404,1093086..1093141,1110720..1110834,
FT                   1130892..1130974,1131830..1132027,1170390..1170527,
FT                   1182873..1182981,1202507..1202596,1204123..1204280)
FT                   /codon_start=1
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT192941.0
FT                   protein_id=mCP113912.0 isoform=CRA_c"
FT                   /protein_id="EDL32199.1"
FT                   /translation="SWSADGMFRLNTLSALAELAVGSRWYHGASQPTQTKRRLMLVAFL
FT                   GASAVTASTGLLWKKAHAESPPCVNSKKPDTEDKERNKDSGEVSSREGRAADAAAEPYP
FT                   EDKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRS
FT                   ITPNEKQPEHLGLDQYIIKRFDGKVSRLKIAQEREKFADEGSIFYSLGECGLISFSDYI
FT                   FLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNT
FT                   LKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFG
FT                   GMLLAYSGVQSKKLTAMQRQLKKHFKDGKGLTFQEVENFFTFLKNINDVDTALSFYHMA
FT                   GASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLE
FT                   KPKDMGFTRLMQAMWKCAQETAWDFALPK"
FT   CDS             join(<1045253..1045269,1070539..1070700,1075565..1075739,
FT                   1083242..1083404,1093086..1093129,1110720..1110834,
FT                   1130892..1130974,1131830..1132027,1170390..1170527,
FT                   1182873..1182981,1202507..1202596,1204123..1204280)
FT                   /codon_start=1
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT192940.0
FT                   protein_id=mCP113911.0 isoform=CRA_b"
FT                   /protein_id="EDL32198.1"
FT                   /translation="SWSADGMFRLNTLSALAELAVGSRWYHGASQPTQTKRRLMLVAFL
FT                   GASAVTASTGLLWKKAHAESPPCVNSKKPDTEDKERNKDSGEVSSREGRAADAAAEPYP
FT                   EDKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRS
FT                   ITPNEKQPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTT
FT                   VLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSG
FT                   LCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLL
FT                   AYSGVQSKKLTAMQRQLKKHFKDGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASL
FT                   DKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKD
FT                   MGFTRLMQAMWKCAQETAWDFALPK"
FT   CDS             join(1070540..1070700,1075565..1075739,1083242..1083404,
FT                   1093086..1093129,1110720..1110834,1130892..1130974,
FT                   1131830..1132027,1170390..1170527,1182873..1182981,
FT                   1202507..1202596,1204123..1204280)
FT                   /codon_start=1
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT175740.0
FT                   protein_id=mCP98662.0 isoform=CRA_a"
FT                   /protein_id="EDL32197.1"
FT                   /translation="MFRLNTLSALAELAVGSRWYHGASQPTQTKRRLMLVAFLGASAVT
FT                   ASTGLLWKKAHAESPPCVNSKKPDTEDKERNKDSGEVSSREGRAADAAAEPYPEDKKKK
FT                   RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEK
FT                   QPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTTVLSTPQ
FT                   RNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALT
FT                   TYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQ
FT                   SKKLTAMQRQLKKHFKDGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQ
FT                   QVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRL
FT                   MQAMWKCAQETAWDFALPK"
FT   gene            complement(1212126..1212637)
FT                   /pseudo
FT                   /locus_tag="mCG_49680"
FT                   /note="gene_id=mCG49680.2"
FT   mRNA            complement(1212126..1212637)
FT                   /pseudo
FT                   /locus_tag="mCG_49680"
FT                   /note="gene_id=mCG49680.2 transcript_id=mCT49863.2 created
FT                   on 14-NOV-2002"
FT   gene            <1220503..1240137
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /note="gene_id=mCG11302.3"
FT   mRNA            join(<1220503..1220749,1230967..1231147,1233512..1233697,
FT                   1233778..1233857,1235072..1235181,1236429..1236601,
FT                   1237191..1237336,1238332..1238855)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT192990"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT192990.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1220506..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237342,1238332..1240137)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT173954"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173954.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1220506..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237336,1238332..1240137)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT173952"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173952.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1220506..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237288,1238332..1240137)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT173953"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173953.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1220506..1220749,1230967..1231147,1233512..1233697,
FT                   1233778..1233857,1235072..1235181,1236429..1236601,
FT                   1237191..1237342,1238332..1240137)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT173951"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173951.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1220506..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237616)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT11589"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT11589.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(1220617..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237288,1238332..1238361)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173953.0
FT                   protein_id=mCP96871.0 isoform=CRA_d"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1931881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C4C9"
FT                   /protein_id="EDL32196.1"
FT                   /translation="MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA
FT                   LIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVK
FT                   RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLS
FT                   NPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS
FT                   NGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
FT                   GHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGL
FT                   LYRARYFGDTDMYHRAQKMGTPSCNRLSETMKSLENFW"
FT   CDS             join(1220617..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173952.0
FT                   protein_id=mCP96873.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QYI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1931881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYI4"
FT                   /protein_id="EDL32192.1"
FT                   /translation="MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA
FT                   LIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVK
FT                   RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLS
FT                   NPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS
FT                   NGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
FT                   GHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGL
FT                   LYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASLHG"
FT   CDS             join(1220617..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173954.0
FT                   protein_id=mCP96872.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QYI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1931881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYI4"
FT                   /protein_id="EDL32193.1"
FT                   /translation="MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA
FT                   LIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVK
FT                   RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLS
FT                   NPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS
FT                   NGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
FT                   GHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGL
FT                   LYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASLHG"
FT   CDS             join(1220617..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT11589.2
FT                   protein_id=mCP1501.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QYI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1931881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYI4"
FT                   /protein_id="EDL32195.1"
FT                   /translation="MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA
FT                   LIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVK
FT                   RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLS
FT                   NPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS
FT                   NGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
FT                   GHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGL
FT                   LYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASLHG"
FT   CDS             join(<1231144..1231147,1233512..1233697,1233778..1233857,
FT                   1235072..1235181,1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT192990.0
FT                   protein_id=mCP113964.0 isoform=CRA_c"
FT                   /protein_id="EDL32194.1"
FT                   /translation="KAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEA
FT                   DISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILI
FT                   LILVSALSQLMVSSPPYSLSPRPSVGHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVE
FT                   RNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASL
FT                   HG"
FT   CDS             join(1233670..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173951.0
FT                   protein_id=mCP96870.0 isoform=CRA_a"
FT                   /protein_id="EDL32191.1"
FT                   /translation="MFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQL
FT                   MPILILILVSALSQLMVSSPPYSLSPRPSVGHIHKRVTDHLNVAYYVADTFSEEYTGSS
FT                   LKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCNRLSE
FT                   VQASLHG"
FT   gene            complement(1290371..1292534)
FT                   /gene="Ddit4"
FT                   /locus_tag="mCG_11295"
FT                   /note="gene_id=mCG11295.2"
FT   mRNA            complement(join(1290371..1291731,1292019..1292274,
FT                   1292399..1292534))
FT                   /gene="Ddit4"
FT                   /locus_tag="mCG_11295"
FT                   /product="DNA-damage-inducible transcript 4"
FT                   /note="gene_id=mCG11295.2 transcript_id=mCT11582.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(1291238..1291731,1292019..1292214))
FT                   /codon_start=1
FT                   /gene="Ddit4"
FT                   /locus_tag="mCG_11295"
FT                   /product="DNA-damage-inducible transcript 4"
FT                   /note="gene_id=mCG11295.2 transcript_id=mCT11582.2
FT                   protein_id=mCP1508.1"
FT                   /db_xref="GOA:B7ZNP9"
FT                   /db_xref="InterPro:IPR012918"
FT                   /db_xref="MGI:MGI:1921997"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZNP9"
FT                   /protein_id="EDL32190.1"
FT                   /translation="MPSLWDRFSSSSSSSSSSRTPAADRPPRSAWGSAAREEGLDRCAS
FT                   LESSDCESLDSSNSGFGPEEDSSYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLSQA
FT                   RLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVAQLALD
FT                   PSLVPTFQLTLVLRLDSRLWPKIQGLLSSANSSLVPGYSQSLTLSTGFRVIKKKLYSSE
FT                   QLLIEEC"
FT   gene            complement(1328092..1343888)
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /note="gene_id=mCG11305.2"
FT   mRNA            complement(join(1328092..1329509,1331504..1331578,
FT                   1343732..1343888))
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   transcript variant mCT173955"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT173955.0 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1328092..1329509,1331504..1331578,
FT                   1337119..1337285,1343732..1343888))
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   transcript variant mCT11592"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT11592.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1328092..1329509,1331504..1331578,
FT                   1337119..1337285,1343194..1343243,1343732..1343888))
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   transcript variant mCT173956"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT173956.0 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1329394..1329509,1331504..1331578,
FT                   1337119..1337285,1343194..1343225))
FT                   /codon_start=1
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT173956.0
FT                   protein_id=mCP96875.0 isoform=CRA_b"
FT                   /db_xref="GOA:S4R2B6"
FT                   /db_xref="MGI:MGI:1289325"
FT                   /db_xref="UniProtKB/TrEMBL:S4R2B6"
FT                   /protein_id="EDL32188.1"
FT                   /translation="MSARSSLSYTNEERLLLEGMAASSSSSSAGGVSGSSVTGSGFSVS
FT                   DLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGL
FT                   VEELEADEWRFKPIEQLLGFTPSSG"
FT   CDS             complement(join(1329394..1329509,1331504..1331578,
FT                   1337119..1337260))
FT                   /codon_start=1
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT11592.1
FT                   protein_id=mCP1435.1 isoform=CRA_c"
FT                   /protein_id="EDL32189.1"
FT                   /translation="MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEM
FT                   LEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLG
FT                   FTPSSG"
FT   CDS             complement(1329394..1329492)
FT                   /codon_start=1
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT173955.0
FT                   protein_id=mCP96874.0 isoform=CRA_a"
FT                   /db_xref="GOA:S4R1V1"
FT                   /db_xref="MGI:MGI:1289325"
FT                   /db_xref="UniProtKB/TrEMBL:S4R1V1"
FT                   /protein_id="EDL32187.1"
FT                   /translation="MEKLAGLVEELEADEWRFKPIEQLLGFTPSSG"
FT   gene            1343580..1441151
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /note="gene_id=mCG11294.2"
FT   mRNA            join(1343580..1343683,1345571..1345703,1348531..1348630,
FT                   1353232..1353329,1354366..1354544,1382930..1383066,
FT                   1390563..1390682,1403372..1403496,1405235..1405320,
FT                   1439254..1439375,1440867..1441151)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT11581"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT11581.2 created
FT                   on 14-NOV-2002"
FT   mRNA            join(1343580..1343683,1345571..1345703,1348531..1348630,
FT                   1354366..1354544,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439375,
FT                   1440867..1441151)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT175721"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175721.0 created
FT                   on 14-NOV-2002"
FT   mRNA            join(1343580..1343683,1345571..1345703,1348531..1348630,
FT                   1353232..1353329,1354366..1354544,1372282..1372468)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT175722"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175722.0 created
FT                   on 14-NOV-2002"
FT   mRNA            join(1344106..1344192,1345571..1345703,1348531..1348630,
FT                   1353232..1353329,1354366..1354544,1382930..1383066,
FT                   1390563..1390682,1403372..1403496,1405235..1405320,
FT                   1439254..1439375,1440867..1441151)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT175720"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175720.0 created
FT                   on 14-NOV-2002"
FT   CDS             join(1345595..1345703,1348531..1348630,1353232..1353329,
FT                   1354366..1354544,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439370)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT11581.2
FT                   protein_id=mCP1505.2 isoform=CRA_a"
FT                   /protein_id="EDL32182.1"
FT                   /translation="MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEP
FT                   CGAYEVAQTPHGFRATVSAPSLLYKHIVGKRGDTKKKIEVETKTSINIPKHGHEGEIVI
FT                   TGQHRNGVVSARTRIDVLLDTFRRRQPFTHFLSFFLNEVEVQERFLMFQEEVLRKCSKD
FT                   RGVDSTIFQNPKKLHLTIGMLVLLSEQEIQQTCEILQRCKEEFINDISGGRPLEVEMAG
FT                   IEYMNDDPAMVDVLYAKVHMKDGSNRLQELVDRVLERFQSLGLIVKEWTSVKLHATVMN
FT                   TLLRKDPNAEGRYNLYTADGKYIFKERESFDGRNILKTFENFYFGSLRLNSIHISQRFT
FT                   VDSFGNYASCGHVDFS"
FT   CDS             join(1345595..1345703,1348531..1348630,1353232..1353329,
FT                   1354366..1354544,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439370)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175720.0
FT                   protein_id=mCP98642.0 isoform=CRA_a"
FT                   /protein_id="EDL32185.1"
FT                   /translation="MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEP
FT                   CGAYEVAQTPHGFRATVSAPSLLYKHIVGKRGDTKKKIEVETKTSINIPKHGHEGEIVI
FT                   TGQHRNGVVSARTRIDVLLDTFRRRQPFTHFLSFFLNEVEVQERFLMFQEEVLRKCSKD
FT                   RGVDSTIFQNPKKLHLTIGMLVLLSEQEIQQTCEILQRCKEEFINDISGGRPLEVEMAG
FT                   IEYMNDDPAMVDVLYAKVHMKDGSNRLQELVDRVLERFQSLGLIVKEWTSVKLHATVMN
FT                   TLLRKDPNAEGRYNLYTADGKYIFKERESFDGRNILKTFENFYFGSLRLNSIHISQRFT
FT                   VDSFGNYASCGHVDFS"
FT   CDS             join(1345595..1345703,1348531..1348630,1353232..1353329,
FT                   1354366..1354544,1372282..1372287)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175722.0
FT                   protein_id=mCP98643.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UMX8"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009210"
FT                   /db_xref="MGI:MGI:1916340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UMX8"
FT                   /protein_id="EDL32184.1"
FT                   /translation="MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEP
FT                   CGAYEVAQTPHGFRATVSAPSLLYKHIVGKRGDTKKKIEVETKTSINIPKHGHEGEIVI
FT                   TGQHRNGVVSARTRIDVLLDTFRRRQPFTHFLSFFLNEVEVQERFLMFQEEVLRKCSKF
FT                   "
FT   CDS             join(1345595..1345703,1348531..1348630,1354366..1354483)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175721.0
FT                   protein_id=mCP98645.0 isoform=CRA_b"
FT                   /protein_id="EDL32183.1"
FT                   /translation="MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEP
FT                   CGAYEVAQTPHGFRATVSAPSLLYNDHWSASKWRGLSANTDRRAPGHVQEEAAFYPLPF
FT                   LLPQ"
FT   mRNA            join(<1372331..1372411,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439375,
FT                   1440867..1441151)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT175723"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175723.0 created
FT                   on 14-NOV-2002"
FT   CDS             join(<1372331..1372411,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439370)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175723.0
FT                   protein_id=mCP98644.0 isoform=CRA_d"
FT                   /protein_id="EDL32186.1"
FT                   /translation="PIETSCWMTDDFSLCPHGHRNSCCVLLDRGVDSTIFQNPKKLHLT
FT                   IGMLVLLSEQEIQQTCEILQRCKEEFINDISGGRPLEVEMAGIEYMNDDPAMVDVLYAK
FT                   VHMKDGSNRLQELVDRVLERFQSLGLIVKEWTSVKLHATVMNTLLRKDPNAEGRYNLYT
FT                   ADGKYIFKERESFDGRNILKTFENFYFGSLRLNSIHISQRFTVDSFGNYASCGHVDFS"
FT   gene            1447332..1476396
FT                   /gene="Spock2"
FT                   /locus_tag="mCG_11290"
FT                   /note="gene_id=mCG11290.2"
FT   mRNA            join(1447332..1447817,1462491..1462499,1462737..1462782,
FT                   1462943..1463057,1465069..1465183,1466909..1467023,
FT                   1467352..1467468,1468032..1468250,1470879..1470941,
FT                   1472282..1472419,1472534..1476396)
FT                   /gene="Spock2"
FT                   /locus_tag="mCG_11290"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 2"
FT                   /note="gene_id=mCG11290.2 transcript_id=mCT11577.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(1447629..1447817,1462491..1462499,1462737..1462782,
FT                   1462943..1463057,1465069..1465183,1466909..1467023,
FT                   1467352..1467468,1468032..1468250,1470879..1470941,
FT                   1472282..1472419,1472534..1472679)
FT                   /codon_start=1
FT                   /gene="Spock2"
FT                   /locus_tag="mCG_11290"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 2"
FT                   /note="gene_id=mCG11290.2 transcript_id=mCT11577.2
FT                   protein_id=mCP1458.2"
FT                   /protein_id="EDL32181.1"
FT                   /translation="MRAPGSGRLALPLLLLAVVALAEGDAKGLKEGETPGNFMEDEQWL
FT                   SSISQYSGKIKHWNRFRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCVAQ
FT                   GYQRAMCISRKKLEHRIKQPSLKLHGGKDSVCKPCHMAQLASVCGSDGHTYSSVCKLEQ
FT                   QACLSSKQLAVRCEGPCPCPTEQYTASTTDSKSETCTGQDLADLGDRLRDWFQLLRENS
FT                   KQNGSANSATNPAGLDKSLGASCKDSIGWMFSKLDTSGDLFLDQTELAAINLDKYEVCI
FT                   RPFFNSCDTYKDGRVSTAEWCFCFWREKPPCLAELERTQIQEAAKKKPGVFIPSCDEDG
FT                   YYRKMQCDQSRGDCWCVDQLGLELTGTRMHGTPDCDDIVGFSGDFGSGVGWEDEEEKET
FT                   EEAGEEAEEEEGEAGEADDGGYIW"
FT   gene            complement(1524870..1534063)
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /note="gene_id=mCG11291.2"
FT   mRNA            complement(join(1524870..1526656,1527846..1528091,
FT                   1533917..1534063))
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /product="carbohydrate (chondroitin 6/keratan)
FT                   sulfotransferase 3, transcript variant mCT11578"
FT                   /note="gene_id=mCG11291.2 transcript_id=mCT11578.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1524870..1526656,1527846..1528479))
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /product="carbohydrate (chondroitin 6/keratan)
FT                   sulfotransferase 3, transcript variant mCT173949"
FT                   /note="gene_id=mCG11291.2 transcript_id=mCT173949.0 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1525378..1526656,1527846..1528003))
FT                   /codon_start=1
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /product="carbohydrate (chondroitin 6/keratan)
FT                   sulfotransferase 3, isoform CRA_a"
FT                   /note="gene_id=mCG11291.2 transcript_id=mCT173949.0
FT                   protein_id=mCP96868.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8X5"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR016469"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858224"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8X5"
FT                   /protein_id="EDL32179.1"
FT                   /translation="MAPPLPMEKGLALPQDFRDLVHSLKIRGRYVLFLAFVVIVFIFIE
FT                   KENKIISRVSDKLKQIPHFVADANSTDPALLLSENASLLSLSELDSTFSHLRSRLHNLS
FT                   LQLGVEPAMESQEAGAEKPSQQAGAGTRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFE
FT                   PLWHIERTVFFQQRGASAAGSALVYRDVLKQLLLCDLYVLEPFISPPPEDHLTQFLFRR
FT                   GSSRSLCEDPVCTPFVKKVFEKYHCRNRRCGPLNVTLAGEACRRKDHVALKAVRIRQLE
FT                   FLQPLVEDPRLDLRVIQLVRDPRAVLASRIVAFAGKYENWKKWLSEGQDQLSEDEVQRL
FT                   RGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARRPLQKAREMYSFAGIPLTPQVEDW
FT                   IQKNTQATRDSSDVYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPTMHLFGYKLARDA
FT                   ASLTNRSISLLEERGTFWVT"
FT   CDS             complement(join(1525378..1526656,1527846..1528003))
FT                   /codon_start=1
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /product="carbohydrate (chondroitin 6/keratan)
FT                   sulfotransferase 3, isoform CRA_a"
FT                   /note="gene_id=mCG11291.2 transcript_id=mCT11578.1
FT                   protein_id=mCP1456.1 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8X5"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR016469"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858224"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8X5"
FT                   /protein_id="EDL32180.1"
FT                   /translation="MAPPLPMEKGLALPQDFRDLVHSLKIRGRYVLFLAFVVIVFIFIE
FT                   KENKIISRVSDKLKQIPHFVADANSTDPALLLSENASLLSLSELDSTFSHLRSRLHNLS
FT                   LQLGVEPAMESQEAGAEKPSQQAGAGTRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFE
FT                   PLWHIERTVFFQQRGASAAGSALVYRDVLKQLLLCDLYVLEPFISPPPEDHLTQFLFRR
FT                   GSSRSLCEDPVCTPFVKKVFEKYHCRNRRCGPLNVTLAGEACRRKDHVALKAVRIRQLE
FT                   FLQPLVEDPRLDLRVIQLVRDPRAVLASRIVAFAGKYENWKKWLSEGQDQLSEDEVQRL
FT                   RGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARRPLQKAREMYSFAGIPLTPQVEDW
FT                   IQKNTQATRDSSDVYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPTMHLFGYKLARDA
FT                   ASLTNRSISLLEERGTFWVT"
FT   gene            1617999..1642945
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /note="gene_id=mCG61290.2"
FT   mRNA            join(1617999..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1637880..1637888,1639441..1639572,
FT                   1639807..1639902,1640122..1640401,1640491..1640648,
FT                   1640881..1640961,1641117..1641224,1642037..1642945)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT61473"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT61473.2 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1617999..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642945)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT173975"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173975.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1617999..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1635308..1635451,1636289..1636345,
FT                   1637880..1637888,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642945)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT173977"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173977.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(<1618062..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636349,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642334)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT192951"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT192951.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(1618087..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1637880..1637888,1639441..1639572,
FT                   1639807..1639902,1640122..1640401,1640491..1640648,
FT                   1640881..1640961,1641117..1641224,1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_e"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT61473.2
FT                   protein_id=mCP24329.2 isoform=CRA_e"
FT                   /db_xref="GOA:Q3UFE8"
FT                   /db_xref="InterPro:IPR003119"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR008373"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR021165"
FT                   /db_xref="MGI:MGI:97783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UFE8"
FT                   /protein_id="EDL32178.1"
FT                   /translation="MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAV
FT                   KHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSA
FT                   SCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDM
FT                   ARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKTNSSFIQGFV
FT                   DHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQDQQPKEICVLAGFCNEVKRVPM
FT                   KTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELL
FT                   VKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEA
FT                   LEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEK
FT                   NSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPS
FT                   AYKLLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN"
FT   CDS             join(1618087..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_a"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173975.0
FT                   protein_id=mCP96895.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BFQ1"
FT                   /db_xref="InterPro:IPR003119"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR008373"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR021165"
FT                   /db_xref="MGI:MGI:97783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BFQ1"
FT                   /protein_id="EDL32174.1"
FT                   /translation="MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAV
FT                   KHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSA
FT                   SCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDM
FT                   ARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKTNSSFIQGFV
FT                   DHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQPKEICVLAGFCNEVKRVPMKTL
FT                   VPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKG
FT                   LSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQ
FT                   PAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNST
FT                   KEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYK
FT                   LLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN"
FT   CDS             join(1618087..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1635308..1635451,1636289..1636345,
FT                   1637880..1637888,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_b"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173977.0
FT                   protein_id=mCP96894.0 isoform=CRA_b"
FT                   /protein_id="EDL32175.1"
FT                   /translation="MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAV
FT                   KHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSA
FT                   SCKEVVDSYLPVILDMIKGEMANEDVCQDCMKLVSDVQTAVKTNSSFIQGFVDHVKEDC
FT                   DRLGPGVSDICKNYVDQYSEVCVQMLMHMQDQQPKEICVLAGFCNEVKRVPMKTLVPAT
FT                   ETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNA
FT                   CALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPA
FT                   IVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEI
FT                   LAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLG
FT                   TEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN"
FT   mRNA            join(1626255..1626305,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1637880..1637888,1639441..1639572,
FT                   1639807..1639902,1640122..1640401,1640491..1640648,
FT                   1640881..1640961,1641117..1641224,1642037..1642945)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT173976"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173976.0 created
FT                   on 02-OCT-2002"
FT   CDS             join(1632092..1632115,1632848..1632922,1633692..1633817,
FT                   1634876..1635073,1635308..1635451,1636289..1636345,
FT                   1637880..1637888,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_d"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173976.0
FT                   protein_id=mCP96896.0 isoform=CRA_d"
FT                   /protein_id="EDL32177.1"
FT                   /translation="MVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCE
FT                   WIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLE
FT                   SNKIPEVDMARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKT
FT                   NSSFIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQDQQPKEICVLAGF
FT                   CNEVKRVPMKTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELI
FT                   VNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLC
FT                   AARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLV
FT                   LYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFV
FT                   CSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN"
FT   CDS             join(<1639441..1639572,1639807..1639902,1640122..1640401,
FT                   1640491..1640648,1640881..1640961,1641117..1641224,
FT                   1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_c"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT192951.0
FT                   protein_id=mCP113932.0 isoform=CRA_c"
FT                   /protein_id="EDL32176.1"
FT                   /translation="QPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYEQ
FT                   NLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGT
FT                   FGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQP
FT                   KQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQ
FT                   CDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETA
FT                   ARCNAVDHCKRHVWN"
FT   gene            complement(1643091..2040116)
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /note="gene_id=mCG1819.2"
FT   mRNA            complement(join(1643091..1644054,1645179..1645301,
FT                   1645412..1645541,1645932..1645992,1646085..1646125,
FT                   1646294..1646373,1646463..1646583,1647817..1647914,
FT                   1648199..1648455,1651030..1651191,1651269..1651520,
FT                   1651613..1651742,1652623..1652736,1652876..1653067,
FT                   1654546..1654757,1654889..1655066,1655976..1656095,
FT                   1656956..1657093,1657372..1657541,1658109..1658333,
FT                   1659920..1660036,1663642..1664100,1665286..1665489,
FT                   1666376..1666501,1667724..1667826,1670159..1670266,
FT                   1671507..1671716,1672061..1672194,1676387..1676567,
FT                   1677571..1677690,1677994..1678215,1717385..1717612,
FT                   1718290..1718418,1719343..1719471,1719793..1719942,
FT                   1723092..1723094,1723250..1723351,1725998..1726386,
FT                   1728066..1728201,1732812..1732960,1734062..1734122,
FT                   1747374..1747522,1748464..1748577,1750104..1750256,
FT                   1751794..1752013,1754152..1754297,1754631..1754820,
FT                   1761209..1761316,1762550..1762662,1768108..1768224,
FT                   1769809..1769881,1775254..1775381,1776007..1776112,
FT                   1778143..1778380,1780296..1780360,1807209..1807367,
FT                   1807767..1807916,1809799..1809804,1829772..1829960,
FT                   1831317..1831429,1866239..1866317,1873700..1873828,
FT                   1877144..1877338,1939616..1939708,1939836..1939883,
FT                   1940517..1940659,1993648..1993725,2000825..2000896,
FT                   2030518..2030728,2039925..2040116))
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), transcript variant
FT                   mCT174089"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT174089.0 created
FT                   on 10-OCT-2002"
FT   mRNA            complement(join(1643091..1644054,1644778..1644882,
FT                   1645179..1645301,1645412..1645541,1645932..1645992,
FT                   1646085..1646125,1646294..1646373,1646463..1646583,
FT                   1647817..1647914,1648199..1648455,1651030..1651191,
FT                   1651269..1651520,1651613..1651742,1652623..1652736,
FT                   1652876..1653067,1654546..1654757,1654889..1655066,
FT                   1655976..1656095,1656956..1657093,1657372..1657541,
FT                   1658109..1658333,1659920..1660036,1663642..1664100,
FT                   1665286..1665489,1666376..1666501,1667724..1667826,
FT                   1670159..1670266,1671507..1671716,1672061..1672194,
FT                   1676387..1676567,1677571..1677690,1677994..1678215,
FT                   1717385..1717612,1718290..1718418,1719343..1719471,
FT                   1719793..1719942,1723092..1723094,1723250..1723351,
FT                   1725998..1726386,1728066..1728201,1732812..1732960,
FT                   1734062..1734122,1747374..1747522,1748464..1748577,
FT                   1750104..1750256,1751794..1752013,1754152..1754297,
FT                   1754631..1754820,1761209..1761316,1762550..1762662,
FT                   1768108..1768224,1769809..1769881,1775254..1775381,
FT                   1776007..1776112,1778143..1778380,1780296..1780360,
FT                   1807209..1807367,1807767..1807916,1809799..1809804,
FT                   1829772..1829960,1831317..1831429,1866239..1866317,
FT                   1873700..1873828,1877144..1877338,1939616..1939708,
FT                   1939836..1939883,1940517..1940659,1993648..1993725,
FT                   2000825..2000896,2030518..2030728,2039925..2040116))
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), transcript variant
FT                   mCT8177"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT8177.2 created on
FT                   10-OCT-2002"
FT   mRNA            complement(join(<1643728..1644054,1644778..1644882,
FT                   1645179..1645301,1645412..1645541,1645932..1645992,
FT                   1646085..1646125,1646294..1646373,1646463..1646583,
FT                   1647817..1647914,1648199..1648455,1651030..1651191,
FT                   1651269..1651520,1651613..1651742,1652623..1652736,
FT                   1652876..1653067,1654546..1654757,1654889..1655066,
FT                   1655976..1656095,1656956..1657093,1657372..1657541,
FT                   1658109..1658333,1659920..1660036,1663642..1664100,
FT                   1665286..1665489,1666376..1666501,1667724..1667826,
FT                   1670159..1670266,1671507..1671716,1672061..1672194,
FT                   1676387..1676567,1677571..1677690,1677994..1678215,
FT                   1717385..1717612,1718290..1718418,1719343..1719471,
FT                   1719793..1719942,1723246..1723351,1725998..1726386,
FT                   1728066..1728201,1732812..1732960,1734062..1734122,
FT                   1747374..1747522,1748464..1748577,1750104..1750256,
FT                   1751794..1752013,1754152..1754297,1754631..1754820,
FT                   1761209..1761316,1762550..1762662,1768108..1768224,
FT                   1769809..1769881,1775254..1775381,1776007..1776112,
FT                   1778143..1778380,1780296..1780360,1807209..1807367,
FT                   1807767..1807916,1829768..1829960,1831317..1831429,
FT                   1866239..1866317,1873700..1873828,1877144..1877338,
FT                   1939616..1939708,1939836..1939883,1940517..1940659,
FT                   1993648..1993725,2000825..>2000891))
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), transcript variant
FT                   mCT192963"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT192963.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1643728..1644054,1645179..1645301,
FT                   1645412..1645541,1645932..1645992,1646085..1646125,
FT                   1646294..1646373,1646463..1646583,1647817..1647914,
FT                   1648199..1648455,1651030..1651191,1651269..1651520,
FT                   1651613..1651742,1652623..1652736,1652876..1653067,
FT                   1654546..1654757,1654889..1655066,1655976..1656095,
FT                   1656956..1657093,1657372..1657541,1658109..1658333,
FT                   1659920..1660036,1663642..1664100,1665286..1665489,
FT                   1666376..1666501,1667724..1667826,1670159..1670266,
FT                   1671507..1671716,1672061..1672194,1676387..1676567,
FT                   1677571..1677690,1677994..1678215,1717385..1717612,
FT                   1718290..1718418,1719343..1719471,1719793..1719942,
FT                   1723092..1723094,1723250..1723351,1725998..1726386,
FT                   1728066..1728201,1732812..1732960,1734062..1734122,
FT                   1747374..1747522,1748464..1748577,1750104..1750256,
FT                   1751794..1752013,1754152..1754297,1754631..1754820,
FT                   1761209..1761316,1762550..1762662,1768108..1768224,
FT                   1769809..1769881,1775254..1775381,1776007..1776112,
FT                   1778143..1778380,1780296..1780360,1807209..1807367,
FT                   1807767..1807916,1809799..1809804,1829772..1829960,
FT                   1831317..1831429,1866239..1866317,1873700..1873828,
FT                   1877144..1877338,1939616..1939708,1939836..1939883,
FT                   1940517..1940659,1993648..1993725,2000825..2000891))
FT                   /codon_start=1
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), isoform CRA_a"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT174089.0
FT                   protein_id=mCP97008.0 isoform=CRA_a"
FT                   /protein_id="EDL32167.1"
FT                   /translation="MRYSLVTCYAVLWLLMLVPGSWGQVNRLPFFTNHFFDTYLLISED
FT                   TPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVE
FT                   FSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGA
FT                   GGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANL
FT                   AIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTN
FT                   SIFALDYISGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVID
FT                   INDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFI
FT                   ISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRP
FT                   IFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIML
FT                   IARLDYELIQRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPS
FT                   VTQLVRLRATDEDSPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNG
FT                   LIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLN
FT                   ATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGV
FT                   GHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGT
FT                   LVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKAT
FT                   SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQ
FT                   VGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVN
FT                   DETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYR
FT                   DAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSY
FT                   EASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPL
FT                   DRERNSSHVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG
FT                   TSVIVVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVS
FT                   ATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNL
FT                   NQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGGPKVDSTV
FT                   KVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDAGSNGQVVFSLASG
FT                   NIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHILQVTILDV
FT                   NDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMD
FT                   RISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPH
FT                   YEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFRINKHTGVITAAKE
FT                   LDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTE
FT                   GQPGPRVWTFLAHDRDSGPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETIA
FT                   FYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVL
FT                   ASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPE
FT                   NPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADE
FT                   DVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNG
FT                   TAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEA
FT                   GAQDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDIND
FT                   SRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQE
FT                   DAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVN
FT                   DNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQL
FT                   EDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQP
FT                   SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLD
FT                   REKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEP
FT                   AGTSVITMLATDQDEGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNLTVV
FT                   ATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDND
FT                   EGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPV
FT                   PYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEG
FT                   PNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPS
FT                   PALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGN
FT                   NSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARD
FT                   LAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFH
FT                   VDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAI
FT                   SVQLPDDMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFID
FT                   IMDMPNTNKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGT
FT                   FGREPAAVKPDDDRYLRAAIQEYDNIAKLGQIIREGPIKLIHTDLEEEPGDHSPGQGSL
FT                   RFRHKPPMELKGQDGIHMVHGSTGTLLATDLNSLPEDDQKGLDRSLETLTASEATAFER
FT                   NARTESAKSTPLHKLRDVIMESPLEITEL"
FT   CDS             complement(join(1643728..1644054,1644778..1644882,
FT                   1645179..1645301,1645412..1645541,1645932..1645992,
FT                   1646085..1646125,1646294..1646373,1646463..1646583,
FT                   1647817..1647914,1648199..1648455,1651030..1651191,
FT                   1651269..1651520,1651613..1651742,1652623..1652736,
FT                   1652876..1653067,1654546..1654757,1654889..1655066,
FT                   1655976..1656095,1656956..1657093,1657372..1657541,
FT                   1658109..1658333,1659920..1660036,1663642..1664100,
FT                   1665286..1665489,1666376..1666501,1667724..1667826,
FT                   1670159..1670266,1671507..1671716,1672061..1672194,
FT                   1676387..1676567,1677571..1677690,1677994..1678215,
FT                   1717385..1717612,1718290..1718418,1719343..1719471,
FT                   1719793..1719942,1723092..1723094,1723250..1723351,
FT                   1725998..1726386,1728066..1728201,1732812..1732960,
FT                   1734062..1734122,1747374..1747522,1748464..1748577,
FT                   1750104..1750256,1751794..1752013,1754152..1754297,
FT                   1754631..1754820,1761209..1761316,1762550..1762662,
FT                   1768108..1768224,1769809..1769881,1775254..1775381,
FT                   1776007..1776112,1778143..1778380,1780296..1780360,
FT                   1807209..1807367,1807767..1807916,1809799..1809804,
FT                   1829772..1829960,1831317..1831429,1866239..1866317,
FT                   1873700..1873828,1877144..1877338,1939616..1939708,
FT                   1939836..1939883,1940517..1940659,1993648..1993725,
FT                   2000825..2000891))
FT                   /codon_start=1
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), isoform CRA_c"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT8177.2
FT                   protein_id=mCP1495.2 isoform=CRA_c"
FT                   /protein_id="EDL32169.1"
FT                   /translation="MRYSLVTCYAVLWLLMLVPGSWGQVNRLPFFTNHFFDTYLLISED
FT                   TPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVE
FT                   FSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGA
FT                   GGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANL
FT                   AIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTN
FT                   SIFALDYISGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVID
FT                   INDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFI
FT                   ISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRP
FT                   IFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIML
FT                   IARLDYELIQRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPS
FT                   VTQLVRLRATDEDSPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNG
FT                   LIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLN
FT                   ATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGV
FT                   GHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGT
FT                   LVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKAT
FT                   SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQ
FT                   VGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVN
FT                   DETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYR
FT                   DAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSY
FT                   EASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPL
FT                   DRERNSSHVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG
FT                   TSVIVVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVS
FT                   ATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNL
FT                   NQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGGPKVDSTV
FT                   KVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDAGSNGQVVFSLASG
FT                   NIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHILQVTILDV
FT                   NDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMD
FT                   RISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPH
FT                   YEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFRINKHTGVITAAKE
FT                   LDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTE
FT                   GQPGPRVWTFLAHDRDSGPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETIA
FT                   FYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVL
FT                   ASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPE
FT                   NPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADE
FT                   DVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNG
FT                   TAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEA
FT                   GAQDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDIND
FT                   SRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQE
FT                   DAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVN
FT                   DNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQL
FT                   EDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQP
FT                   SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLD
FT                   REKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEP
FT                   AGTSVITMLATDQDEGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNLTVV
FT                   ATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDND
FT                   EGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPV
FT                   PYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEG
FT                   PNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPS
FT                   PALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGN
FT                   NSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARD
FT                   LAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFH
FT                   VDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAI
FT                   SVQLPDDMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFID
FT                   IMDMPNTNKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGT
FT                   FGREPAAVKPDDDRYLRAAIQEYDNIAKLGQIIREGPIKGSLLKVVLEDYLRLKKLFAQ
FT                   RMVQKASSCHSSISELIHTDLEEEPGDHSPGQGSLRFRHKPPMELKGQDGIHMVHGSTG
FT                   TLLATDLNSLPEDDQKGLDRSLETLTASEATAFERNARTESAKSTPLHKLRDVIMESPL
FT                   EITEL"
FT   CDS             complement(join(1643728..1644054,1644778..1644882,
FT                   1645179..1645301,1645412..1645541,1645932..1645992,
FT                   1646085..1646125,1646294..1646373,1646463..1646583,
FT                   1647817..1647914,1648199..1648455,1651030..1651191,
FT                   1651269..1651520,1651613..1651742,1652623..1652736,
FT                   1652876..1653067,1654546..1654757,1654889..1655066,
FT                   1655976..1656095,1656956..1657093,1657372..1657541,
FT                   1658109..1658333,1659920..1660036,1663642..1664100,
FT                   1665286..1665489,1666376..1666501,1667724..1667826,
FT                   1670159..1670266,1671507..1671716,1672061..1672194,
FT                   1676387..1676567,1677571..1677690,1677994..1678215,
FT                   1717385..1717612,1718290..1718418,1719343..1719471,
FT                   1719793..>1719942))
FT                   /codon_start=1
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), isoform CRA_b"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT192963.0
FT                   protein_id=mCP113914.0 isoform=CRA_b"
FT                   /protein_id="EDL32168.1"
FT                   /translation="VYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDA
FT                   GSNGQVVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPR
FT                   KKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYY
FT                   ITEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIV
FT                   DENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFR
FT                   INKHTGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPT
FT                   FPRDYEGPFDVTEGQPGPRVWTFLAHDRDSGPNGQVEYSVVDGDPLGEFVISPVEGVLR
FT                   VRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTIS
FT                   ENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP
FT                   EYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLT
FT                   VLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLE
FT                   LLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDED
FT                   SGLNGELVYRIEAGAQDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSG
FT                   TAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIV
FT                   AKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSV
FT                   PNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITY
FT                   TLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEI
FT                   VDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAIN
FT                   PNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFS
FT                   KPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQR
FT                   PLQSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPL
FT                   RSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVY
FT                   SLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTL
FT                   VGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKA
FT                   SSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSE
FT                   LIQVLALDADIGNNSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAY
FT                   SPGYFVVDIVARDLAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNI
FT                   TGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNL
FT                   FRNYNVLDVQPAISVQLPDDMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKA
FT                   IVAGSAGNRGFIDIMDMPNTNKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEI
FT                   ADLWNSPTRTHGTFGREPAAVKPDDDRYLRAAIQEYDNIAKLGQIIREGPIKGSLLKVV
FT                   LEDYLRLKKLFAQRMVQKASSCHSSISELIHTDLEEEPGDHSPGQGSLRFRHKPPMELK
FT                   GQDGIHMVHGSTGTLLATDLNSLPEDDQKGLDRSLETLTASEATAFERNARTESAKSTP
FT                   LHKLRDVIMESPLEITEL"
FT   gene            1687254..1713280
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /note="gene_id=mCG1822.2"
FT   mRNA            join(1687254..1687454,1698193..1698618,1699558..1699608,
FT                   1704798..1704905,1708362..1708389,1709125..1709321,
FT                   1709498..1713280)
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /product="RIKEN cDNA 4632428N05, transcript variant
FT                   mCT8182"
FT                   /note="gene_id=mCG1822.2 transcript_id=mCT8182.2 created on
FT                   01-OCT-2002"
FT   mRNA            join(1687254..1687454,1698193..1698486,1704798..1704905,
FT                   1708362..1708389,1709125..1709321,1709498..1713280)
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /product="RIKEN cDNA 4632428N05, transcript variant
FT                   mCT173969"
FT                   /note="gene_id=mCG1822.2 transcript_id=mCT173969.0 created
FT                   on 01-OCT-2002"
FT   CDS             join(1687373..1687454,1698193..1698618,1699558..1699608,
FT                   1704798..1704905,1708362..1708389,1709125..1709321,
FT                   1709498..1709535)
FT                   /codon_start=1
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /product="RIKEN cDNA 4632428N05, isoform CRA_b"
FT                   /note="gene_id=mCG1822.2 transcript_id=mCT8182.2
FT                   protein_id=mCP1486.2 isoform=CRA_b"
FT                   /protein_id="EDL32173.1"
FT                   /translation="MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCP
FT                   EGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHL
FT                   KANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSM
FT                   ELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHR
FT                   RAQELVRMDSSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPS
FT                   TPLSPPGPGDVFFPSLDPVPDSPNSEAI"
FT   CDS             join(1687373..1687454,1698193..1698486,1704798..1704905,
FT                   1708362..1708389,1709125..1709321,1709498..1709535)
FT                   /codon_start=1
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /product="RIKEN cDNA 4632428N05, isoform CRA_a"
FT                   /note="gene_id=mCG1822.2 transcript_id=mCT173969.0
FT                   protein_id=mCP96888.0 isoform=CRA_a"
FT                   /protein_id="EDL32172.1"
FT                   /translation="MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCP
FT                   EGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHL
FT                   KANASHDQPQKHGLELASDHHGITAAALATGACIVGILCLPLILLLVYKQRQVASHRRA
FT                   QELVRMDSSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTP
FT                   LSPPGPGDVFFPSLDPVPDSPNSEAI"
FT   gene            1740816..1744631
FT                   /locus_tag="mCG_55969"
FT                   /note="gene_id=mCG55969.0"
FT   mRNA            join(1740816..1741109,1744042..1744631)
FT                   /locus_tag="mCG_55969"
FT                   /product="mCG55969"
FT                   /note="gene_id=mCG55969.0 transcript_id=mCT175756.0 created
FT                   on 19-JUN-2003"
FT   CDS             1744047..1744433
FT                   /codon_start=1
FT                   /locus_tag="mCG_55969"
FT                   /product="mCG55969"
FT                   /note="gene_id=mCG55969.0 transcript_id=mCT175756.0
FT                   protein_id=mCP98678.0"
FT                   /db_xref="MGI:MGI:4937089"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW87"
FT                   /protein_id="EDL32171.1"
FT                   /translation="MNTEGSSLLSPPTFLTTPAASGTSTQAADPVPILIALACIFLLLA
FT                   SCLLFMMLCKPTALDPGRRGARECMPHHPVSPSEPRLRLWKRLGSLRRSLHSFRRGRPA
FT                   IQRCPLPDSDDHRGDYDWTEATMM"
FT   mRNA            complement(join(1925980..1926195,1939616..1939708,
FT                   1939836..1939883,1940517..1940659,1993648..1993725,
FT                   2000825..2000896,2030518..2030728,2039925..2040116))
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), transcript variant
FT                   mCT174090"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT174090.0 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(1926001..1926195,1939616..1939708,
FT                   1939836..1939883,1940517..1940659,1993648..1993725,
FT                   2000825..2000891))
FT                   /codon_start=1
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), isoform CRA_d"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT174090.0
FT                   protein_id=mCP97009.0 isoform=CRA_d"
FT                   /protein_id="EDL32170.1"
FT                   /translation="MRYSLVTCYAVLWLLMLVPGSWGQVNRLPFFTNHFFDTYLLISED
FT                   TPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVE
FT                   FSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPEVFHTQGLAHPKRIVPTTAPK
FT                   MEMEAMRQQSLRRKTLNGVEVMFKVCRDYRHFQRAAGDPGGAGG"
FT   gene            complement(2055699..2097090)
FT                   /gene="Slc29a3"
FT                   /locus_tag="mCG_141222"
FT                   /note="gene_id=mCG141222.0"
FT   mRNA            complement(join(2055699..2060117,2064489..2064651,
FT                   2067392..2067618,2074240..2074322,2094692..2094990,
FT                   2097028..2097090))
FT                   /gene="Slc29a3"
FT                   /locus_tag="mCG_141222"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 3, transcript variant mCT173958"
FT                   /note="gene_id=mCG141222.0 transcript_id=mCT173958.0
FT                   created on 01-OCT-2002"
FT   mRNA            complement(join(2058856..2060117,2064489..2064651,
FT                   2067392..2067618,2074240..2074345,2094692..2094990,
FT                   2097028..>2097079))
FT                   /gene="Slc29a3"
FT                   /locus_tag="mCG_141222"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 3, transcript variant mCT192935"
FT                   /note="gene_id=mCG141222.0 transcript_id=mCT192935.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(2059463..2060117,2064489..2064651,
FT                   2067392..2067618,2074240..2074322,2094692..2094990,
FT                   2097028))
FT                   /codon_start=1
FT                   /gene="Slc29a3"
FT                   /locus_tag="mCG_141222"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 3, isoform CRA_b"
FT                   /note="gene_id=mCG141222.0 transcript_id=mCT173958.0
FT                   protein_id=mCP96877.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99P65"
FT                   /db_xref="InterPro:IPR002259"
FT                   /db_xref="MGI:MGI:1918529"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q99P65"
FT                   /protein_id="EDL32166.1"
FT                   /translation="MAFASEDNVYHSSNAVYRAPSNHQEADQEALLGKLLDYPAPGLQR
FT                   PEDRFNGAYIIFFCLGIGGLLPWNFFVTAKEYWAYKLRNCSSPASGEDPEDMDILNYFE
FT                   SYLAVASTVPSLLFLVANFLLVNRVQVHVRVLASLSVSLAIFVVMIVLVKVDTSSWTRG
FT                   FFSLTIACMAIISSSSTIFNSSVYGLTGSFPMRNAQALISGGAMGGTVSAVALLVDLAA
FT                   SSDVRDSTLAFFLMAAVFLGLCMGLYLLLSQLEYARYYMRPVAPVRVFSGEDNPSQDAP
FT                   SASSVAPASRVMHTPPLGPILKKTASLGFCAVSLYFVTAFIIPAISTNIQSMHKGTGSP
FT                   WTSKFFVPLTVFLLFNFADLCGRQVTAWIQVPGPRSKLLPGLVVSRFCLVPLFLLCNYQ
FT                   PRSHLTKVLFQSDIYPVLFTCLLGLSNGYLSTLVLIYGPKIVPRELAEATSVVMLFYMS
FT                   VGLMLGSACAALLEHFI"
FT   CDS             complement(join(2059463..2060117,2064489..2064651,
FT                   2067392..2067618,2074240..>2074322))
FT                   /codon_start=1
FT                   /gene="Slc29a3"
FT                   /locus_tag="mCG_141222"
FT                   /product="solute carrier family 29 (nucleoside
FT                   transporters), member 3, isoform CRA_a"
FT                   /note="gene_id=mCG141222.0 transcript_id=mCT192935.0
FT                   protein_id=mCP113910.0 isoform=CRA_a"
FT                   /protein_id="EDL32165.1"
FT                   /translation="NYFESYLAVASTVPSLLFLVANFLLVNRVQVHVRVLASLSVSLAI
FT                   FVVMIVLVKVDTSSWTRGFFSLTIACMAIISSSSTIFNSSVYGLTGSFPMRNAQALISG
FT                   GAMGGTVSAVALLVDLAASSDVRDSTLAFFLMAAVFLGLCMGLYLLLSQLEYARYYMRP
FT                   VAPVRVFSGEDNPSQDAPSASSVAPASRVMHTPPLGPILKKTASLGFCAVSLYFVTAFI
FT                   IPAISTNIQSMHKGTGSPWTSKFFVPLTVFLLFNFADLCGRQVTAWIQVPGPRSKLLPG
FT                   LVVSRFCLVPLFLLCNYQPRSHLTKVLFQSDIYPVLFTCLLGLSNGYLSTLVLIYGPKI
FT                   VPRELAEATSVVMLFYMSVGLMLGSACAALLEHFI"
FT   gene            complement(2106880..2176024)
FT                   /gene="Unc5b"
FT                   /locus_tag="mCG_1827"
FT                   /note="gene_id=mCG1827.2"
FT   mRNA            complement(join(2106880..2109669,2111276..2111457,
FT                   2112620..2112784,2113404..2113553,2116474..2116707,
FT                   2116785..2116953,2118040..2118127,2118649..2119038,
FT                   2119262..2119456,2121481..2121513,2121686..2121850,
FT                   2122464..2122631,2123080..2123260,2123964..2124067,
FT                   2124391..2124534,2127354..2127578,2175530..2176024))
FT                   /gene="Unc5b"
FT                   /locus_tag="mCG_1827"
FT                   /product="unc-5 homolog B (C. elegans), transcript variant
FT                   mCT8185"
FT                   /note="gene_id=mCG1827.2 transcript_id=mCT8185.2 created on
FT                   14-NOV-2002"
FT   mRNA            complement(join(2108919..2109669,2111276..2111457,
FT                   2112620..2112784,2113404..2113553,2116474..2116707,
FT                   2116785..2116953,2118040..2118127,2118649..2119038,
FT                   2119262..2119456,2121686..2121850,2122464..2122631,
FT                   2123080..2123260,2123964..2124067,2124391..2124534,
FT                   2127354..2127578,2175530..>2175832))
FT                   /gene="Unc5b"
FT                   /locus_tag="mCG_1827"
FT                   /product="unc-5 homolog B (C. elegans), transcript variant
FT                   mCT192930"
FT                   /note="gene_id=mCG1827.2 transcript_id=mCT192930.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2109504..2109669,2111276..2111457,
FT                   2112620..2112784,2113404..2113553,2116474..2116707,
FT                   2116785..2116953,2118040..2118127,2118649..2119038,
FT                   2119262..2119456,2121686..2121850,2122464..2122631,
FT                   2123080..2123260,2123964..2124067,2124391..2124534,
FT                   2127354..2127578,2175530..>2175830))
FT                   /codon_start=1
FT                   /gene="Unc5b"
FT                   /locus_tag="mCG_1827"
FT                   /product="unc-5 homolog B (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG1827.2 transcript_id=mCT192930.0
FT                   protein_id=mCP113917.0 isoform=CRA_a"
FT                   /protein_id="EDL32163.1"
FT                   /translation="APEPGSPAASDSRSAPSRRAASRRCAVASAPTEGTGWRCRAPART
FT                   ARRRRRRRRRGWGPGKNPEGEAPGPGDRSMRARSGVRSALLLALLLCWDPTPSLAGVDS
FT                   AGQVLPDSYPSAPAEQLPYFLLEPQDAYIVKNKPVELHCRAFPATQIYFKCNGEWVSQN
FT                   DHVTQESLDEATGLRVREVQIEVSRQQVEELFGLEDYWCQCVAWSSSGTTKSRRAYIRI
FT                   AYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTID
FT                   HNLIIRQARLSDTANYTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGW
FT                   QKRTRTCTNPAPLNGGAFCEGQAFQKTACTTVCPVDGAWTEWSKWSACSTECAHWRSRE
FT                   CMAPPPQNGGRDCSGTLLDSKNCTDGLCVLTLETSGDVALYAGLVVAVFVVVAVLMAVG
FT                   VIVYRRNCRDFDTDITDSSAALTGGFHPVNFKTARPNNPQLLHPSAPPDLTASAGIYRG
FT                   PVYALQDSADKIPMTNSPLLDPLPSLKIKVYNSSTIGSGSGLADGADLLGVLPPGTYPG
FT                   DFSRDTHFLHLRSASLGSQHLLGLPRDPSSSVSGTFGCLGGRLSLPGTGVSLLVPNGAI
FT                   PQGKFYDLYLHINKAESTLPLSEGSQTVLSPSVTCGPTGLLLCRPVVLTVPHCAEVIAG
FT                   DWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLEAKSCHILLDQLGTYVFMGESYSRS
FT                   AVKRLQLAIFAPALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLLFKD
FT                   SYHNLRLSLHDIPHAHWRSKLLAKYQEIPFYHVWNGSQRALHCTFTLERHSLASTEFTC
FT                   KVCVRQVEGEGQIFQLHTTLAETPAGSLDALCSAPGNAITTQLGPYAFKIPLSIRQKIC
FT                   SSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASA
FT                   LEEMGKSEMLVAMATDGDC"
FT   CDS             complement(join(2109504..2109669,2111276..2111457,
FT                   2112620..2112784,2113404..2113553,2116474..2116707,
FT                   2116785..2116953,2118040..2118127,2118649..2119038,
FT                   2119262..2119456,2121481..2121513,2121686..2121850,
FT                   2122464..2122631,2123080..2123260,2123964..2124067,
FT                   2124391..2124534,2127354..2127578,2175530..2175608))
FT                   /codon_start=1
FT                   /gene="Unc5b"
FT                   /locus_tag="mCG_1827"
FT                   /product="unc-5 homolog B (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG1827.2 transcript_id=mCT8185.2
FT                   protein_id=mCP1452.2 isoform=CRA_b"
FT                   /protein_id="EDL32164.1"
FT                   /translation="MRARSGVRSALLLALLLCWDPTPSLAGVDSAGQVLPDSYPSAPAE
FT                   QLPYFLLEPQDAYIVKNKPVELHCRAFPATQIYFKCNGEWVSQNDHVTQESLDEATGLR
FT                   VREVQIEVSRQQVEELFGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKE
FT                   VPLDHEVLLQCRPPEGVPVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTAN
FT                   YTCVAKNIVAKRRSTTATVIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNG
FT                   GAFCEGQAFQKTACTTVCPVDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSG
FT                   TLLDSKNCTDGLCVLNQRTLNDPKSHPLETSGDVALYAGLVVAVFVVVAVLMAVGVIVY
FT                   RRNCRDFDTDITDSSAALTGGFHPVNFKTARPNNPQLLHPSAPPDLTASAGIYRGPVYA
FT                   LQDSADKIPMTNSPLLDPLPSLKIKVYNSSTIGSGSGLADGADLLGVLPPGTYPGDFSR
FT                   DTHFLHLRSASLGSQHLLGLPRDPSSSVSGTFGCLGGRLSLPGTGVSLLVPNGAIPQGK
FT                   FYDLYLHINKAESTLPLSEGSQTVLSPSVTCGPTGLLLCRPVVLTVPHCAEVIAGDWIF
FT                   QLKTQAHQGHWEEVVTLDEETLNTPCYCQLEAKSCHILLDQLGTYVFMGESYSRSAVKR
FT                   LQLAIFAPALCTSLEYSLRVYCLEDTPVALKEVLELERTLGGYLVEEPKPLLFKDSYHN
FT                   LRLSLHDIPHAHWRSKLLAKYQEIPFYHVWNGSQRALHCTFTLERHSLASTEFTCKVCV
FT                   RQVEGEGQIFQLHTTLAETPAGSLDALCSAPGNAITTQLGPYAFKIPLSIRQKICSSLD
FT                   APNSRGNDWRLLAQKLSMDRYLNYFATKASPTGVILDLWEARQQDDGDLNSLASALEEM
FT                   GKSEMLVAMATDGDC"
FT   gene            complement(2272137..2282135)
FT                   /locus_tag="mCG_1044223"
FT                   /note="gene_id=mCG1044223.0"
FT   mRNA            complement(join(2272137..2272717,2273226..2273294,
FT                   2281931..2282135))
FT                   /locus_tag="mCG_1044223"
FT                   /product="mCG1044223"
FT                   /note="gene_id=mCG1044223.0 transcript_id=mCT161927.0
FT                   created on 13-NOV-2002"
FT   CDS             complement(2272171..2272557)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044223"
FT                   /product="mCG1044223"
FT                   /note="gene_id=mCG1044223.0 transcript_id=mCT161927.0
FT                   protein_id=mCP55121.1"
FT                   /db_xref="GOA:Q9D980"
FT                   /db_xref="MGI:MGI:1920866"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D980"
FT                   /protein_id="EDL32162.1"
FT                   /translation="MGPSSCHSRANSSFLLSLSIVMPGKPLRPSQRPLPGNPGGQAHSP
FT                   FCPSLCLGRKRRHRERRGLAQGHGTEVSSPQVSQHPEKGSLRALPNSKMIHQHANHSPA
FT                   FQQPSRAPPGCHIYFWACCPGPGV"
FT   gene            <2375323..2382100
FT                   /locus_tag="mCG_144845"
FT                   /note="gene_id=mCG144845.0"
FT   mRNA            join(<2375323..2375471,2380423..2381199,2381896..2382100)
FT                   /locus_tag="mCG_144845"
FT                   /product="mCG144845"
FT                   /note="gene_id=mCG144845.0 transcript_id=mCT184269.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<2375359..2375471,2380423..2380735)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144845"
FT                   /product="mCG144845"
FT                   /note="gene_id=mCG144845.0 transcript_id=mCT184269.0
FT                   protein_id=mCP105585.0"
FT                   /protein_id="EDL32161.1"
FT                   /translation="LVFSVLPLCCVTLNESSPHSGPSSLVCRRQAWRIALIKTYFLLPA
FT                   ASSQLPPSSHQLYSGFCSVLGNLVHHLEHCVCFSLPRNSGYKGTAEVKHLPASKPFLTP
FT                   EIKTPFPVCQAQGDLVSTTRAGCLLPTQPAWTHGSFP"
FT   gene            2433407..2438436
FT                   /gene="Pcbd1"
FT                   /locus_tag="mCG_1824"
FT                   /note="gene_id=mCG1824.2"
FT   mRNA            join(2433407..2433464,2436175..2436306,2436715..2436795,
FT                   2437918..2438436)
FT                   /gene="Pcbd1"
FT                   /locus_tag="mCG_1824"
FT                   /product="pterin 4 alpha carbinolamine
FT                   dehydratase/dimerization cofactor of hepatocyte nuclear
FT                   factor 1 alpha (TCF1) 1"
FT                   /note="gene_id=mCG1824.2 transcript_id=mCT8181.1 created on
FT                   01-OCT-2002"
FT   CDS             join(2433462..2433464,2436175..2436306,2436715..2436795,
FT                   2437918..2438016)
FT                   /codon_start=1
FT                   /gene="Pcbd1"
FT                   /locus_tag="mCG_1824"
FT                   /product="pterin 4 alpha carbinolamine
FT                   dehydratase/dimerization cofactor of hepatocyte nuclear
FT                   factor 1 alpha (TCF1) 1"
FT                   /note="gene_id=mCG1824.2 transcript_id=mCT8181.1
FT                   protein_id=mCP1472.1"
FT                   /protein_id="EDL32160.1"
FT                   /translation="MAGKAHRLSAEERDQLLPNLRAVGWNEVEGRDAIFKQFHFKDFNR
FT                   AFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
FT                   "
FT   gene            complement(2442757..2491695)
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /note="gene_id=mCG1825.2"
FT   mRNA            complement(join(2442757..2445121,2445794..2445914,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490299,
FT                   2491621..2491695))
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, transcript variant
FT                   mCT173971"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT173971.0 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(2442757..2445121,2445794..2445914,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490299,
FT                   2491652..2491678))
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, transcript variant
FT                   mCT173970"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT173970.0 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(2442757..2445121,2445794..2445914,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490301,
FT                   2491559..2491645))
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, transcript variant
FT                   mCT8183"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT8183.2 created on
FT                   17-DEC-2002"
FT   mRNA            complement(join(2442757..2445121,2445794..2445914,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490299,
FT                   2491559..2491644))
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, transcript variant
FT                   mCT177497"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT177497.0 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(2442758..2445121,2445794..2446176,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490299,
FT                   2491559..>2491682))
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, transcript variant
FT                   mCT192929"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT192929.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(2444981..2445121,2445794..2445914,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490252))
FT                   /codon_start=1
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, isoform CRA_b"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT173970.0
FT                   protein_id=mCP96889.0 isoform=CRA_b"
FT                   /protein_id="EDL32156.1"
FT                   /translation="MPGTDLLKLKDFEPYLEILESYSTKAKNYVNGYCTKYEPWQLIAW
FT                   SVLCTLLIVWVYELIFQPESLWSRFKKKLFKLIRKMPFIGRKIEQQVSKAKKDLVKNMP
FT                   FLKVDKDYVKTLPAQGMGTAEVLERLKEYSSMDGSWQEGKASGAVYNGEPKLTELLVQA
FT                   YGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYR
FT                   DLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVALKKNMEVDVQAMKRAISRNTA
FT                   MLVCSTPQFPHGVMDPVPEVAKLAVRYKIPLHVDACLGGFLIVFMEKAGYPLEKPFDFR
FT                   VKGVTSISADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGG
FT                   IIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIFIFGDPQLSVIALGSNDF
FT                   DIYRLSNMMSAKGWNFNYLQFPRSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKA
FT                   KTTGMGAIYGMAQATIDRKLVAEISSVFLDCLYTTDPVTQGNQMNGSPKPR"
FT   CDS             complement(join(2444981..2445121,2445794..2445914,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490252))
FT                   /codon_start=1
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, isoform CRA_b"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT177497.0
FT                   protein_id=mCP100419.0 isoform=CRA_b"
FT                   /protein_id="EDL32157.1"
FT                   /translation="MPGTDLLKLKDFEPYLEILESYSTKAKNYVNGYCTKYEPWQLIAW
FT                   SVLCTLLIVWVYELIFQPESLWSRFKKKLFKLIRKMPFIGRKIEQQVSKAKKDLVKNMP
FT                   FLKVDKDYVKTLPAQGMGTAEVLERLKEYSSMDGSWQEGKASGAVYNGEPKLTELLVQA
FT                   YGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYR
FT                   DLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVALKKNMEVDVQAMKRAISRNTA
FT                   MLVCSTPQFPHGVMDPVPEVAKLAVRYKIPLHVDACLGGFLIVFMEKAGYPLEKPFDFR
FT                   VKGVTSISADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGG
FT                   IIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIFIFGDPQLSVIALGSNDF
FT                   DIYRLSNMMSAKGWNFNYLQFPRSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKA
FT                   KTTGMGAIYGMAQATIDRKLVAEISSVFLDCLYTTDPVTQGNQMNGSPKPR"
FT   CDS             complement(join(2444981..2445121,2445794..2445914,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490252))
FT                   /codon_start=1
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, isoform CRA_b"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT8183.2
FT                   protein_id=mCP1475.2 isoform=CRA_b"
FT                   /protein_id="EDL32158.1"
FT                   /translation="MPGTDLLKLKDFEPYLEILESYSTKAKNYVNGYCTKYEPWQLIAW
FT                   SVLCTLLIVWVYELIFQPESLWSRFKKKLFKLIRKMPFIGRKIEQQVSKAKKDLVKNMP
FT                   FLKVDKDYVKTLPAQGMGTAEVLERLKEYSSMDGSWQEGKASGAVYNGEPKLTELLVQA
FT                   YGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYR
FT                   DLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVALKKNMEVDVQAMKRAISRNTA
FT                   MLVCSTPQFPHGVMDPVPEVAKLAVRYKIPLHVDACLGGFLIVFMEKAGYPLEKPFDFR
FT                   VKGVTSISADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGG
FT                   IIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIFIFGDPQLSVIALGSNDF
FT                   DIYRLSNMMSAKGWNFNYLQFPRSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKA
FT                   KTTGMGAIYGMAQATIDRKLVAEISSVFLDCLYTTDPVTQGNQMNGSPKPR"
FT   CDS             complement(join(2444981..2445121,2445794..2445914,
FT                   2446681..2446827,2447234..2447472,2448576..2448725,
FT                   2449535..2449633,2450378..2450483,2451690..2451778,
FT                   2456277..2456405,2457553..2457629,2458125..2458272,
FT                   2461810..2461877,2467424..2467589,2490226..2490252))
FT                   /codon_start=1
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, isoform CRA_b"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT173971.0
FT                   protein_id=mCP96890.0 isoform=CRA_b"
FT                   /protein_id="EDL32159.1"
FT                   /translation="MPGTDLLKLKDFEPYLEILESYSTKAKNYVNGYCTKYEPWQLIAW
FT                   SVLCTLLIVWVYELIFQPESLWSRFKKKLFKLIRKMPFIGRKIEQQVSKAKKDLVKNMP
FT                   FLKVDKDYVKTLPAQGMGTAEVLERLKEYSSMDGSWQEGKASGAVYNGEPKLTELLVQA
FT                   YGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYR
FT                   DLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVALKKNMEVDVQAMKRAISRNTA
FT                   MLVCSTPQFPHGVMDPVPEVAKLAVRYKIPLHVDACLGGFLIVFMEKAGYPLEKPFDFR
FT                   VKGVTSISADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGG
FT                   IIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIFIFGDPQLSVIALGSNDF
FT                   DIYRLSNMMSAKGWNFNYLQFPRSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKA
FT                   KTTGMGAIYGMAQATIDRKLVAEISSVFLDCLYTTDPVTQGNQMNGSPKPR"
FT   CDS             complement(join(2446158..2446176,2446681..2446827,
FT                   2447234..2447472,2448576..2448725,2449535..2449633,
FT                   2450378..2450483,2451690..2451778,2456277..2456405,
FT                   2457553..2457629,2458125..2458272,2461810..2461877,
FT                   2467424..2467589,2490226..2490299,2491559..>2491562))
FT                   /codon_start=1
FT                   /gene="Sgpl1"
FT                   /locus_tag="mCG_1825"
FT                   /product="sphingosine phosphate lyase 1, isoform CRA_a"
FT                   /note="gene_id=mCG1825.2 transcript_id=mCT192929.0
FT                   protein_id=mCP113916.0 isoform=CRA_a"
FT                   /protein_id="EDL32155.1"
FT                   /translation="GDAEAGQPRGGSRLQRKMPGTDLLKLKDFEPYLEILESYSTKAKN
FT                   YVNGYCTKYEPWQLIAWSVLCTLLIVWVYELIFQPESLWSRFKKKLFKLIRKMPFIGRK
FT                   IEQQVSKAKKDLVKNMPFLKVDKDYVKTLPAQGMGTAEVLERLKEYSSMDGSWQEGKAS
FT                   GAVYNGEPKLTELLVQAYGEFTWSNPLHPDIFPGLRKLEAEIVRMTCSLFNGGPDSCGC
FT                   VTSGGTESILMACKAYRDLALEKGIKTPEIVAPESAHAAFDKAAHYFGMKIVRVALKKN
FT                   MEVDVQAMKRAISRNTAMLVCSTPQFPHGVMDPVPEVAKLAVRYKIPLHVDACLGGFLI
FT                   VFMEKAGYPLEKPFDFRVKGVTSISADTHKYGYAPKGSSVVMYSNEKYRTYQFFVGADW
FT                   QGGVYASPSIAGSRPGGIIAACWAALMHFGENGYVEATKQIIKTARFLKSELENIKNIF
FT                   IFGDPQLSVIALGSNDFDIYRLSNMMSAKGWNFNYLQFPRRAYPLR"
FT   gene            <2519391..2533272
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /note="gene_id=mCG1826.2"
FT   mRNA            join(<2519391..2519518,2519846..2520093,2523200..2523358,
FT                   2524168..2524247,2527596..2527784,2528812..2529201,
FT                   2529595..2529676,2530723..2530864,2532110..2532162,
FT                   2533029..2533272)
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /product="RIKEN cDNA 1700021K02, transcript variant
FT                   mCT173973"
FT                   /note="gene_id=mCG1826.2 transcript_id=mCT173973.0 created
FT                   on 01-OCT-2002"
FT   mRNA            join(<2519391..2519518,2519846..2520093,2523200..2523358,
FT                   2524168..2524247,2527596..2527784,2529595..2529676,
FT                   2530723..2530864,2532110..2532162,2533029..2533272)
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /product="RIKEN cDNA 1700021K02, transcript variant
FT                   mCT173974"
FT                   /note="gene_id=mCG1826.2 transcript_id=mCT173974.0 created
FT                   on 01-OCT-2002"
FT   mRNA            join(<2519391..2519518,2519846..2520093,2523098..2523358,
FT                   2524168..2524532)
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /product="RIKEN cDNA 1700021K02, transcript variant
FT                   mCT8184"
FT                   /note="gene_id=mCG1826.2 transcript_id=mCT8184.1 created on
FT                   01-OCT-2002"
FT   mRNA            join(<2519391..2519518,2519846..2520093,2523200..2523358,
FT                   2524168..2524532)
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /product="RIKEN cDNA 1700021K02, transcript variant
FT                   mCT173972"
FT                   /note="gene_id=mCG1826.2 transcript_id=mCT173972.0 created
FT                   on 01-OCT-2002"
FT   CDS             join(<2519460..2519518,2519846..2520093,2523200..2523358,
FT                   2524168..2524247,2527596..2527784,2529595..2529676,
FT                   2530723..2530864,2532110..2532162,2533029..2533108)
FT                   /codon_start=1
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /product="RIKEN cDNA 1700021K02, isoform CRA_b"
FT                   /note="gene_id=mCG1826.2 transcript_id=mCT173974.0
FT                   protein_id=mCP96893.0 isoform=CRA_b"
FT                   /protein_id="EDL32152.1"
FT                   /translation="LFLGNVYKGSLAPRRDEVTSPKAEPQPETKPENLPRSHGDVGLQK
FT                   ETVVPGIVDFELIHEELKTTKPQTSQPTPSAYRFGRLSHHSFFSRHHPQPQRVTHIQDI
FT                   AGKPVCVVRDEFSLSALTQPTFLSRCLMGMPTISVPIGDPQSNRNPQLSTSDTWRKKLK
FT                   DLASRVTVFTKEIQPKPDEKEEPPLREPPPREQGAKYSAETGRLIPASSQALTRRNRQG
FT                   QRVHPSSKDGGVQASILQDQELLILELLCQILQTDSLRAIQFWLLYAPSKEKDLALGLL
FT                   QTAVAQLIPQPLSSIPAEKLWNHLQELQEPQETQEAAYSPSLKKTRSPPLPKTDKPEYI
FT                   GKAQVLLVHPSEDPEEKTTKAES"
FT   CDS             join(<2519460..2519518,2519846..2520093,2523200..2523358,
FT                   2524168..2524247,2527596..2527784,2528812..2528820)
FT                   /codon_start=1
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /product="RIKEN cDNA 1700021K02, isoform CRA_d"
FT                   /note="gene_id=mCG1826.2 transcript_id=mCT173973.0
FT                   protein_id=mCP96892.0 isoform=CRA_d"
FT                   /protein_id="EDL32154.1"
FT                   /translation="LFLGNVYKGSLAPRRDEVTSPKAEPQPETKPENLPRSHGDVGLQK
FT                   ETVVPGIVDFELIHEELKTTKPQTSQPTPSAYRFGRLSHHSFFSRHHPQPQRVTHIQDI
FT                   AGKPVCVVRDEFSLSALTQPTFLSRCLMGMPTISVPIGDPQSNRNPQLSTSDTWRKKLK
FT                   DLASRVTVFTKEIQPKPDEKEEPPLREPPPREQGAKYSAETGRLIPASSQALTRRNRQG
FT                   QRVHPSSKDGGVQASILQDQELLDS"
FT   CDS             join(<2519460..2519518,2519846..2520093,2523098..2523358,
FT                   2524168..2524295)
FT                   /codon_start=1
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /product="RIKEN cDNA 1700021K02, isoform CRA_c"
FT                   /note="gene_id=mCG1826.2 transcript_id=mCT8184.1
FT                   protein_id=mCP1518.2 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8I6"
FT                   /db_xref="MGI:MGI:1923820"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8I6"
FT                   /protein_id="EDL32153.1"
FT                   /translation="LFLGNVYKGSLAPRRDEVTSPKAEPQPETKPENLPRSHGDVGLQK
FT                   ETVVPGIVDFELIHEELKTTKPQTSQPTPSAYRFGRLSHHSFFSRHHPQPQRVTHIQVT
FT                   GREDLEHSLPLTTSFQLLQAPGVQPMDLTPSADIAGKPVCVVRDEFSLSALTQPTFLSR
FT                   CLMGMPTISVPIGDPQSNRNPQLSTSDTWRKKLKDLASRVTVFTKEIQPKPDEVGVAQR
FT                   MEPRKKRPS"
FT   CDS             join(<2519460..2519518,2519846..2520093,2523200..2523358,
FT                   2524168..2524295)
FT                   /codon_start=1
FT                   /gene="1700021K02Rik"
FT                   /locus_tag="mCG_1826"
FT                   /product="RIKEN cDNA 1700021K02, isoform CRA_a"
FT                   /note="gene_id=mCG1826.2 transcript_id=mCT173972.0
FT                   protein_id=mCP96891.0 isoform=CRA_a"
FT                   /protein_id="EDL32151.1"
FT                   /translation="LFLGNVYKGSLAPRRDEVTSPKAEPQPETKPENLPRSHGDVGLQK
FT                   ETVVPGIVDFELIHEELKTTKPQTSQPTPSAYRFGRLSHHSFFSRHHPQPQRVTHIQDI
FT                   AGKPVCVVRDEFSLSALTQPTFLSRCLMGMPTISVPIGDPQSNRNPQLSTSDTWRKKLK
FT                   DLASRVTVFTKEIQPKPDEVGVAQRMEPRKKRPS"
FT   gene            complement(2542910..>2617890)
FT                   /locus_tag="mCG_122067"
FT                   /note="gene_id=mCG122067.1"
FT   mRNA            complement(join(2542910..2543393,2544797..2544907,
FT                   2545610..2545739,2547257..2547464,2549281..2549413,
FT                   2549798..2549966,2551734..2551897,2556022..2556102,
FT                   2557558..2557681,2557964..2558097,2562782..2562957,
FT                   2566282..2566430,2567208..2567321,2568697..2568829,
FT                   2569761..2569904,2571531..2571636,2574080..2574227,
FT                   2574842..2574925,2590547..2590737,2594225..2594381,
FT                   2615438..2615838,2617809..>2617890))
FT                   /locus_tag="mCG_122067"
FT                   /product="mCG122067"
FT                   /note="gene_id=mCG122067.1 transcript_id=mCT123282.1
FT                   created on 19-SEP-2002"
FT   CDS             complement(join(2542912..2543393,2544797..2544907,
FT                   2545610..2545739,2547257..2547464,2549281..2549413,
FT                   2549798..2549966,2551734..2551897,2556022..2556102,
FT                   2557558..2557681,2557964..2558097,2562782..2562957,
FT                   2566282..2566430,2567208..2567321,2568697..2568829,
FT                   2569761..2569904,2571531..2571636,2574080..2574227,
FT                   2574842..2574925,2590547..2590737,2594225..2594381,
FT                   2615438..2615838,2617809..2617890))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122067"
FT                   /product="mCG122067"
FT                   /note="gene_id=mCG122067.1 transcript_id=mCT123282.1
FT                   protein_id=mCP55218.1"
FT                   /db_xref="GOA:B2RXX5"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR002870"
FT                   /db_xref="InterPro:IPR010294"
FT                   /db_xref="InterPro:IPR010909"
FT                   /db_xref="InterPro:IPR013273"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="MGI:MGI:2179942"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXX5"
FT                   /protein_id="EDL32150.1"
FT                   /translation="MAWLRALLHCLLPWYCALCAAAGSQTPDLRLSGKLHDYVVTVPCS
FT                   TDFQGRFLSHVVSAPAAPSPRSHLRVARSPLSLERETPRPGGPRQHFLYFNVTVFGKLL
FT                   HLRLQPNRRLVAPGAPVEWQEDFRELFRQPLQQECVYTGGVTGMPGAAVAISNCDGLAG
FT                   LIRTDNSDYFIEPLERGQQEKEAGGRTHVVYRREAVQREWKEPHGDLHNEAFGLGDLPN
FT                   VLDLVGDRLGDAERKRRHAKPGSYSIEVLLAVDDSVVRFHGREHTQNYVLTLMNIVDEI
FT                   YHDESLGAHVNIALVRLIMVGYRQSLSLIERGNPARSLEQVCRWAHSQQRQDPSHTEHH
FT                   DHVIFLTRQNFGPSGYAPVTGMCHPLRSCALNHEDGFSSAFVVAHETGHVLGMEHDGQG
FT                   NGCDDETSLGSVMAPLVQAAFHRFHWSRCSKLELSRYLPSYDCLLDDPFERTWPQPPEL
FT                   PGIDYSMDEQCRFDFGTGYHTCLAFRTFEPCKQLWCSHPDNPYFCKTKKGPPLDGTECA
FT                   PGKWCFKGHCIWKSPEQTYGQDGGWSSWTNFGSCSRSCGGGVRSRSRSCDNPPPAYGGR
FT                   PCSGSMFEYQICNSEDCPGPYEDFRAQQCAKRNSYYTHQDAKHSWLPYEPDSDAQKCEL
FT                   ICQSADTGDVVFMNQVVHDGTRCSYRDPYSVCARGECVPFGCDKEVGSMKTDDKCGVCG
FT                   GDNSHCRTVKGTLGKGSKQAAALKQVQIPAGARHIQIELLEKAPHRIAVKNQVTGSFIF
FT                   NPKGKEASSRTFTALGLEWEHEAEDTKDSLRTNGPLPEAIAILVLPPAEGKPRGSLAYK
FT                   YVIHEDLLPLIGSNNVLLEETDTYEWALKSWSPCSKACGGGIQFTKYGCRRRRDHHMVH
FT                   RHLCDHKKRPKPIRRRCNQHSCPQPTWVTEEWGACSRSCGKLGLQTRGVQCLLPLSNGT
FT                   HKAMPAKACLGNRPEAKKPCLRVPCPAQWRTGAWSQCSATCGEGIQQRQVVCRNTSSAL
FT                   GPCEGVKPDMVQICSLPACGGDLQNSTVKAEVQDPVTKTGYREPQSRPLTPEDRISTME
FT                   PCVRDRSVFCRMEVLDRYCTIPGYHRLCCESCIKKTSGPNASLALPPTFSTPGSLLPAP
FT                   KATLEDVKSTRGPTSLEDHRQSQPTQLPDVADRISPVTQYPVTPQMLSPKAFPGNSPAT
FT                   PRRPPQDWTQTAMPTSEGQGQSREEPGHGGTSLPATSPVT"
FT   gene            2642486..2648966
FT                   /gene="Prf1"
FT                   /locus_tag="mCG_15751"
FT                   /note="gene_id=mCG15751.1"
FT   mRNA            join(2642486..2642506,2644563..2645134,2647454..2648966)
FT                   /gene="Prf1"
FT                   /locus_tag="mCG_15751"
FT                   /product="perforin 1 (pore forming protein), transcript
FT                   variant mCT173966"
FT                   /note="gene_id=mCG15751.1 transcript_id=mCT173966.0 created
FT                   on 30-SEP-2002"
FT   mRNA            join(2644451..2645134,2647454..2648966)
FT                   /gene="Prf1"
FT                   /locus_tag="mCG_15751"
FT                   /product="perforin 1 (pore forming protein), transcript
FT                   variant mCT20126"
FT                   /note="gene_id=mCG15751.1 transcript_id=mCT20126.2 created
FT                   on 30-SEP-2002"
FT   CDS             join(2644599..2645134,2647454..2648582)
FT                   /codon_start=1
FT                   /gene="Prf1"
FT                   /locus_tag="mCG_15751"
FT                   /product="perforin 1 (pore forming protein), isoform CRA_a"
FT                   /note="gene_id=mCG15751.1 transcript_id=mCT173966.0
FT                   protein_id=mCP96885.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2RSY7"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR020863"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="MGI:MGI:97551"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSY7"
FT                   /protein_id="EDL32148.1"
FT                   /translation="MATCLFLLGLFLLLPRPVPAPCYTATRSECKQKHKFVPGVWMAGE
FT                   GMDVTTLRRSGSFPVNTQRFLRPDRTCTLCKNSLMRDATQRLPVAITHWRPHSSHCQRN
FT                   VAAAKVHSTEGVAREAAANINNDWRVGLDVNPRPEANMRASVAGSHSKVANFAAEKTYQ
FT                   DQYNFNSDTVECRMYSFRLVQKPPLHLDFKKALRALPRNFNSSTEHAYHRLISSYGTHF
FT                   ITAVDLGGRISVLTALRTCQLTLNGLTADEVGDCLNVEAQVSIGAQASVSSEYKACEEK
FT                   KKQHKMATSFHQTYRERHVEVLGGPLDSTHDLLFGNQATPEQFSTWTASLPSNPGLVDY
FT                   SLEPLHTLLEEQNPKREALRQAISHYIMSRARWQNCSRPCRSGQHKSSHDSCQCECQDS
FT                   KVTNQDCCPRQRGLAHLVVSNFRAEHLWGDYTTATDAYLKVFFGGQEFRTGVVWNNNNP
FT                   RWTDKMDFENVLLSTGGPLRVQVWDADYGWDDDLLGSCDRSPHSGFHEVTCELNHGRVK
FT                   FSYHAKCLPHLTGGTCLEYAPQGLLGDPPGNRSGAVW"
FT   CDS             join(2644599..2645134,2647454..2648582)
FT                   /codon_start=1
FT                   /gene="Prf1"
FT                   /locus_tag="mCG_15751"
FT                   /product="perforin 1 (pore forming protein), isoform CRA_a"
FT                   /note="gene_id=mCG15751.1 transcript_id=mCT20126.2
FT                   protein_id=mCP1473.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2RSY7"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR020863"
FT                   /db_xref="InterPro:IPR020864"
FT                   /db_xref="MGI:MGI:97551"
FT                   /db_xref="UniProtKB/TrEMBL:A2RSY7"
FT                   /protein_id="EDL32149.1"
FT                   /translation="MATCLFLLGLFLLLPRPVPAPCYTATRSECKQKHKFVPGVWMAGE
FT                   GMDVTTLRRSGSFPVNTQRFLRPDRTCTLCKNSLMRDATQRLPVAITHWRPHSSHCQRN
FT                   VAAAKVHSTEGVAREAAANINNDWRVGLDVNPRPEANMRASVAGSHSKVANFAAEKTYQ
FT                   DQYNFNSDTVECRMYSFRLVQKPPLHLDFKKALRALPRNFNSSTEHAYHRLISSYGTHF
FT                   ITAVDLGGRISVLTALRTCQLTLNGLTADEVGDCLNVEAQVSIGAQASVSSEYKACEEK
FT                   KKQHKMATSFHQTYRERHVEVLGGPLDSTHDLLFGNQATPEQFSTWTASLPSNPGLVDY
FT                   SLEPLHTLLEEQNPKREALRQAISHYIMSRARWQNCSRPCRSGQHKSSHDSCQCECQDS
FT                   KVTNQDCCPRQRGLAHLVVSNFRAEHLWGDYTTATDAYLKVFFGGQEFRTGVVWNNNNP
FT                   RWTDKMDFENVLLSTGGPLRVQVWDADYGWDDDLLGSCDRSPHSGFHEVTCELNHGRVK
FT                   FSYHAKCLPHLTGGTCLEYAPQGLLGDPPGNRSGAVW"
FT   gene            2654586..2655108
FT                   /locus_tag="mCG_49843"
FT                   /note="gene_id=mCG49843.1"
FT   mRNA            2654586..2655108
FT                   /locus_tag="mCG_49843"
FT                   /product="mCG49843"
FT                   /note="gene_id=mCG49843.1 transcript_id=mCT50026.1 created
FT                   on 13-NOV-2002"
FT   CDS             2654619..2655065
FT                   /codon_start=1
FT                   /locus_tag="mCG_49843"
FT                   /product="mCG49843"
FT                   /note="gene_id=mCG49843.1 transcript_id=mCT50026.1
FT                   protein_id=mCP24325.0"
FT                   /protein_id="EDL32147.1"
FT                   /translation="MPSRLRKTRKLRGHVSHSHGRIGKHRKHPGSRGNAGGRHHHRINF
FT                   DTYHPGYFGKVGMRHYHLKRNQSFCPTVNLDKLWTLVSEQTRVNAAKNKTGAAPIIDVV
FT                   RSGYYKVLGKGKLPKQPVIVKAKLFSRRAEEKIKGVGGACVLVA"
FT   gene            complement(2664572..2728718)
FT                   /gene="X99384"
FT                   /locus_tag="mCG_122064"
FT                   /note="gene_id=mCG122064.1"
FT   mRNA            complement(join(2664572..2666152,2668134..2668289,
FT                   2684343..2684483,2686075..2686146,2686356..2686496,
FT                   2687463..2687645,2687938..2688093,2688188..2688304,
FT                   2688775..2688903,2689251..2689346,2691908..2692012,
FT                   2692185..2692284,2692570..2692721,2693455..2693530,
FT                   2693681..2693841,2695288..2695452,2696043..2696222,
FT                   2698080..2698182,2700961..2701183,2728480..2728718))
FT                   /gene="X99384"
FT                   /locus_tag="mCG_122064"
FT                   /product="cDNA sequence X99384, transcript variant
FT                   mCT123279"
FT                   /note="gene_id=mCG122064.1 transcript_id=mCT123279.1
FT                   created on 30-SEP-2002"
FT   mRNA            complement(join(2664572..2666152,2668134..2668289,
FT                   2684343..2684483,2686075..2686146,2686356..2686496,
FT                   2687463..2687645,2687938..2688304,2688775..2688874,
FT                   2689251..2689346,2691908..2692012,2692185..2692284,
FT                   2692570..2692721,2693455..2693530,2693681..2693841,
FT                   2695288..2695452,2696043..2696222,2698080..2698182,
FT                   2700961..2701189,2728480..2728718))
FT                   /gene="X99384"
FT                   /locus_tag="mCG_122064"
FT                   /product="cDNA sequence X99384, transcript variant
FT                   mCT173957"
FT                   /note="gene_id=mCG122064.1 transcript_id=mCT173957.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(2666000..2666152,2668134..2668289,
FT                   2684343..2684483,2686075..2686146,2686356..2686496,
FT                   2687463..2687645,2687938..2688093,2688188..2688304,
FT                   2688775..2688903,2689251..2689346,2691908..2692012,
FT                   2692185..2692284,2692570..2692721,2693455..2693530,
FT                   2693681..2693841,2695288..2695452,2696043..2696222,
FT                   2698080..2698182,2700961..2701154))
FT                   /codon_start=1
FT                   /gene="X99384"
FT                   /locus_tag="mCG_122064"
FT                   /product="cDNA sequence X99384, isoform CRA_a"
FT                   /note="gene_id=mCG122064.1 transcript_id=mCT123279.1
FT                   protein_id=mCP54990.1 isoform=CRA_a"
FT                   /protein_id="EDL32145.1"
FT                   /translation="MGTTASTAQQTVSAGTSLEGLQGGSSSSMDSQHSLGGVQSFRATS
FT                   LHNSKAKSIIPNKVAPVVITYNCKEEFQIHDELLKAHYRMGRLSDATPEHYLVQGRYFL
FT                   VRDITEKMDILGTLKSCGAPNFRQVRGGLPVFGMGQPSLLGFRRVLQKLQTDGLKECII
FT                   FCVREEPVVFLRAEEDFVSYTPRDKESLHENLRDPSPGVKAENLELAIQKEIHDFAQLR
FT                   DNVYHVYHNTEDLRGEPHTVAIRGEDGVCVTEEVFKRPLFLQPTYRYHRLPLPEQGAPL
FT                   EAQFDAFVSVLRETPSLLPLRDNHGPLPALLFSCQSGVGRTNLGMVLGTLVMFHHSRTT
FT                   SQLEAASPLAKPLPMEQFQVIQGFICKVPQGKKMVEEVDRAISACAELHDLKEEVLKNQ
FT                   RRLESFRPESRGQECGSQQAVQQRALWSLELYFYLLLFNYYLHEQYPLAFALSFSRWLC
FT                   THPELYRLLVELNSVGPLVPGDLIAKGSLEADDLVSLDALSTVREMDVANFRRVPRMPI
FT                   YGTAQPSAKALGNILAYLSDAKRKLRQVVWINLREEVVLECDGHTHSLWPPGPALAPEH
FT                   LEALEAQLKAHLSAPVPNTKSPTAPRFQKCLTTQEVFSQHQGACLGLTYCRIPVPDFCA
FT                   PREEDFDRLLEALRAALTKDPGTGFVFSCLSGQGRTTTAMVVAVLACWHIGGCPEVGEE
FT                   ELVSVPDAKFTKGEFQVVMKVVQLLPDGHHVKKEVDAALDIVSETMTPMHYHLREIIIS
FT                   TYRQAKATKEAQEAQRLQLRSLQYLERYIYLILFNAYLRLEKTSSWQRPFSTWMREVAT
FT                   KAGIYEILNQLGFPELESIEEQPLSRLRYRWQEQSRDPEPCDVGDFL"
FT   CDS             complement(join(2688851..2688874,2689251..2689346,
FT                   2691908..2692012,2692185..2692284,2692570..2692721,
FT                   2693455..2693530,2693681..2693841,2695288..2695452,
FT                   2696043..2696222,2698080..2698182,2700961..2701154))
FT                   /codon_start=1
FT                   /gene="X99384"
FT                   /locus_tag="mCG_122064"
FT                   /product="cDNA sequence X99384, isoform CRA_b"
FT                   /note="gene_id=mCG122064.1 transcript_id=mCT173957.0
FT                   protein_id=mCP96876.0 isoform=CRA_b"
FT                   /protein_id="EDL32146.1"
FT                   /translation="MGTTASTAQQTVSAGTSLEGLQGGSSSSMDSQHSLGGVQSFRATS
FT                   LHNSKAKSIIPNKVAPVVITYNCKEEFQIHDELLKAHYRMGRLSDATPEHYLVQGRYFL
FT                   VRDITEKMDILGTLKSCGAPNFRQVRGGLPVFGMGQPSLLGFRRVLQKLQTDGLKECII
FT                   FCVREEPVVFLRAEEDFVSYTPRDKESLHENLRDPSPGVKAENLELAIQKEIHDFAQLR
FT                   DNVYHVYHNTEDLRGEPHTVAIRGEDGVCVTEEVFKRPLFLQPTYRYHRLPLPEQGAPL
FT                   EAQFDAFVSVLRETPSLLPLRDNHGPLPALLFSCQSGVGRTNLGMVLGTLVMFHHSRTT
FT                   SQLEAASPLAKPLPMEQFQVIQGFICKVPQGKKMVEEVDRAISACAELHDLKEEVLKNQ
FT                   RRLESFRPESRGQECGSQQAVQQRALWSLELYFYLLLFNYYLHEQSMAVYPS"
FT   gene            2762765..2770145
FT                   /gene="Nodal"
FT                   /locus_tag="mCG_15753"
FT                   /note="gene_id=mCG15753.2"
FT   mRNA            join(2762765..2763288,2767773..2768488,2769292..2770145)
FT                   /gene="Nodal"
FT                   /locus_tag="mCG_15753"
FT                   /product="nodal"
FT                   /note="gene_id=mCG15753.2 transcript_id=mCT20128.2 created
FT                   on 30-SEP-2002"
FT   CDS             join(2763093..2763288,2767773..2768488,2769292..2769444)
FT                   /codon_start=1
FT                   /gene="Nodal"
FT                   /locus_tag="mCG_15753"
FT                   /product="nodal"
FT                   /note="gene_id=mCG15753.2 transcript_id=mCT20128.2
FT                   protein_id=mCP1476.1"
FT                   /db_xref="GOA:P43021"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:97359"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43021"
FT                   /protein_id="EDL32144.1"
FT                   /translation="MSAHSLRILLLQACWALLHPRAPTAAALPLWTRGQPSSPSPLAYM
FT                   LSLYRDPLPRADIIRSLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDI
FT                   PTEGPLTIDIFHQAKGDPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKW
FT                   LKDPRALEKQVSSRAEKCWHQPYTPPVPVASTNVLMLYSNRPQEQRQLGGATLLWEAES
FT                   SWRAQEGQLSVERGGWGRRQRRHHLPDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAY
FT                   RCEGECPNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLL
FT                   EHHKDMIVEECGCL"
FT   gene            complement(2777228..2797481)
FT                   /locus_tag="mCG_15757"
FT                   /note="gene_id=mCG15757.3"
FT   mRNA            complement(join(2777228..2778020,2778642..2778743,
FT                   2779833..2780018,2797289..2797481))
FT                   /locus_tag="mCG_15757"
FT                   /product="mCG15757, transcript variant mCT173967"
FT                   /note="gene_id=mCG15757.3 transcript_id=mCT173967.0 created
FT                   on 03-DEC-2002"
FT   mRNA            complement(join(2777228..2778743,2779833..2780018,
FT                   2797289..2797481))
FT                   /locus_tag="mCG_15757"
FT                   /product="mCG15757, transcript variant mCT176133"
FT                   /note="gene_id=mCG15757.3 transcript_id=mCT176133.0 created
FT                   on 03-DEC-2002"
FT   CDS             complement(join(2778712..2778743,2779833..2780018,
FT                   2797289..2797433))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15757"
FT                   /product="mCG15757, isoform CRA_a"
FT                   /note="gene_id=mCG15757.3 transcript_id=mCT176133.0
FT                   protein_id=mCP99055.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UFP6"
FT                   /db_xref="InterPro:IPR008606"
FT                   /db_xref="MGI:MGI:109198"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UFP6"
FT                   /protein_id="EDL32142.1"
FT                   /translation="MSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFST
FT                   TPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNH
FT                   DRKHAVGDEAQFEMDI"
FT   CDS             complement(join(2778712..2778743,2779833..2780018,
FT                   2797289..2797433))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15757"
FT                   /product="mCG15757, isoform CRA_a"
FT                   /note="gene_id=mCG15757.3 transcript_id=mCT173967.0
FT                   protein_id=mCP96887.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UFP6"
FT                   /db_xref="InterPro:IPR008606"
FT                   /db_xref="MGI:MGI:109198"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UFP6"
FT                   /protein_id="EDL32143.1"
FT                   /translation="MSASAGGSHQPSQSRAIPTRTVAISDAAQLPQDYCTTPGGTLFST
FT                   TPGGTRIIYDRKFLLDRRNSPMAQTPPCHLPNIPGVTSPGALIEDSKVEVNNLNNLNNH
FT                   DRKHAVGDEAQFEMDI"
FT   gene            2820818..2927580
FT                   /gene="Lrrc20"
FT                   /locus_tag="mCG_15759"
FT                   /note="gene_id=mCG15759.2"
FT   mRNA            join(2820818..2820899,2827346..2827492,2872101..2872250,
FT                   2893089..2893257,2924918..2927580)
FT                   /gene="Lrrc20"
FT                   /locus_tag="mCG_15759"
FT                   /product="leucine rich repeat containing 20"
FT                   /note="gene_id=mCG15759.2 transcript_id=mCT20132.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(2827411..2827492,2872101..2872250,2893089..2893132)
FT                   /codon_start=1
FT                   /gene="Lrrc20"
FT                   /locus_tag="mCG_15759"
FT                   /product="leucine rich repeat containing 20"
FT                   /note="gene_id=mCG15759.2 transcript_id=mCT20132.2
FT                   protein_id=mCP1469.2"
FT                   /protein_id="EDL32140.1"
FT                   /translation="MLRKMGEAVARVARKVNETVESGSDTLDLADCKLVSFPICIYKVL
FT                   RNVSDQIHLITLANNELKSLTSKFMTTFNQLRELRLEGNYLLSTPQ"
FT   gene            complement(<2841565..2844611)
FT                   /locus_tag="mCG_1044338"
FT                   /note="gene_id=mCG1044338.0"
FT   mRNA            complement(join(<2841565..2842177,2843746..2843835,
FT                   2844571..2844611))
FT                   /locus_tag="mCG_1044338"
FT                   /product="mCG1044338"
FT                   /note="gene_id=mCG1044338.0 transcript_id=mCT162042.0
FT                   created on 13-NOV-2002"
FT   CDS             complement(<2841565..2841727)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044338"
FT                   /product="mCG1044338"
FT                   /note="gene_id=mCG1044338.0 transcript_id=mCT162042.0
FT                   protein_id=mCP55161.1"
FT                   /protein_id="EDL32141.1"
FT                   /translation="MRARRCSLKPQSGYLCTLPEWLPFLPQVSVLEAEGSRQAPGPPRH
FT                   KETMHKGQR"
FT   gene            complement(2854683..2855676)
FT                   /pseudo
FT                   /locus_tag="mCG_1044222"
FT                   /note="gene_id=mCG1044222.1"
FT   mRNA            complement(2854683..2855676)
FT                   /pseudo
FT                   /locus_tag="mCG_1044222"
FT                   /note="gene_id=mCG1044222.1 transcript_id=mCT161926.1
FT                   created on 13-NOV-2002"
FT   gene            2958797..2971306
FT                   /locus_tag="mCG_15770"
FT                   /note="gene_id=mCG15770.2"
FT   mRNA            join(2958797..2959188,2968210..2968309,2970429..2971306)
FT                   /locus_tag="mCG_15770"
FT                   /product="mCG15770"
FT                   /note="gene_id=mCG15770.2 transcript_id=mCT20189.2 created
FT                   on 13-NOV-2002"
FT   CDS             join(2958999..2959188,2968210..2968309,2970429..2971305)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15770"
FT                   /product="mCG15770"
FT                   /note="gene_id=mCG15770.2 transcript_id=mCT20189.2
FT                   protein_id=mCP1492.2"
FT                   /protein_id="EDL32139.1"
FT                   /translation="MFIAAYALIFLLCMVGNTLVCFIVLKNRHMRTVTNMFILNLAVSD
FT                   LLVGIFCMPTTLVDNLITGWPFDNATCKMSGLVQGMSVSASVFTLVAIAVERFRCIVHP
FT                   FREKLTLRKALLTIAVIWALALLIMCPSAVTLTVTREEHHFMLDARNRSYPLYSCWEAW
FT                   PEKGMRKVYTAVLFAHIYLAPLALIVVMYARIARKLCQAPGPARDAEEAVAEGGRASRR
FT                   RARVVHMLVMVALFFTLSWLPLWVLLLLIDYGELSELQLHLLSVYAFPLAHWLAFFHSS
FT                   ANPIIYGYFNENFRRGFQAAFRAQLCWLPWAAHKQAYSERPGRLLRRRVVVDVQPSDSG
FT                   LPSESGPSSGVPGPNRLPLRNGRVAHQDGPREGPGCNHMPLTIPAWNI"
FT   gene            <2993527..3019203
FT                   /gene="Ppa1"
FT                   /locus_tag="mCG_15762"
FT                   /note="gene_id=mCG15762.2"
FT   mRNA            join(<2993527..2993734,2996503..2996561,3004392..3004445,
FT                   3005855..3005974,3008633..3008719,3010332..3010458,
FT                   3011903..3012030,3012577..3012662,3015410..3015479,
FT                   3017383..3017425,3018811..3019203)
FT                   /gene="Ppa1"
FT                   /locus_tag="mCG_15762"
FT                   /product="pyrophosphatase (inorganic) 1"
FT                   /note="gene_id=mCG15762.2 transcript_id=mCT20137.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(<2993560..2993734,2996503..2996561,3004392..3004445,
FT                   3005855..3005974,3008633..3008719,3010332..3010458,
FT                   3011903..3012030,3012577..3012662,3015410..3015479,
FT                   3017383..3017425,3018811..3018842)
FT                   /codon_start=1
FT                   /gene="Ppa1"
FT                   /locus_tag="mCG_15762"
FT                   /product="pyrophosphatase (inorganic) 1"
FT                   /note="gene_id=mCG15762.2 transcript_id=mCT20137.2
FT                   protein_id=mCP1503.1"
FT                   /protein_id="EDL32138.1"
FT                   /translation="GQLVVRRRGLSPPYSGSGSGLCGCVAVQRRRRCISDTMSGFSSEE
FT                   RAAPFTLEYRVFLKNEKGQYISPFHDVPIYADKDVFHMVVEVPRWSNAKMEIATKDPLN
FT                   PIKQDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHSDKHTGCCGDNDPIDVCEIG
FT                   SKVCARGEIIRVKVLGILAMIDEGETDWKVIAINVDDPDAANYKDISDVERLKPGYLEA
FT                   TVDWFRRYKVPDGKPENEFAFNAEFKNKDFAVDIIKSTHDYWKALVTKKTDGKGISCMN
FT                   TTVSESPFKCDPDAAKAIVDALPPPCESACSLPTDVDKWFHQQKN"
FT   gene            complement(3019781..3025248)
FT                   /locus_tag="mCG_1044336"
FT                   /note="gene_id=mCG1044336.1"
FT   mRNA            complement(join(3019781..3020050,3025131..3025248))
FT                   /locus_tag="mCG_1044336"
FT                   /product="mCG1044336"
FT                   /note="gene_id=mCG1044336.1 transcript_id=mCT162040.1
FT                   created on 13-NOV-2002"
FT   CDS             complement(3019789..3019968)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044336"
FT                   /product="mCG1044336"
FT                   /note="gene_id=mCG1044336.1 transcript_id=mCT162040.1
FT                   protein_id=mCP55152.1"
FT                   /protein_id="EDL32137.1"
FT                   /translation="MAKSEIKKSRGHYCASDGDMRTRRACWPASLAQSVSSRFHCACGL
FT                   QELCTPTDIKIKFR"
FT   gene            3025290..3038315
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /note="gene_id=mCG15771.2"
FT   mRNA            join(3025290..3025430,3029872..3029945,3030058..3030177,
FT                   3030546..3030611,3031367..3031470,3034766..3034897,
FT                   3036277..3038315)
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), transcript
FT                   variant mCT175753"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175753.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(3025290..3025405,3027091..3027140,3029872..3029945,
FT                   3030058..3030177,3030546..3030611,3031367..3031470,
FT                   3034766..3034897,3036277..3038315)
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), transcript
FT                   variant mCT175752"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175752.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(3025290..3025405,3029053..3029179,3029872..3029945,
FT                   3030058..3030177,3030546..3030611,3031367..3031470,
FT                   3034766..3034897,3036277..3038315)
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), transcript
FT                   variant mCT175751"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175751.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(3025290..3025405,3029226..3029323,3029872..3029945,
FT                   3030058..3030177,3030546..3030611,3031367..3031470,
FT                   3034766..3034897,3036277..3038315)
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), transcript
FT                   variant mCT175750"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175750.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(3025290..3025405,3029872..3029945,3030058..3030177,
FT                   3030546..3030611,3031367..3031470,3034604..3034723,
FT                   3036277..3038315)
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), transcript
FT                   variant mCT175749"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175749.0 created
FT                   on 13-NOV-2002"
FT   mRNA            join(3025290..3025405,3029872..3029945,3030058..3030177,
FT                   3030546..3030611,3031367..3031470,3034766..3034897,
FT                   3036277..3038315)
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), transcript
FT                   variant mCT20190"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT20190.2 created
FT                   on 13-NOV-2002"
FT   mRNA            join(3025290..3025405,3029872..3029945,3030058..3030177,
FT                   3030546..3030611,3031367..3031419,3037496..3038315)
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), transcript
FT                   variant mCT175754"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175754.0 created
FT                   on 13-NOV-2002"
FT   CDS             join(3029888..3029945,3030058..3030177,3030546..3030611,
FT                   3031367..3031419,3037496..3037549)
FT                   /codon_start=1
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175754.0
FT                   protein_id=mCP98676.0 isoform=CRA_c"
FT                   /protein_id="EDL32134.1"
FT                   /translation="MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHML
FT                   KDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLMVCRW
FT                   EGILILISFNAR"
FT   CDS             join(3029888..3029945,3030058..3030177,3030546..3030611,
FT                   3031367..3031470,3034766..3034897,3036277..3036393)
FT                   /codon_start=1
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175750.0
FT                   protein_id=mCP98674.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99JZ4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:98230"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JZ4"
FT                   /protein_id="EDL32131.1"
FT                   /translation="MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHML
FT                   KDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCAD
FT                   HSRLMESKVELNALMTDETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNV
FT                   TLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID"
FT   CDS             join(3029888..3029945,3030058..3030177,3030546..3030611,
FT                   3031367..3031470,3034766..3034897,3036277..3036393)
FT                   /codon_start=1
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175751.0
FT                   protein_id=mCP98675.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99JZ4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:98230"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JZ4"
FT                   /protein_id="EDL32132.1"
FT                   /translation="MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHML
FT                   KDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCAD
FT                   HSRLMESKVELNALMTDETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNV
FT                   TLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID"
FT   CDS             join(3029888..3029945,3030058..3030177,3030546..3030611,
FT                   3031367..3031470,3034766..3034897,3036277..3036393)
FT                   /codon_start=1
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175753.0
FT                   protein_id=mCP98672.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99JZ4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:98230"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JZ4"
FT                   /protein_id="EDL32133.1"
FT                   /translation="MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHML
FT                   KDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCAD
FT                   HSRLMESKVELNALMTDETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNV
FT                   TLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID"
FT   CDS             join(3029888..3029945,3030058..3030177,3030546..3030611,
FT                   3031367..3031470,3034766..3034897,3036277..3036393)
FT                   /codon_start=1
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175752.0
FT                   protein_id=mCP98673.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q99JZ4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:98230"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JZ4"
FT                   /protein_id="EDL32135.1"
FT                   /translation="MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHML
FT                   KDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCAD
FT                   HSRLMESKVELNALMTDETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNV
FT                   TLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID"
FT   CDS             join(3029888..3029945,3030058..3030177,3030546..3030611,
FT                   3031367..3031470,3034766..3034897,3036277..3036393)
FT                   /codon_start=1
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT20190.2
FT                   protein_id=mCP1447.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q99JZ4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006687"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:98230"
FT                   /db_xref="UniProtKB/TrEMBL:Q99JZ4"
FT                   /protein_id="EDL32136.1"
FT                   /translation="MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHML
FT                   KDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCAD
FT                   HSRLMESKVELNALMTDETISNVPILILGNKIDRTDAISEEKLREIFGLYGQTTGKGNV
FT                   TLKELNARPMEVFMCSVLKRQGYGEGFRWLSQYID"
FT   CDS             join(3029888..3029945,3030058..3030177,3030546..3030611,
FT                   3031367..3031470,3034604..3034612)
FT                   /codon_start=1
FT                   /gene="Sar1a"
FT                   /locus_tag="mCG_15771"
FT                   /product="SAR1 gene homolog A (S. cerevisiae), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG15771.2 transcript_id=mCT175749.0
FT                   protein_id=mCP98671.0 isoform=CRA_a"
FT                   /protein_id="EDL32130.1"
FT                   /translation="MSFIFEWIYNGFSSVLQFLGLYKKSGKLVFLGLDNAGKTTLLHML
FT                   KDDRLGQHVPTLHPTSEELTIAGMTFTTFDLGGHEQARRVWKNYLPAINGIVFLVDCAD
FT                   HSRLMESKVELNVC"
FT   gene            3040505..3047766
FT                   /locus_tag="mCG_15765"
FT                   /note="gene_id=mCG15765.2"
FT   mRNA            join(3040505..3041734,3043291..3043421,3044436..3044621,
FT                   3047028..3047766)
FT                   /locus_tag="mCG_15765"
FT                   /product="mCG15765, transcript variant mCT20184"
FT                   /note="gene_id=mCG15765.2 transcript_id=mCT20184.2 created
FT                   on 13-NOV-2002"
FT   mRNA            join(3040505..3041734,3043291..3043421,3047028..3047766)
FT                   /locus_tag="mCG_15765"
FT                   /product="mCG15765, transcript variant mCT175748"
FT                   /note="gene_id=mCG15765.2 transcript_id=mCT175748.0 created
FT                   on 13-NOV-2002"
FT   CDS             join(3040563..3041734,3043291..3043421,3044436..3044621,
FT                   3047028..3047245)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15765"
FT                   /product="mCG15765, isoform CRA_a"
FT                   /note="gene_id=mCG15765.2 transcript_id=mCT20184.2
FT                   protein_id=mCP1509.2 isoform=CRA_a"
FT                   /protein_id="EDL32128.1"
FT                   /translation="MGRQWGPSMRVAEQAGCVVSASRAGQPDAGSWSCSGVILSRNPGL
FT                   VLCHGGIFTPFLRTGSAALTQTGTAFLPGDSCSDDLRLHVQWGPTAASPAGRADQELPG
FT                   LCTPQCASLGLEPGAPSRARARPLQPPRPAQLLLLLSCPAFRSHFARLFGADAVDQWHF
FT                   VSSAPDDAVSEEEEEDQLRALGWFALLRVQRGAAAEERRGPVVTVAPLGAVVKGAPLLA
FT                   CGSPFGAFCPDIFLNTLSRGVLSNAAGPLLLTDARCLPGTEGGGVFAARPAGALVALVA
FT                   APLCWKAREWVGLTLLCAAAPLLQVARWALARLHPGSASLSVLLPPPDVSTPRGLPLRD
FT                   LGPPWAAAAVLVECGTVWGSGVVVAPRLVVTCRHVAPREAARVLVHSATPKNVAIWGQV
FT                   VFATQETSPYDIAVVSLEEELNGVPTPVPAGHFHEGEPVSVVGFGVFGQACGPSVTSGI
FT                   LSAVVRVDGSPVMLQTTCAVHGGSSGGPLFSSGSGDLLGIVASNTRDNNTGATYPHLNF
FT                   SIPITVLQPALKQYSQTGDLGGLRELDHTTEPVRVVWRLQRPLSEVPRSKL"
FT   CDS             join(3040563..3041734,3043291..3043421,3047028..3047245)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15765"
FT                   /product="mCG15765, isoform CRA_b"
FT                   /note="gene_id=mCG15765.2 transcript_id=mCT175748.0
FT                   protein_id=mCP98670.0 isoform=CRA_b"
FT                   /protein_id="EDL32129.1"
FT                   /translation="MGRQWGPSMRVAEQAGCVVSASRAGQPDAGSWSCSGVILSRNPGL
FT                   VLCHGGIFTPFLRTGSAALTQTGTAFLPGDSCSDDLRLHVQWGPTAASPAGRADQELPG
FT                   LCTPQCASLGLEPGAPSRARARPLQPPRPAQLLLLLSCPAFRSHFARLFGADAVDQWHF
FT                   VSSAPDDAVSEEEEEDQLRALGWFALLRVQRGAAAEERRGPVVTVAPLGAVVKGAPLLA
FT                   CGSPFGAFCPDIFLNTLSRGVLSNAAGPLLLTDARCLPGTEGGGVFAARPAGALVALVA
FT                   APLCWKAREWVGLTLLCAAAPLLQVARWALARLHPGSASLSVLLPPPDVSTPRGLPLRD
FT                   LGPPWAAAAVLVECGTVWGSGVVVAPRLVVTCRHVAPREAARVLVHSATPKNVAIWGQV
FT                   VFATQETSPYDIAVVSLEEELNGVPTPVPAGHFHEGIVASNTRDNNTGATYPHLNFSIP
FT                   ITVLQPALKQYSQTGDLGGLRELDHTTEPVRVVWRLQRPLSEVPRSKL"
FT   gene            3060262..3084965
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /note="gene_id=mCG141511.0"
FT   mRNA            join(3060262..3060352,3070826..3071024,3071335..3071450,
FT                   3072617..3072736,3073099..3073191,3077301..3077409,
FT                   3079255..3079407,3080436..3080636,3081561..3081736,
FT                   3083377..3084965)
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /product="apoptosis-inducing factor (AIF)-like
FT                   mitochondrion-associated inducer of death, transcript
FT                   variant mCT175742"
FT                   /note="gene_id=mCG141511.0 transcript_id=mCT175742.0
FT                   created on 13-NOV-2002"
FT   mRNA            join(3060262..3060352,3070826..3071024,3071335..3071450,
FT                   3072617..3072736,3073099..3073191,3077301..3077409,
FT                   3079255..3079407,3080436..3080636,3081561..3081736,
FT                   3084006..3084965)
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /product="apoptosis-inducing factor (AIF)-like
FT                   mitochondrion-associated inducer of death, transcript
FT                   variant mCT175741"
FT                   /note="gene_id=mCG141511.0 transcript_id=mCT175741.0
FT                   created on 13-NOV-2002"
FT   mRNA            join(3065621..3065711,3070826..3071024,3071335..3071450,
FT                   3072617..3072736,3073099..3073191,3077301..3077409,
FT                   3079255..3079407,3080436..3080636,3081561..3081736,
FT                   3084006..3084965)
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /product="apoptosis-inducing factor (AIF)-like
FT                   mitochondrion-associated inducer of death, transcript
FT                   variant mCT175744"
FT                   /note="gene_id=mCG141511.0 transcript_id=mCT175744.0
FT                   created on 13-NOV-2002"
FT   mRNA            join(3065621..3065711,3070826..3071024,3071335..3071450,
FT                   3072617..3072736,3073099..3073191,3077301..3077409,
FT                   3079255..3079407,3080436..3080636,3083377..3084965)
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /product="apoptosis-inducing factor (AIF)-like
FT                   mitochondrion-associated inducer of death, transcript
FT                   variant mCT175743"
FT                   /note="gene_id=mCG141511.0 transcript_id=mCT175743.0
FT                   created on 13-NOV-2002"
FT   CDS             join(3070847..3071024,3071335..3071450,3072617..3072736,
FT                   3073099..3073191,3077301..3077409,3079255..3079407,
FT                   3080436..3080636,3083377..3083549)
FT                   /codon_start=1
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /product="apoptosis-inducing factor (AIF)-like
FT                   mitochondrion-associated inducer of death, isoform CRA_b"
FT                   /note="gene_id=mCG141511.0 transcript_id=mCT175743.0
FT                   protein_id=mCP98663.0 isoform=CRA_b"
FT                   /protein_id="EDL32125.1"
FT                   /translation="MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDS
FT                   FHHNVAALRASVESGFAKKTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSH
FT                   LILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKT
FT                   EYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYRE
FT                   YIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIY
FT                   AIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPETDQPPAALSPALLLWT
FT                   PARKLTLSEGRINYLQEAGHVRTLQSMAGLFSDRPCVISL"
FT   CDS             join(3070847..3071024,3071335..3071450,3072617..3072736,
FT                   3073099..3073191,3077301..3077409,3079255..3079407,
FT                   3080436..3080636,3081561..3081712)
FT                   /codon_start=1
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /product="apoptosis-inducing factor (AIF)-like
FT                   mitochondrion-associated inducer of death, isoform CRA_a"
FT                   /note="gene_id=mCG141511.0 transcript_id=mCT175741.0
FT                   protein_id=mCP98664.0 isoform=CRA_a"
FT                   /protein_id="EDL32124.1"
FT                   /translation="MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDS
FT                   FHHNVAALRASVESGFAKKTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSH
FT                   LILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKT
FT                   EYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYRE
FT                   YIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIY
FT                   AIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQ
FT                   ISGFYVGRLMVRLAKSRDLLISTSWKTMRQSPP"
FT   CDS             join(3070847..3071024,3071335..3071450,3072617..3072736,
FT                   3073099..3073191,3077301..3077409,3079255..3079407,
FT                   3080436..3080636,3081561..3081712)
FT                   /codon_start=1
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /product="apoptosis-inducing factor (AIF)-like
FT                   mitochondrion-associated inducer of death, isoform CRA_a"
FT                   /note="gene_id=mCG141511.0 transcript_id=mCT175742.0
FT                   protein_id=mCP98666.0 isoform=CRA_a"
FT                   /protein_id="EDL32126.1"
FT                   /translation="MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDS
FT                   FHHNVAALRASVESGFAKKTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSH
FT                   LILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKT
FT                   EYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYRE
FT                   YIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIY
FT                   AIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQ
FT                   ISGFYVGRLMVRLAKSRDLLISTSWKTMRQSPP"
FT   CDS             join(3070847..3071024,3071335..3071450,3072617..3072736,
FT                   3073099..3073191,3077301..3077409,3079255..3079407,
FT                   3080436..3080636,3081561..3081712)
FT                   /codon_start=1
FT                   /gene="Amid"
FT                   /locus_tag="mCG_141511"
FT                   /product="apoptosis-inducing factor (AIF)-like
FT                   mitochondrion-associated inducer of death, isoform CRA_a"
FT                   /note="gene_id=mCG141511.0 transcript_id=mCT175744.0
FT                   protein_id=mCP98665.0 isoform=CRA_a"
FT                   /protein_id="EDL32127.1"
FT                   /translation="MGSQVSVDTGAVHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDS
FT                   FHHNVAALRASVESGFAKKTFISYSATFKDNFRQGKVIGIDLKNRMVLLQGGEALPFSH
FT                   LILATGSTGPFPGKFNEVSCQQAAIQAYEDMVKQIQRSQFIVVVGGGSAGVEMAAEIKT
FT                   EYPEKEVTLIHSRVPLADKELLPCVRQEVKEILLRKGVQLLLSERVSNLEELPRNEYRE
FT                   YIKVETDKGTEVATNMVIVCNGIKINSSAYRSAFESRLASNGALKVNEFLQVEGYSNIY
FT                   AIGDCADTKEPKMAYHAGLHANVAVANIVNSMKQRPLKAYKPGALTFLLSMGRNDGVGQ
FT                   ISGFYVGRLMVRLAKSRDLLISTSWKTMRQSPP"
FT   gene            complement(3083677..>3094302)
FT                   /locus_tag="mCG_146290"
FT                   /note="gene_id=mCG146290.0"
FT   mRNA            complement(join(3083677..3084440,3086113..3086287,
FT                   3091611..3091700,3092650..3092749,3094254..>3094302))
FT                   /locus_tag="mCG_146290"
FT                   /product="mCG146290"
FT                   /note="gene_id=mCG146290.0 transcript_id=mCT186393.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(3084275..3084440,3086113..3086287,
FT                   3091611..3091700,3092650..3092749,3094254..>3094301))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146290"
FT                   /product="mCG146290"
FT                   /note="gene_id=mCG146290.0 transcript_id=mCT186393.0
FT                   protein_id=mCP107472.0"
FT                   /db_xref="GOA:A0PJB8"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="MGI:MGI:3037658"
FT                   /db_xref="UniProtKB/TrEMBL:A0PJB8"
FT                   /protein_id="EDL32123.1"
FT                   /translation="DGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDL
FT                   KEEIGKALEKAGGKEFLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSD
FT                   KCEEQLEETIKNCLSAAEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSS
FT                   SSLKNVYFLLFDSESIGIYVQEMAKLDTK"
FT   gene            complement(<3096661..>3129378)
FT                   /locus_tag="mCG_144844"
FT                   /note="gene_id=mCG144844.0"
FT   mRNA            complement(join(<3096661..3096852,3098440..3098546,
FT                   3102830..3103060,3129208..>3129378))
FT                   /locus_tag="mCG_144844"
FT                   /product="mCG144844"
FT                   /note="gene_id=mCG144844.0 transcript_id=mCT184268.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<3096661..3096852,3098440..3098546,
FT                   3102830..>3103019))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144844"
FT                   /product="mCG144844"
FT                   /note="gene_id=mCG144844.0 transcript_id=mCT184268.0
FT                   protein_id=mCP105584.0"
FT                   /protein_id="EDL32122.1"
FT                   /translation="EENRGKMSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKY
FT                   RISVGAPVYMAAVIEYLAAEILELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGV
FT                   TIASGGVLPRIHPELLAKKRGTKGKSETILSPPPEKRGRKAASGKKGGKKSKATKPRTS
FT                   "
FT   gene            complement(3183835..>3324645)
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /note="gene_id=mCG15769.2"
FT   mRNA            complement(join(3183835..3184307,3185677..3185715,
FT                   3189167..3189253,3194775..3194810,3195756..3195809,
FT                   3196711..3196764,3201937..3202017,3202381..3202407,
FT                   3203187..3203228,3206039..3206083,3207614..3207712,
FT                   3208227..3208370,3208643..3208687,3209540..3209602,
FT                   3211990..3212013,3213050..3213118,3213429..3213473,
FT                   3215122..3215175,3215759..3215845,3216886..3216930,
FT                   3219590..3219616,3220334..3220366,3221864..3221908,
FT                   3230278..3230313,3231290..3231316,3232851..3232958,
FT                   3235681..3235746,3236810..3236866,3238558..3238584,
FT                   3239517..3239543,3239636..3239662,3240936..3240962,
FT                   3241948..3241974,3242741..3242776,3248692..3248742,
FT                   3250856..3250882,3254284..3254319,3257251..3257277,
FT                   3265633..3265640,3306830..3306899,3323886..3324645))
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /product="procollagen, type XIII, alpha 1, transcript
FT                   variant mCT20188"
FT                   /note="gene_id=mCG15769.2 transcript_id=mCT20188.2 created
FT                   on 27-SEP-2002"
FT   mRNA            complement(join(3183836..3184307,3185677..3185715,
FT                   3189167..3189253,3194775..3194810,3195756..3195809,
FT                   3196711..3196764,3201937..3202017,3202381..3202407,
FT                   3203187..3203228,3206039..3206083,3208227..3208370,
FT                   3208643..3208687,3209540..3209602,3211990..3212013,
FT                   3213050..3213118,3213429..3213473,3215122..3215175,
FT                   3215759..3215845,3216886..3216930,3219590..3219616,
FT                   3220334..3220366,3221864..3221908,3230278..3230313,
FT                   3231290..3231316,3232851..3232958,3236810..3236866,
FT                   3238558..3238584,3239517..3239543,3239636..3239662,
FT                   3240936..3240962,3241948..3241974,3242741..3242776,
FT                   3248692..3248742,3254284..3254319,3257251..3257277,
FT                   3306830..3306899,3323886..>3324613))
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /product="procollagen, type XIII, alpha 1, transcript
FT                   variant mCT192972"
FT                   /note="gene_id=mCG15769.2 transcript_id=mCT192972.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3184097..3184307,3185677..3185715,
FT                   3189167..3189253,3194775..3194810,3195756..3195809,
FT                   3196711..3196764,3201937..3202017,3202381..3202407,
FT                   3203187..3203228,3206039..3206083,3207614..3207712,
FT                   3208227..3208370,3208643..3208687,3209540..3209602,
FT                   3211990..3212013,3213050..3213118,3213429..3213473,
FT                   3215122..3215175,3215759..3215845,3216886..3216930,
FT                   3219590..3219616,3220334..3220366,3221864..3221908,
FT                   3230278..3230313,3231290..3231316,3232851..3232958,
FT                   3235681..3235746,3236810..3236866,3238558..3238584,
FT                   3239517..3239543,3239636..3239662,3240936..3240962,
FT                   3241948..3241974,3242741..3242776,3248692..3248742,
FT                   3250856..3250882,3254284..3254319,3257251..3257277,
FT                   3306830..3306899,3323886..>3324645))
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /product="procollagen, type XIII, alpha 1, transcript
FT                   variant mCT192971"
FT                   /note="gene_id=mCG15769.2 transcript_id=mCT192971.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3184305..3184307,3185677..3185715,
FT                   3189167..3189253,3194775..3194810,3195756..3195809,
FT                   3196711..3196764,3201937..3202017,3202381..3202407,
FT                   3203187..3203228,3206039..3206083,3207614..3207712,
FT                   3208227..3208370,3208643..3208687,3209540..3209602,
FT                   3211990..3212013,3213050..3213118,3213429..3213473,
FT                   3215122..3215175,3215759..3215845,3216886..3216930,
FT                   3219590..3219616,3220334..3220366,3221864..3221908,
FT                   3230278..3230313,3231290..3231316,3232851..3232958,
FT                   3235681..3235746,3236810..3236866,3238558..3238584,
FT                   3239517..3239543,3239636..3239662,3240936..3240962,
FT                   3241948..3241974,3242741..3242776,3248692..3248742,
FT                   3250856..3250882,3254284..3254319,3257251..3257277,
FT                   3265633..3265640,3306830..3306899,3323886..3324173))
FT                   /codon_start=1
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /product="procollagen, type XIII, alpha 1, isoform CRA_d"
FT                   /note="gene_id=mCG15769.2 transcript_id=mCT20188.2
FT                   protein_id=mCP1488.2 isoform=CRA_d"
FT                   /protein_id="EDL32121.1"
FT                   /translation="MVAERTRKAAASGSRGPGELGAPGPGTVALAEQCARLPSPGCCGL
FT                   LALALCSLALSLLAHFRTAELQARVLRLEAERGEQQMEKAILGRVNQLLDEKWKFYSRR
FT                   RREAPKMSPGCNCPPGPPGPTGRPGLPGDKGAIGMPGRVGIKGQPGEKGAPGDAGMSIV
FT                   GPRGPPGQPGTRGFPGFPGPIGLDGRPGHPGPKGEMGLVGPRGQPGPQGQKGEKGQCGE
FT                   YPHREYPGGMLAALRSNPIMSLKLLPLLNSVRLAPPPVIKRRTFQGEQSQTGIQGPPGP
FT                   PGPPGPSGPLGHPGLPGPIGPPGLPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKG
FT                   VPGIAVAGMKGEPGTPGTKGEKGAAGSPGLLGQKGEKGDAGNAIGGGRGEPGPPGLPGP
FT                   PGPKGEAGVDGQAGPPGQQGDKGQPGAAGEQGPSGPKGAKGEPGKGEMVDYNGSINEAL
FT                   QEIRTLALMGPPGLPGQTGPPGPPGTPGQRGEIGLPGPPGHDGDKGPRGKPGDMGPAGP
FT                   QGPPGKDGPPGMKGEVGPPGSPGEKGETGQAGPQGLDGPTGEKGEPGDEGRPGATGLPG
FT                   PIGLPGFTGEKGEAGEKGDPGAEVPGPPGPEGPPGPPGLQGFPGPKGEAGLEGSKGEKG
FT                   SQGEKGDRGPLGLPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPGLHGPPGDK
FT                   GNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK"
FT   CDS             complement(join(3184305..3184307,3185677..3185715,
FT                   3189167..3189253,3194775..3194810,3195756..3195809,
FT                   3196711..3196764,3201937..3202017,3202381..3202407,
FT                   3203187..3203228,3206039..3206083,3208227..3208370,
FT                   3208643..3208687,3209540..3209602,3211990..3212013,
FT                   3213050..3213118,3213429..3213473,3215122..3215175,
FT                   3215759..3215845,3216886..3216930,3219590..3219616,
FT                   3220334..3220366,3221864..3221908,3230278..3230313,
FT                   3231290..3231316,3232851..3232958,3236810..3236866,
FT                   3238558..3238584,3239517..3239543,3239636..3239662,
FT                   3240936..3240962,3241948..3241974,3242741..3242776,
FT                   3248692..3248742,3254284..3254319,3257251..3257277,
FT                   3306830..3306899,3323886..>3324028))
FT                   /codon_start=1
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /product="procollagen, type XIII, alpha 1, isoform CRA_b"
FT                   /note="gene_id=mCG15769.2 transcript_id=mCT192972.0
FT                   protein_id=mCP113958.0 isoform=CRA_b"
FT                   /protein_id="EDL32119.1"
FT                   /translation="RCVRWRSACSPTFGPRSCRPGCCAWKQSAGSSRWRKLFWDESTNC
FT                   WTRNGSSTRVGAGKPRRCLQDVTAHQGPTGRPGLPGDKGAIGMPGRVGAPGDAGMSIVG
FT                   PRGPPGQPGTRGFPGFPGPIGLDGRPGHPGPKGEMGLVGPRGQPGPQGQKGEKGQCGEY
FT                   PHREYPGGMLAALRSNPIMSLKGEQSQTGIQGPPGPPGPPGPSGPLGHPGLPGPIGPPG
FT                   LPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGAKGVPGIAVAGMKGEPGTPGTKGEKG
FT                   AAGSPGLLGQKGEKGDAGNAIGGGRGEPGPPGLPGPPGPKGEAGVDGQAGPPGQQGDKG
FT                   QPGAAGEQGPSGPKGAKGEPGKGEMVDYNGSINEALQEIRTLALMGPPGLPGQTGPPGP
FT                   PGTPGQRGEIGLPGPPGHDGDKGPRGKPGDMGPAGPQGPPGKDGPPGMKGEVGPPGSPG
FT                   EKGETGQAGPQGEKGEAGEKGDPGAEVPGPPGPEGPPGPPGLQGFPGPKGEAGLEGSKG
FT                   EKGSQGEKGDRGPLGLPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPGLHGPP
FT                   GDKGNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK"
FT   CDS             complement(join(3184305..3184307,3185677..3185715,
FT                   3189167..3189253,3194775..3194810,3195756..3195809,
FT                   3196711..3196764,3201937..3202017,3202381..3202407,
FT                   3203187..3203228,3206039..3206083,3207614..3207712,
FT                   3208227..3208370,3208643..3208687,3209540..3209602,
FT                   3211990..3212013,3213050..3213118,3213429..3213473,
FT                   3215122..3215175,3215759..3215845,3216886..3216930,
FT                   3219590..3219616,3220334..3220366,3221864..3221908,
FT                   3230278..3230313,3231290..3231316,3232851..3232958,
FT                   3235681..3235746,3236810..3236866,3238558..3238584,
FT                   3239517..3239543,3239636..3239662,3240936..3240962,
FT                   3241948..3241974,3242741..3242776,3248692..3248742,
FT                   3250856..3250882,3254284..3254319,3257251..3257277,
FT                   3306830..3306899,3323886..>3324028))
FT                   /codon_start=1
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /product="procollagen, type XIII, alpha 1, isoform CRA_a"
FT                   /note="gene_id=mCG15769.2 transcript_id=mCT192971.0
FT                   protein_id=mCP113957.0 isoform=CRA_a"
FT                   /protein_id="EDL32118.1"
FT                   /translation="RCVRWRSACSPTFGPRSCRPGCCAWKQSAGSSRWRKLFWDESTNC
FT                   WTRNGSSTRVGAGKPRRCLQDVTAHQGPTGRPGLPGDKGAIGMPGRVGIKGQPGEKGAP
FT                   GDAGMSIVGPRGPPGQPGTRGFPGFPGPIGLDGRPGHPGPKGEMGLVGPRGQPGPQGQK
FT                   GEKGQCGEYPHREYPGGMLAALRSNPIMSLKLLPLLNSVRLAPPPVIKRRTFQGEQSQT
FT                   GIQGPPGPPGPPGPSGPLGHPGLPGPIGPPGLPGPPGPKGDPGIQGYHGRKGERGMPGM
FT                   PGKHGAKGVPGIAVAGMKGEPGTPGTKGEKGAAGSPGLLGQKGEKGDAGNAIGGGRGEP
FT                   GPPGLPGPPGPKGEAGVDGQAGPPGQQGDKGQPGAAGEQGPSGPKGAKGEPGKGEMVDY
FT                   NGSINEALQEIRTLALMGPPGLPGQTGPPGPPGTPGQRGEIGLPGPPGHDGDKGPRGKP
FT                   GDMGPAGPQGPPGKDGPPGMKGEVGPPGSPGEKGETGQAGPQGLDGPTGEKGEPGDEGR
FT                   PGATGLPGPIGLPGFTGEKGEAGEKGDPGAEVPGPPGPEGPPGPPGLQGFPGPKGEAGL
FT                   EGSKGEKGSQGEKGDRGPLGLPGTPGPIGVPGPAGPKGERGSKGDPGMTGPTGAAGLPG
FT                   LHGPPGDKGNRGERGKKGSRGPKGDKGDQGAPGLDAPCPLGEDGLPVQGCWNK"
FT   mRNA            complement(join(3194331..3194810,3195756..3195809,
FT                   3196711..3196764,3201937..3202017,3202381..3202407,
FT                   3203187..3203228,3206039..3206083,3208227..3208370,
FT                   3208643..3208687,3209540..3209602,3211990..3212013,
FT                   3213050..3213118,3213429..3213473,3215122..3215175,
FT                   3215759..3215845,3216886..3216930,3219590..3219616,
FT                   3220334..3220366,3221864..3221908,3230278..3230313,
FT                   3231290..3231316,3232851..3232958,3238558..3238584,
FT                   3239517..3239543,3239636..3239662,3240936..3240962,
FT                   3241948..3241974,3242741..3242776,3248692..3248742,
FT                   3254284..3254319,3257251..3257277,3306830..3306899,
FT                   3323250..>3323659))
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /product="procollagen, type XIII, alpha 1, transcript
FT                   variant mCT192973"
FT                   /note="gene_id=mCG15769.2 transcript_id=mCT192973.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3194655..3194810,3195756..3195809,
FT                   3196711..3196764,3201937..3202017,3202381..3202407,
FT                   3203187..3203228,3206039..3206083,3208227..3208370,
FT                   3208643..3208687,3209540..3209602,3211990..3212013,
FT                   3213050..3213118,3213429..3213473,3215122..3215175,
FT                   3215759..3215845,3216886..3216930,3219590..3219616,
FT                   3220334..3220366,3221864..3221908,3230278..3230313,
FT                   3231290..3231316,3232851..3232958,3238558..3238584,
FT                   3239517..3239543,3239636..3239662,3240936..3240962,
FT                   3241948..3241974,3242741..3242776,3248692..3248742,
FT                   3254284..3254319,3257251..3257277,3306830..3306899,
FT                   3323250..>3323347))
FT                   /codon_start=1
FT                   /gene="Col13a1"
FT                   /locus_tag="mCG_15769"
FT                   /product="procollagen, type XIII, alpha 1, isoform CRA_c"
FT                   /note="gene_id=mCG15769.2 transcript_id=mCT192973.0
FT                   protein_id=mCP113959.0 isoform=CRA_c"
FT                   /protein_id="EDL32120.1"
FT                   /translation="PMTLPAVASGMILTQSLQLRKGCSSLSKVSLPRNGSSTRVGAGKP
FT                   RRCLQDVTAHQGPTGRPGLPGDKGAIGMPGRVGAPGDAGMSIVGPRGPPGQPGTRGFPG
FT                   FPGPIGLDGRPGHPGPKGEMGLVGPRGQPGPQGQKGEKGQCGEYPHRGEQSQTGIQGPP
FT                   GPPGPPGPSGPLGHPGLPGPIGPPGLPGPPGPKGDPGIQGYHGRKGERGMPGMPGKHGA
FT                   KGVPGIAVAGMKGEPGTPGTKGEKGAAGSPGLLGQKGEKGDAGNAIGGGRGEPGPPGLP
FT                   GPPGPKGEAGVDGQAGPPGQQGDKGQPGAAGEQGPSGPKGAKGEPGKGEMVDYNGSINE
FT                   ALQEIRTLALMGPPGLPGQTGPPGPPGTPGQRGEIGLPGPPGHDGDKGPRGKPGDMGPA
FT                   GPQGPPGKDGPPGMKGEVGPPGSPGEKGETGQAGPQGEKGEAGEKGDPGAEVPGPPGPE
FT                   GPPGPPGLQGFPGPKGEAGLEGSKGEKGSQGEKGDRGPLGLPGTPGPIGVPGPAGPKGE
FT                   RGSKGDPGMTGPTGAAGLPGLHGPPGDKGNRVSLSPRALHLVTNVFMMGWNDQLEAPDL
FT                   TGQMFFPYKSS"
FT   gene            3305144..3306017
FT                   /pseudo
FT                   /locus_tag="mCG_15752"
FT                   /note="gene_id=mCG15752.1"
FT   mRNA            3305144..3306017
FT                   /pseudo
FT                   /locus_tag="mCG_15752"
FT                   /note="gene_id=mCG15752.1 transcript_id=mCT20127.1 created
FT                   on 13-NOV-2002"
FT   gene            3416881..3418489
FT                   /locus_tag="mCG_15755"
FT                   /note="gene_id=mCG15755.1"
FT   mRNA            3416881..3418489
FT                   /locus_tag="mCG_15755"
FT                   /product="mCG15755"
FT                   /note="gene_id=mCG15755.1 transcript_id=mCT20130.1 created
FT                   on 13-NOV-2002"
FT   CDS             3416990..3418228
FT                   /codon_start=1
FT                   /locus_tag="mCG_15755"
FT                   /product="mCG15755"
FT                   /note="gene_id=mCG15755.1 transcript_id=mCT20130.1
FT                   protein_id=mCP1511.1"
FT                   /db_xref="GOA:J3QNG0"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="MGI:MGI:3643173"
FT                   /db_xref="UniProtKB/TrEMBL:J3QNG0"
FT                   /protein_id="EDL32117.1"
FT                   /translation="MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFE
FT                   EARKKALKLGAKKVFIEDVSKEFVEEFIWPAVQSSALYEDRYLLGTSLARPCIARRQVE
FT                   IAQREGAKYVSHGATGKGNDQVRFELTCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEY
FT                   AKQHGIPIPVSPKSPWSMDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDV
FT                   LEIEFKKGVPVKVTNIKDGTTRTTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGI
FT                   YETPAGTILYHAHLDIEAFTMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIQK
FT                   SQERVEGKVQVSVFKGQVYILGRESPLSLYNEELVSMNVQGDYEPIDATGFININSLRL
FT                   KEYHRLQSKVTAK"
FT   gene            complement(3453658..3457024)
FT                   /gene="2010107G23Rik"
FT                   /locus_tag="mCG_15763"
FT                   /note="gene_id=mCG15763.2"
FT   mRNA            complement(join(3453658..3455122,3455883..3456011,
FT                   3456235..3456313,3456958..3457023))
FT                   /gene="2010107G23Rik"
FT                   /locus_tag="mCG_15763"
FT                   /product="RIKEN cDNA 2010107G23, transcript variant
FT                   mCT175746"
FT                   /note="gene_id=mCG15763.2 transcript_id=mCT175746.0 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(3453658..3455122,3455883..3456011,
FT                   3456235..3456313,3456597..3457023))
FT                   /gene="2010107G23Rik"
FT                   /locus_tag="mCG_15763"
FT                   /product="RIKEN cDNA 2010107G23, transcript variant
FT                   mCT175747"
FT                   /note="gene_id=mCG15763.2 transcript_id=mCT175747.0 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(3453659..3455122,3455883..3456011,
FT                   3456958..3457024))
FT                   /gene="2010107G23Rik"
FT                   /locus_tag="mCG_15763"
FT                   /product="RIKEN cDNA 2010107G23, transcript variant
FT                   mCT20182"
FT                   /note="gene_id=mCG15763.2 transcript_id=mCT20182.2 created
FT                   on 13-NOV-2002"
FT   CDS             complement(join(3454853..3455122,3455883..3455975))
FT                   /codon_start=1
FT                   /gene="2010107G23Rik"
FT                   /locus_tag="mCG_15763"
FT                   /product="RIKEN cDNA 2010107G23, isoform CRA_a"
FT                   /note="gene_id=mCG15763.2 transcript_id=mCT175746.0
FT                   protein_id=mCP98669.0 isoform=CRA_a"
FT                   /protein_id="EDL32114.1"
FT                   /translation="MVRILANGEIVQDDDPRVRTTTQHRSSSSQQGFFNRGHGAPPGGP
FT                   GPRQQQAGARLGAAQSPFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMMLGVRG
FT                   LLLVGLVYLVSHLSQR"
FT   CDS             complement(join(3454853..3455122,3455883..3455975))
FT                   /codon_start=1
FT                   /gene="2010107G23Rik"
FT                   /locus_tag="mCG_15763"
FT                   /product="RIKEN cDNA 2010107G23, isoform CRA_a"
FT                   /note="gene_id=mCG15763.2 transcript_id=mCT175747.0
FT                   protein_id=mCP98668.0 isoform=CRA_a"
FT                   /protein_id="EDL32115.1"
FT                   /translation="MVRILANGEIVQDDDPRVRTTTQHRSSSSQQGFFNRGHGAPPGGP
FT                   GPRQQQAGARLGAAQSPFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMMLGVRG
FT                   LLLVGLVYLVSHLSQR"
FT   CDS             complement(join(3454853..3455122,3455883..3455975))
FT                   /codon_start=1
FT                   /gene="2010107G23Rik"
FT                   /locus_tag="mCG_15763"
FT                   /product="RIKEN cDNA 2010107G23, isoform CRA_a"
FT                   /note="gene_id=mCG15763.2 transcript_id=mCT20182.2
FT                   protein_id=mCP1461.2 isoform=CRA_a"
FT                   /protein_id="EDL32116.1"
FT                   /translation="MVRILANGEIVQDDDPRVRTTTQHRSSSSQQGFFNRGHGAPPGGP
FT                   GPRQQQAGARLGAAQSPFSDLNRQLVNMGFPQWHLGNHVVEPVTSILLLFLLMMLGVRG
FT                   LLLVGLVYLVSHLSQR"
FT   gene            3474533..3480764
FT                   /gene="Neurog3"
FT                   /locus_tag="mCG_127654"
FT                   /note="gene_id=mCG127654.1"
FT   mRNA            3474533..>3480108
FT                   /gene="Neurog3"
FT                   /locus_tag="mCG_127654"
FT                   /product="neurogenin 3, transcript variant mCT128943"
FT                   /note="gene_id=mCG127654.1 transcript_id=mCT128943.0
FT                   created on 26-SEP-2002"
FT   mRNA            join(3479089..3479328,3479463..3480764)
FT                   /gene="Neurog3"
FT                   /locus_tag="mCG_127654"
FT                   /product="neurogenin 3, transcript variant mCT173610"
FT                   /note="gene_id=mCG127654.1 transcript_id=mCT173610.0
FT                   created on 26-SEP-2002"
FT   CDS             3479464..3480108
FT                   /codon_start=1
FT                   /gene="Neurog3"
FT                   /locus_tag="mCG_127654"
FT                   /product="neurogenin 3, isoform CRA_a"
FT                   /note="gene_id=mCG127654.1 transcript_id=mCT128943.0
FT                   protein_id=mCP55225.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q548G3"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:893591"
FT                   /db_xref="UniProtKB/TrEMBL:Q548G3"
FT                   /protein_id="EDL32112.1"
FT                   /translation="MAPHPLDALTIQVSPETQQPFPGASDHEVLSSNSTPPSPTLIPRD
FT                   CSEAEVGDCRGTSRKLRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALD
FT                   ALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGG
FT                   GSNGDWGSIYSPVSQAGNLSPTASLEEFPGLQVPSSPSYLLPGALVFSDFL"
FT   CDS             3479464..3480108
FT                   /codon_start=1
FT                   /gene="Neurog3"
FT                   /locus_tag="mCG_127654"
FT                   /product="neurogenin 3, isoform CRA_a"
FT                   /note="gene_id=mCG127654.1 transcript_id=mCT173610.0
FT                   protein_id=mCP96529.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q548G3"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="MGI:MGI:893591"
FT                   /db_xref="UniProtKB/TrEMBL:Q548G3"
FT                   /protein_id="EDL32113.1"
FT                   /translation="MAPHPLDALTIQVSPETQQPFPGASDHEVLSSNSTPPSPTLIPRD
FT                   CSEAEVGDCRGTSRKLRARRGGRNRPKSELALSKQRRSRRKKANDRERNRMHNLNSALD
FT                   ALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLRIADHSFYGPEPPVPCGELGSPGG
FT                   GSNGDWGSIYSPVSQAGNLSPTASLEEFPGLQVPSSPSYLLPGALVFSDFL"
FT   gene            complement(3533820..3577987)
FT                   /gene="Tspan15"
FT                   /locus_tag="mCG_15761"
FT                   /note="gene_id=mCG15761.2"
FT   mRNA            complement(join(3533820..3534626,3535107..3535223,
FT                   3536278..3536321,3537932..3538048,3540331..3540426,
FT                   3548494..3548568,3549796..3549981,3577757..3577987))
FT                   /gene="Tspan15"
FT                   /locus_tag="mCG_15761"
FT                   /product="tetraspanin 15, transcript variant mCT175745"
FT                   /note="gene_id=mCG15761.2 transcript_id=mCT175745.0 created
FT                   on 13-NOV-2002"
FT   mRNA            complement(join(3533821..3534626,3535107..3535223,
FT                   3536278..3536325,3537932..3538048,3540331..3540426,
FT                   3548494..3548568,3549796..3549981,3577757..3577987))
FT                   /gene="Tspan15"
FT                   /locus_tag="mCG_15761"
FT                   /product="tetraspanin 15, transcript variant mCT20136"
FT                   /note="gene_id=mCG15761.2 transcript_id=mCT20136.2 created
FT                   on 13-NOV-2002"
FT   CDS             complement(join(3534477..3534626,3535107..3535223,
FT                   3536278..3536325,3537932..3538048,3540331..3540426,
FT                   3548494..3548568,3549796..3549981,3577757..3577852))
FT                   /codon_start=1
FT                   /gene="Tspan15"
FT                   /locus_tag="mCG_15761"
FT                   /product="tetraspanin 15, isoform CRA_b"
FT                   /note="gene_id=mCG15761.2 transcript_id=mCT20136.2
FT                   protein_id=mCP1438.2 isoform=CRA_b"
FT                   /protein_id="EDL32111.1"
FT                   /translation="MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYA
FT                   EAERQKYKTLESAFLAPAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLV
FT                   MELIGGIVALIFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDW
FT                   SKNQYHDCSAPGPLACGVPYTCCIRNTTDVVNTMCGYKTIDKERLNAQNIIHVRGCTNA
FT                   VLIWFMDNYTIMAGLLLGILLPQFLGVLLTLLYITRVEDIILEHSVTDGLLGPGAKSRT
FT                   DTAGTGCCLCYPD"
FT   CDS             complement(join(3535217..3535223,3536278..3536321,
FT                   3537932..3538048,3540331..3540426,3548494..3548568,
FT                   3549796..3549981,3577757..3577852))
FT                   /codon_start=1
FT                   /gene="Tspan15"
FT                   /locus_tag="mCG_15761"
FT                   /product="tetraspanin 15, isoform CRA_a"
FT                   /note="gene_id=mCG15761.2 transcript_id=mCT175745.0
FT                   protein_id=mCP98667.0 isoform=CRA_a"
FT                   /db_xref="GOA:F7BWT7"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="MGI:MGI:1917673"
FT                   /db_xref="UniProtKB/Swiss-Prot:F7BWT7"
FT                   /protein_id="EDL32110.1"
FT                   /translation="MPRGDSEQVRYCARFSYLWLKFSLIIYSTVFWLIGGLVLSVGIYA
FT                   EAERQKYKTLESAFLAPAIILILLGVVMFIVSFIGVLASLRDNLCLLQSFMYILGICLV
FT                   MELIGGIVALIFRNQTIDFLNDNIRRGIENYYDDLDFKNIMDFVQKKFKCCGGEDYRDW
FT                   SKNQYHDCSAPGPLACGVPYTCCIRNTMLSTPCVATKQSTRSA"
FT   gene            3599203..3612049
FT                   /gene="Tacr2"
FT                   /locus_tag="mCG_15760"
FT                   /note="gene_id=mCG15760.1"
FT   mRNA            join(3599203..3599974,3604923..3605117,3607937..3608090,
FT                   3608249..3608445,3611813..3612049)
FT                   /gene="Tacr2"
FT                   /locus_tag="mCG_15760"
FT                   /product="tachykinin receptor 2"
FT                   /note="gene_id=mCG15760.1 transcript_id=mCT20135.1 created
FT                   on 26-SEP-2002"
FT   CDS             join(3599583..3599974,3604923..3605117,3607937..3608090,
FT                   3608249..3608445,3611813..3612029)
FT                   /codon_start=1
FT                   /gene="Tacr2"
FT                   /locus_tag="mCG_15760"
FT                   /product="tachykinin receptor 2"
FT                   /note="gene_id=mCG15760.1 transcript_id=mCT20135.1
FT                   protein_id=mCP1497.1"
FT                   /db_xref="GOA:Q3KP20"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000913"
FT                   /db_xref="InterPro:IPR001681"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:98477"
FT                   /db_xref="UniProtKB/TrEMBL:Q3KP20"
FT                   /protein_id="EDL32109.1"
FT                   /translation="MGAHASVTDTNILSGLESNATGVTAFSMPGWQLALWATAYLALVL
FT                   VAVTGNATVIWIILAHERMRTVTNYFIINLALADLCMAAFNATFNFIYASHNIWYFGST
FT                   FCYFQNLFPVTAMFVSIYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAVIWLVALALA
FT                   SPQCFYSTITVDQGATKCVVAWPNDNGGKMLLLYHLVVFVLIYFLPLVVMFAAYSVIGL
FT                   TLWKRAVPRHQAHGANLRHLQAKKKFVKAMVLVVVTFAICWLPYHLYFILGTFQEDIYY
FT                   RKFIQQVYLALFWLAMSSTMYNPIIYCCLNHRFRSGFRLAFRCCPWGTPTEEDRLELTH
FT                   TPSISRRVNRCHTKETLFMTGDMTHSEATNGQVGGPQDGEPAGP"
FT   gene            complement(3615839..3726601)
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /note="gene_id=mCG127656.1"
FT   mRNA            complement(join(3615839..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638602..3638670,
FT                   3638941..3639096,3642330..3642513,3642623..3642722,
FT                   3643376..3643471,3645849..3645968,3651419..3651567,
FT                   3662078..3662240,3699876..3699923,3705154..3705248,
FT                   3711841..3711886,3726528..3726601))
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, transcript variant mCT128945"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT128945.1
FT                   created on 26-SEP-2002"
FT   mRNA            complement(join(3615839..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3689318..3689532))
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, transcript variant mCT173613"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173613.0
FT                   created on 26-SEP-2002"
FT   mRNA            complement(join(3615839..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3651419..3651567,3662078..3662240,
FT                   3689318..3689532))
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, transcript variant mCT173615"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173615.0
FT                   created on 26-SEP-2002"
FT   mRNA            complement(join(3615839..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3651419..3651567,3662078..3662240,
FT                   3686830..3687176))
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, transcript variant mCT173614"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173614.0
FT                   created on 26-SEP-2002"
FT   mRNA            complement(join(3615839..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3651419..3651567,3662078..3662240,
FT                   3674096..3674455))
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, transcript variant mCT173611"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173611.0
FT                   created on 26-SEP-2002"
FT   mRNA            complement(join(3615839..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3651419..3651567,3662078..3662240,
FT                   3664957..3665084))
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, transcript variant mCT173612"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173612.0
FT                   created on 26-SEP-2002"
FT   CDS             complement(join(3616644..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638602..3638670,
FT                   3638941..3639096,3642330..3642513,3642623..3642722,
FT                   3643376..3643471,3645849..3645968,3651419..3651567,
FT                   3662078..3662240,3699876..3699923,3705154..3705180))
FT                   /codon_start=1
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT128945.1
FT                   protein_id=mCP55233.1 isoform=CRA_a"
FT                   /protein_id="EDL32103.1"
FT                   /translation="MGQNCQRGQAVDVEPKIRPPLTEEKIDKYLYAMRLSDEILIDILT
FT                   RFKKEMKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHE
FT                   KSQNVSMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCR
FT                   QSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCG
FT                   YDDQQCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEF
FT                   DRELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTT
FT                   SDVAAIETGWELSPDRRWYQAYMRCTQDTHRDKEGVQNAKEILTRLGVEPSHDDCVSVQ
FT                   HVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTL
FT                   RRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLSHFRLSKQALMEVKKK
FT                   LRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSGK
FT                   KRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQ
FT                   TSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAY
FT                   EEPSCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQMCINMEWGAFGDNGCLDDIRTDFD
FT                   KVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETK
FT                   FLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAVVEK
FT                   IRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKGAAL
FT                   ITAVGVRLRGDPTNA"
FT   CDS             complement(join(3616644..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3689318..3689377))
FT                   /codon_start=1
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, isoform CRA_c"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173613.0
FT                   protein_id=mCP96534.0 isoform=CRA_c"
FT                   /protein_id="EDL32105.1"
FT                   /translation="MDSEHCPSVPCGGAGAWEARLFDHVAECLGDFMEKRKIKDKKLPV
FT                   GFTFSFPCRQSKIDEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVND
FT                   TVGTMMTCGYDDQQCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDG
FT                   SLEDIRTEFDRELDRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPE
FT                   LLTRGKFTTSDVAAIETDKEGVQNAKEILTRLGVEPSHDDCVSVQHVCTIVSFRSANLV
FT                   AATLGAILNRLRDNKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLVPDSDVRFLLS
FT                   ESGSGKGAAMVTAVAYRLAEQHRQIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETN
FT                   SRATVKMLPSYVRSIPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIP
FT                   LEIMQGTGDELFDHIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKG
FT                   FKATDCVGHDVATLLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTG
FT                   SNACYMEEMKNVEMVEGNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQR
FT                   FEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLALLQ
FT                   VRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTV
FT                   GVDGTLYKLHPHFSRIMHQTVKELSPKCTVSFLLSEDGSGKGAALITAVGVRLRGDPTN
FT                   A"
FT   CDS             complement(join(3616644..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3651419..3651567,3662078..3662240,
FT                   3689318..3689377))
FT                   /codon_start=1
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, isoform CRA_f"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173615.0
FT                   protein_id=mCP96531.0 isoform=CRA_f"
FT                   /db_xref="GOA:G3UVV4"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="MGI:MGI:96103"
FT                   /db_xref="UniProtKB/TrEMBL:G3UVV4"
FT                   /protein_id="EDL32108.1"
FT                   /translation="MDSEHCPSVPCGGAGAWEARIDKYLYAMRLSDEILIDILTRFKKE
FT                   MKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNV
FT                   SMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKID
FT                   EAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQ
FT                   CEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELD
FT                   RGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAA
FT                   IETDKEGVQNAKEILTRLGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDN
FT                   KGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAV
FT                   AYRLAEQHRQIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRS
FT                   IPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDH
FT                   IVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATL
FT                   LRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEM
FT                   VEGNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIV
FT                   RNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTC
FT                   DDSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFS
FT                   RIMHQTVKELSPKCTVSFLLSEDGSGKGAALITAVGVRLRGDPTNA"
FT   CDS             complement(join(3616644..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3651419..3651567,3662078..3662240,
FT                   3686830..3686892))
FT                   /codon_start=1
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, isoform CRA_d"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173614.0
FT                   protein_id=mCP96530.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q6GQU1"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="InterPro:IPR019807"
FT                   /db_xref="InterPro:IPR022672"
FT                   /db_xref="InterPro:IPR022673"
FT                   /db_xref="MGI:MGI:96103"
FT                   /db_xref="UniProtKB/TrEMBL:Q6GQU1"
FT                   /protein_id="EDL32106.1"
FT                   /translation="MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDEILIDILTRFKK
FT                   EMKNGLSRDYNPTASVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQN
FT                   VSMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKI
FT                   DEAVLITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQ
FT                   QCEVGLIIGTGTNACYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREL
FT                   DRGSLNPGKQLFEKMVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVA
FT                   AIETDKEGVQNAKEILTRLGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRD
FT                   NKGTPRLRTTVGVDGSLYKMHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTA
FT                   VAYRLAEQHRQIEETLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVR
FT                   SIPDGTEHGDFLALDLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFD
FT                   HIVSCISDFLDYMGIKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVAT
FT                   LLRDAVKRREEFDLDVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVE
FT                   MVEGNQGQMCINMEWGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEI
FT                   VRNILIDFTKKGFLFRGQISEPLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNST
FT                   CDDSILVKTVCGVVSKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHF
FT                   SRIMHQTVKELSPKCTVSFLLSEDGSGKGAALITAVGVRLRGDPTNA"
FT   CDS             complement(join(3616644..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3651419..3651567,3662078..3662240,
FT                   3674096..3674116))
FT                   /codon_start=1
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, isoform CRA_e"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173611.0
FT                   protein_id=mCP96532.0 isoform=CRA_e"
FT                   /protein_id="EDL32107.1"
FT                   /translation="MACPVQKIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTA
FT                   SVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENI
FT                   VHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKA
FT                   SGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNA
FT                   CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEK
FT                   MVSGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKE
FT                   ILTRLGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVD
FT                   GSLYKMHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEE
FT                   TLSHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLAL
FT                   DLGGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMG
FT                   IKGPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDL
FT                   DVVAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQMCINME
FT                   WGAFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFL
FT                   FRGQISEPLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVV
FT                   SKRAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPK
FT                   CTVSFLLSEDGSGKGAALITAVGVRLRGDPTNA"
FT   CDS             complement(join(3616644..3616791,3618324..3618557,
FT                   3621165..3621320,3622399..3622582,3627659..3627758,
FT                   3628437..3628532,3630906..3631025,3631328..3631476,
FT                   3632975..3633279,3636787..3637020,3638941..3639096,
FT                   3642330..3642513,3642623..3642722,3643376..3643471,
FT                   3645849..3645968,3651419..3651567,3662078..3662240,
FT                   3664957..3664971))
FT                   /codon_start=1
FT                   /gene="Hk1"
FT                   /locus_tag="mCG_127656"
FT                   /product="hexokinase 1, isoform CRA_b"
FT                   /note="gene_id=mCG127656.1 transcript_id=mCT173612.0
FT                   protein_id=mCP96533.0 isoform=CRA_b"
FT                   /protein_id="EDL32104.1"
FT                   /translation="MRWDQIDKYLYAMRLSDEILIDILTRFKKEMKNGLSRDYNPTASV
FT                   KMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKSQNVSMESEVYDTPENIVH
FT                   GSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCRQSKIDEAVLITWTKRFKASG
FT                   VEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACY
FT                   MEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDRELDRGSLNPGKQLFEKMV
FT                   SGMYMGELVRLILVKMAKESLLFEGRITPELLTRGKFTTSDVAAIETDKEGVQNAKEIL
FT                   TRLGVEPSHDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGS
FT                   LYKMHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETL
FT                   SHFRLSKQALMEVKKKLRSEMEMGLRKETNSRATVKMLPSYVRSIPDGTEHGDFLALDL
FT                   GGTNFRVLLVKIRSGKKRTVEMHNKIYSIPLEIMQGTGDELFDHIVSCISDFLDYMGIK
FT                   GPRMPLGFTFSFPCKQTSLDCGILITWTKGFKATDCVGHDVATLLRDAVKRREEFDLDV
FT                   VAVVNDTVGTMMTCAYEEPSCEIGLIVGTGSNACYMEEMKNVEMVEGNQGQMCINMEWG
FT                   AFGDNGCLDDIRTDFDKVVDEYSLNSGKQRFEKMISGMYLGEIVRNILIDFTKKGFLFR
FT                   GQISEPLKTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSK
FT                   RAAQLCGAGMAAVVEKIRENRGLDHLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCT
FT                   VSFLLSEDGSGKGAALITAVGVRLRGDPTNA"
FT   gene            complement(3729852..3769109)
FT                   /gene="Hkdc1"
FT                   /locus_tag="mCG_11333"
FT                   /note="gene_id=mCG11333.2"
FT   mRNA            complement(join(3729852..3730635,3732391..3732624,
FT                   3738024..3738179,3740400..3740583,3741868..3741967,
FT                   3742111..3742206,3745298..3745417,3745503..3745642,
FT                   3746905..3747209,3748433..3748666,3750201..3750356,
FT                   3752134..3752317,3755267..3755366,3756442..3756537,
FT                   3758159..3758278,3758358..3758506,3764427..3764589,
FT                   3768950..3769109))
FT                   /gene="Hkdc1"
FT                   /locus_tag="mCG_11333"
FT                   /product="hexokinase domain containing 1"
FT                   /note="gene_id=mCG11333.2 transcript_id=mCT12047.2 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(3730488..3730635,3732391..3732624,
FT                   3738024..3738179,3740400..3740583,3741868..3741967,
FT                   3742111..3742206,3745298..3745417,3745503..3745642,
FT                   3746905..3747209,3748433..3748666,3750201..3750356,
FT                   3752134..3752317,3755267..3755366,3756442..3756537,
FT                   3758159..3758278,3758358..3758506,3764427..3764589,
FT                   3768950..3769012))
FT                   /codon_start=1
FT                   /gene="Hkdc1"
FT                   /locus_tag="mCG_11333"
FT                   /product="hexokinase domain containing 1"
FT                   /note="gene_id=mCG11333.2 transcript_id=mCT12047.2
FT                   protein_id=mCP1439.2"
FT                   /protein_id="EDL32102.1"
FT                   /translation="MFAVHLVAFYFTKLKEDQIKKVDRFLYHMRLSDETLVDIMARFQA
FT                   EMEKGLGKDTNPTASVKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSQEGQQN
FT                   VQMESQFYPMPNEITRGNGTELFDYVADCLADFMKTKNLTHKKLPLGFTFSFPCRQNKL
FT                   EEGVLLSWTKKFKARGVQDTDVVNRLATAMKKHKDLDVDILALVNDTVGTMMTCAYDDP
FT                   NCEVGVIIGTGTNACYMEDMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREL
FT                   DLGSLNPGKQLFEKMISGLYMGELVRLILLKMAKVGLLFGGAKSSALHTKGKIETQHVA
FT                   AMEMSKEGLANTREILVDLGLEPSESDCIAVQHVCTIVSFRSANLCAAALATILTRLRE
FT                   NKKLARLRTTVGMDGTLYKTHPQYPKRLHKVVRRLVPNCDVRFLLSESGSTKGAAMVTA
FT                   VASRVQAQRKQIDKVLALFQLTREQLLGVRDKMRAELEYGLKKKTHSLATVKMLPTYVY
FT                   GMPDGTEKGKFLALDLGGTNFRVLLVKIRRRSVRMYNKIFAIPLEIMQGTGEELFDHIV
FT                   QCIADFLDYMGLKGAQLPLGFTFSFPCRQTCIDKGTLVGWTKGFKATDCEGEDVVDMLR
FT                   EAIKRRNEFDLDIVAIVNDTVGTMMTCGYEDPRCEIGLIAGTGSNVCYMEEMRNIELVD
FT                   GDEGRMCVNTEWGGFGDNGCIDDIRTQYDKEVDEGSLNAGKQRYEKMTSGMYLGEIVRR
FT                   ILIDLTRQGLLFRGQISERLRTRGIFETKFLSQIESDRLALLQVRRILQQLGLDSTCED
FT                   SIVVKEVCGAVSRRAAQMCGAGMAAIVEKRREDQGLQHFKVTVGVDGTLYKLHPHFSRI
FT                   LQETVKELAPQCDVTFMLSEDGSGKGAALITAVAKRLQQPRKDI"
FT   gene            complement(3775869..3797257)
FT                   /gene="Supv3l1"
FT                   /locus_tag="mCG_11332"
FT                   /note="gene_id=mCG11332.2"
FT   mRNA            complement(join(3775869..3776485,3777122..3777270,
FT                   3778940..3779116,3779703..3779783,3781046..3781265,
FT                   3782110..3782203,3782297..3782477,3784085..3784176,
FT                   3785625..3785702,3787786..3787897,3790046..3790214,
FT                   3791690..3791804,3793675..3793782,3794347..3794424,
FT                   3796066..3797257))
FT                   /gene="Supv3l1"
FT                   /locus_tag="mCG_11332"
FT                   /product="suppressor of var1, 3-like 1 (S. cerevisiae),
FT                   transcript variant mCT12046"
FT                   /note="gene_id=mCG11332.2 transcript_id=mCT12046.2 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(3775906..3776485,3777122..3777270,
FT                   3778940..3779116,3779703..3779783,3781046..3781265,
FT                   3782110..3782203,3782297..3782477,3784085..3784176,
FT                   3785625..3785702,3787786..3787897,3790030..3790214,
FT                   3791690..3791804,3793675..3793782,3794347..3794424,
FT                   3796066..>3796335))
FT                   /gene="Supv3l1"
FT                   /locus_tag="mCG_11332"
FT                   /product="suppressor of var1, 3-like 1 (S. cerevisiae),
FT                   transcript variant mCT192952"
FT                   /note="gene_id=mCG11332.2 transcript_id=mCT192952.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3776071..3776485,3777122..3777270,
FT                   3778940..3779116,3779703..3779783,3781046..3781265,
FT                   3782110..3782203,3782297..3782477,3784085..3784176,
FT                   3785625..3785702,3787786..3787897,3790046..3790214,
FT                   3791690..3791804,3793675..3793782,3794347..3794424,
FT                   3796066..3796336))
FT                   /codon_start=1
FT                   /gene="Supv3l1"
FT                   /locus_tag="mCG_11332"
FT                   /product="suppressor of var1, 3-like 1 (S. cerevisiae),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11332.2 transcript_id=mCT12046.2
FT                   protein_id=mCP1451.2 isoform=CRA_a"
FT                   /protein_id="EDL32100.1"
FT                   /translation="MSLPRCTLLWARLPAGRGAGPRAAPCSALRALVGSFPGASGRVPC
FT                   LAASSSASGGSKAPNTSLFVPLTVKPQGPSADGDVGAELTRPLDKNEVKKILDKFYKRQ
FT                   EIQKLSADYGLDARLFHQAFISFRNYIMQSHSLDVDIHIVLNDICFSAAHVDDLFPFFL
FT                   RHAKQIFPVLECKDDLRKISDLRIPPNWYPEARARQRKIIFHSGPTNSGKTYHAIQRYL
FT                   SATSGVYCGPLKLLAHEIFEKSNAAGVPCDLVTGEERLTVEPEGKQATHVSCTVEMCNV
FT                   ATPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGESAAINLVSELLYTTGEEV
FT                   EVQKYERLTPISVLDHALESLDNLQPGDCIVCFSKNDIYSVSRQIEIRGLESAVIYGSL
FT                   PPGTKLAQARKFNDPNDPCKILVATDAIGMGLNLSIRRIIFYSLIKPSINEKGEKELEP
FT                   ITTSQALQIAGRAGRFSSHFKEGQVTTMHRDDLALLKDILNRPVDPIQAAGLHPTAEQI
FT                   EMFAYHLPETTLSNLIDIFVDFAQVDGQYFVCNMDDFKFSAELIQHIPLSLRVRYVFCT
FT                   APINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMDLEAVHDVF
FT                   DLYLWLSYRFIDMFPDSSLVRSLQKELDAIIQEGVHNITKLIKISESRKLLNLESLPSG
FT                   DQSRLSGASKSPARRTRGTKSAGNKATEPLSPSDKELPLASRLVQQGLLTADMLRQLQK
FT                   EWLTQQPEHSREKVGTRRKKKDPDSD"
FT   CDS             complement(join(3776071..3776485,3777122..3777270,
FT                   3778940..3779116,3779703..3779783,3781046..3781265,
FT                   3782110..3782203,3782297..3782477,3784085..3784176,
FT                   3785625..3785702,3787786..3787897,3790030..>3790086))
FT                   /codon_start=1
FT                   /gene="Supv3l1"
FT                   /locus_tag="mCG_11332"
FT                   /product="suppressor of var1, 3-like 1 (S. cerevisiae),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11332.2 transcript_id=mCT192952.0
FT                   protein_id=mCP113942.0 isoform=CRA_b"
FT                   /protein_id="EDL32101.1"
FT                   /translation="NCWRTRSLRRAMLLSVLYRGVPCDLVTGEERLTVEPEGKQATHVS
FT                   CTVEMCNVATPYEVAVIDEIQMIRDPARGWAWTRALLGLCAEEVHLCGESAAINLVSEL
FT                   LYTTGEEVEVQKYERLTPISVLDHALESLDNLQPGDCIVCFSKNDIYSVSRQIEIRGLE
FT                   SAVIYGSLPPGTKLAQARKFNDPNDPCKILVATDAIGMGLNLSIRRIIFYSLIKPSINE
FT                   KGEKELEPITTSQALQIAGRAGRFSSHFKEGQVTTMHRDDLALLKDILNRPVDPIQAAG
FT                   LHPTAEQIEMFAYHLPETTLSNLIDIFVDFAQVDGQYFVCNMDDFKFSAELIQHIPLSL
FT                   RVRYVFCTAPINKKQPFVCSSLLQFARQYSRNEPLTFAWLRRYIKWPLLPPKNIKDLMD
FT                   LEAVHDVFDLYLWLSYRFIDMFPDSSLVRSLQKELDAIIQEGVHNITKLIKISESRKLL
FT                   NLESLPSGDQSRLSGASKSPARRTRGTKSAGNKATEPLSPSDKELPLASRLVQQGLLTA
FT                   DMLRQLQKEWLTQQPEHSREKVGTRRKKKDPDSD"
FT   gene            3796149..3798003
FT                   /locus_tag="mCG_148087"
FT                   /note="gene_id=mCG148087.0"
FT   mRNA            3796149..3798003
FT                   /locus_tag="mCG_148087"
FT                   /product="mCG148087"
FT                   /note="gene_id=mCG148087.0 transcript_id=mCT188350.0
FT                   created on 13-JAN-2004"
FT   CDS             3797714..3797968
FT                   /codon_start=1
FT                   /locus_tag="mCG_148087"
FT                   /product="mCG148087"
FT                   /note="gene_id=mCG148087.0 transcript_id=mCT188350.0
FT                   protein_id=mCP108317.0"
FT                   /protein_id="EDL32099.1"
FT                   /translation="MTQVPGDHSGEGLWLPGTRFRHHRWGWGCSELEPNTWVKTLSLGW
FT                   RDDGSVVKSTSCSCRDLGSQLSVSSVPPHTDMQSKHQCI"
FT   gene            complement(3801886..3833320)
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /note="gene_id=mCG11324.2"
FT   mRNA            complement(join(3801886..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3814858..3815022,
FT                   3816469..3816625,3817628..3817703,3833226..3833320))
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   transcript variant mCT173591"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT173591.0 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(3801886..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3816469..3816625,
FT                   3827126..3827275,3833226..3833320))
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   transcript variant mCT173593"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT173593.0 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(3801886..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3814858..3815022,
FT                   3816469..3816625,3827126..3827275,3833226..3833320))
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   transcript variant mCT173592"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT173592.0 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(3801886..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3814858..3815022,
FT                   3816469..3816625,3817628..3817703,3827126..3827275,
FT                   3833226..3833320))
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   transcript variant mCT12038"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT12038.2 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(3801886..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3814858..3815022,
FT                   3816469..3816625,3817628..3817703,3827126..3827275,
FT                   3832946..3833168))
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   transcript variant mCT173590"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT173590.0 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(3803396..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3814858..3815022,
FT                   3816469..3816625,3817628..3817703,3833226..3833228))
FT                   /codon_start=1
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT173591.0
FT                   protein_id=mCP96509.0 isoform=CRA_b"
FT                   /protein_id="EDL32095.1"
FT                   /translation="MVNLAFKQPGKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKEL
FT                   ALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQL
FT                   ATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIK
FT                   KEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRY
FT                   FLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPDSQASAEQPEM"
FT   CDS             complement(join(3803396..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3814858..3815022,
FT                   3816469..3816625,3817628..3817703,3827126..3827275,
FT                   3833226..3833228))
FT                   /codon_start=1
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT12038.2
FT                   protein_id=mCP1500.2 isoform=CRA_d"
FT                   /protein_id="EDL32097.1"
FT                   /translation="MSFLGGFFGPICEIDVALNDGETRKMAEMKTEDGKVEKHYLFYDG
FT                   ESVSGKVNLAFKQPGKRLEHQGIRIEFVGQIELFNDKSNTHEFVNLVKELALPGELTQS
FT                   RSYDFEFMQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLATYPDVNNS
FT                   IKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKEITGIGPS
FT                   TTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDE
FT                   EDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPDSQASAEQPEM"
FT   CDS             complement(join(3803396..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3814858..3815022,
FT                   3816469..3816625,3817628..3817703,3827126..3827275,
FT                   3832946..3833044))
FT                   /codon_start=1
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT173590.0
FT                   protein_id=mCP96512.0 isoform=CRA_a"
FT                   /protein_id="EDL32094.1"
FT                   /translation="MSEPLPAFLDRLWGPWLGTRSPPSRSSAASPSKSFLGGFFGPICE
FT                   IDVALNDGETRKMAEMKTEDGKVEKHYLFYDGESVSGKVNLAFKQPGKRLEHQGIRIEF
FT                   VGQIELFNDKSNTHEFVNLVKELALPGELTQSRSYDFEFMQVEKPYESYIGANVRLRYF
FT                   LKVTIVRRLTDLVKEYDLIVHQLATYPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDV
FT                   IVGKIYFLLVRIKIQHMELQLIKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIR
FT                   LFLAGYDPTPTMRDVNKKFSVRYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTN
FT                   FHQRFESPDSQASAEQPEM"
FT   CDS             complement(join(3803396..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3816469..3816521))
FT                   /codon_start=1
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT173593.0
FT                   protein_id=mCP96511.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q6PE78"
FT                   /db_xref="InterPro:IPR028934"
FT                   /db_xref="MGI:MGI:1353654"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PE78"
FT                   /protein_id="EDL32098.1"
FT                   /translation="MQVEKPYESYIGANVRLRYHLKDVIVGKIYFLLVRIKIQHMELQL
FT                   IKKEITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSV
FT                   RYFLNLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPDSQASAEQPEM"
FT   CDS             complement(join(3803396..3803509,3805575..3805717,
FT                   3810354..3810422,3811295..3811401,3814858..3815022,
FT                   3816469..3816521))
FT                   /codon_start=1
FT                   /gene="Vps26a"
FT                   /locus_tag="mCG_11324"
FT                   /product="vacuolar protein sorting 26 homolog A (yeast),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG11324.2 transcript_id=mCT173592.0
FT                   protein_id=mCP96510.0 isoform=CRA_c"
FT                   /protein_id="EDL32096.1"
FT                   /translation="MQVEKPYESYIGANVRLRYFLKVTIVRRLTDLVKEYDLIVHQLAT
FT                   YPDVNNSIKMEVGIEDCLHIEFEYNKSKYHLKDVIVGKIYFLLVRIKIQHMELQLIKKE
FT                   ITGIGPSTTTETETIAKYEIMDGAPVKGESIPIRLFLAGYDPTPTMRDVNKKFSVRYFL
FT                   NLVLVDEEDRRYFKQQEIILWRKAPEKLRKQRTNFHQRFESPDSQASAEQPEM"
FT   gene            complement(3839963..3855163)
FT                   /gene="Prg1"
FT                   /locus_tag="mCG_11329"
FT                   /note="gene_id=mCG11329.2"
FT   mRNA            complement(join(3839963..3841057,3854181..3854375,
FT                   3854452..3855163))
FT                   /gene="Prg1"
FT                   /locus_tag="mCG_11329"
FT                   /product="proteoglycan 1, secretory granule, transcript
FT                   variant mCT173594"
FT                   /note="gene_id=mCG11329.2 transcript_id=mCT173594.0 created
FT                   on 03-DEC-2002"
FT   mRNA            complement(join(3839963..3841057,3844340..3844484,
FT                   3854181..3854375,3854452..3855163))
FT                   /gene="Prg1"
FT                   /locus_tag="mCG_11329"
FT                   /product="proteoglycan 1, secretory granule, transcript
FT                   variant mCT12043"
FT                   /note="gene_id=mCG11329.2 transcript_id=mCT12043.1 created
FT                   on 03-DEC-2002"
FT   CDS             complement(join(3840817..3841057,3844340..3844484,
FT                   3854181..3854375,3854452..3854455))
FT                   /codon_start=1
FT                   /gene="Prg1"
FT                   /locus_tag="mCG_11329"
FT                   /product="proteoglycan 1, secretory granule, isoform CRA_b"
FT                   /note="gene_id=mCG11329.2 transcript_id=mCT12043.1
FT                   protein_id=mCP1499.1 isoform=CRA_b"
FT                   /protein_id="EDL32093.1"
FT                   /translation="MGNCDVCSWAGSEVLEPLSKRDRKSTLLHLLIQRLSGAELVRMQV
FT                   PVGSRLVLALAFVLVWGSSVQGYPARRARYQWVRCKPNGFFANCIEEKGPQFDLIDESN
FT                   NIGPPMNNPVLMEGPSKDFISNYDDYGSGSGSGSGSGSGSGSGSGSGFLGDMEWEYQPT
FT                   DESNIVYFNYKPFDRILTEQNQDQPEDDFII"
FT   CDS             complement(join(3840942..3841057,3854181..3854375,
FT                   3854452..3854455))
FT                   /codon_start=1
FT                   /gene="Prg1"
FT                   /locus_tag="mCG_11329"
FT                   /product="proteoglycan 1, secretory granule, isoform CRA_a"
FT                   /note="gene_id=mCG11329.2 transcript_id=mCT173594.0
FT                   protein_id=mCP96514.0 isoform=CRA_a"
FT                   /protein_id="EDL32092.1"
FT                   /translation="MGNCDVCSWAGSEVLEPLSKRDRKSTLLHLLIQRLSGAELVRMQV
FT                   PVGSRLVLALAFVLVWGSSVQGWKDPQKISSPIMMTMGQVRAPALAPALARVPAPEVAS
FT                   "
FT   gene            complement(3905326..3926032)
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /note="gene_id=mCG11325.2"
FT   mRNA            complement(join(3905326..3906735,3910088..3910203,
FT                   3912889..3912973,3916311..3916494,3917251..3917330,
FT                   3922014..3922112,3924928..3926032))
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /product="RIKEN cDNA 2510003E04, transcript variant
FT                   mCT12039"
FT                   /note="gene_id=mCG11325.2 transcript_id=mCT12039.2 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(3905326..3906735,3910088..3910360,
FT                   3912889..3912973,3916311..3916494,3917251..3917330,
FT                   3922014..3922112,3924928..3926032))
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /product="RIKEN cDNA 2510003E04, transcript variant
FT                   mCT175727"
FT                   /note="gene_id=mCG11325.2 transcript_id=mCT175727.0 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(3905860..3906735,3910088..3910203,
FT                   3912889..3912973,3916311..3916494,3917251..3917330,
FT                   3922014..3922112,3924928..3925341))
FT                   /codon_start=1
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /product="RIKEN cDNA 2510003E04, isoform CRA_a"
FT                   /note="gene_id=mCG11325.2 transcript_id=mCT12039.2
FT                   protein_id=mCP1514.2 isoform=CRA_a"
FT                   /protein_id="EDL32087.1"
FT                   /translation="MANAPGPEIREKFQAALALSRVELHKNPEKEPYKSKYGARALLEE
FT                   VRALLGPAPEDEDEPAADDGPGDQALGAGEPREAEGPGAQRALRLAVVEFHLGVNHIDT
FT                   EELSAGEEHLVRCLSLLRPYRLSLGCVSLYIQAQNNLGILWSEREEIETARTYLESSEA
FT                   LYSQYMKEIGSPPLDPTEHFLPEEEKLTEQERSKRFEKVYTHNLYYLAQVYQHMEMFEK
FT                   AAHYCHSTLKRQLEHNAYHPMEWAINAATLSQFYINKLCFMEARHCLSAANVIFGQTGK
FT                   IPATEDTPEVEGDVPELYHQRKGEIARCWIKYCLTLMQNAQLSMQDNIGELDLDKQSEL
FT                   RALRKKELDEEESVRKRAVQFGTGELCDAISAVEEKVRYLRPLDFEEARELFLLGQHYV
FT                   CEAKEFFQIDGYVTDHIEVVQDHSALFKVLSFFEADMERRCKMHKRRIAMLEPLTVDLN
FT                   PQYYLLVSRQIQFEIAHAYYDMMDLKVAIADKLRDPDSHIVKKINSLNKSALKYYQLFL
FT                   DSLRDPNKVFPEHIGEDVLRPAMLAKFRVARLYGKIITADPKKELENLATSLEHYKFIV
FT                   DYCETHPEAAQEIEVELELSKEMVSLLPTKMERFRAKMALT"
FT   mRNA            complement(join(3908186..3909939,3909989..3910203,
FT                   3912889..3912973,3916311..3916494,3917251..3917330,
FT                   3922014..3922112,3924928..>3925409))
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /product="RIKEN cDNA 2510003E04, transcript variant
FT                   mCT192922"
FT                   /note="gene_id=mCG11325.2 transcript_id=mCT192922.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(3909835..3909939,3909989..3910203,
FT                   3912889..3912973,3916311..3916494,3917251..3917330,
FT                   3922014..3922112,3924928..>3925407))
FT                   /codon_start=1
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /product="RIKEN cDNA 2510003E04, isoform CRA_d"
FT                   /note="gene_id=mCG11325.2 transcript_id=mCT192922.0
FT                   protein_id=mCP113940.0 isoform=CRA_d"
FT                   /protein_id="EDL32090.1"
FT                   /translation="ATRRPPVAAGPRTGRRPSAQAAMANAPGPEIREKFQAALALSRVE
FT                   LHKNPEKEPYKSKYGARALLEEVRALLGPAPEDEDEPAADDGPGDQALGAGEPREAEGP
FT                   GAQRALRLAVVEFHLGVNHIDTEELSAGEEHLVRCLSLLRPYRLSLGCVSLYIQAQNNL
FT                   GILWSEREEIETARTYLESSEALYSQYMKEIGSPPLDPTEHFLPEEEKLTEQERSKRFE
FT                   KVYTHNLYYLAQVYQHMEMFEKAAHYCHSTLKRQLEHNAYHPMEWAINAATLSQFYINK
FT                   LCFMEARHCLSAANVIFGQTGKIPATEDTPEVEGDVPELYHQRKGEIARCWIKYCLTLM
FT                   QNAQLSMQVCTWKWPAASVRLIIRPTMCFVVLSFTLCVCVCVPVCICRFGGMYMSACGQ
FT                   PGFLRQSLSLVLGLGD"
FT   CDS             complement(join(3910350..3910360,3912889..3912973,
FT                   3916311..3916494,3917251..3917330,3922014..3922112,
FT                   3924928..3925341))
FT                   /codon_start=1
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /product="RIKEN cDNA 2510003E04, isoform CRA_b"
FT                   /note="gene_id=mCG11325.2 transcript_id=mCT175727.0
FT                   protein_id=mCP98650.0 isoform=CRA_b"
FT                   /protein_id="EDL32088.1"
FT                   /translation="MANAPGPEIREKFQAALALSRVELHKNPEKEPYKSKYGARALLEE
FT                   VRALLGPAPEDEDEPAADDGPGDQALGAGEPREAEGPGAQRALRLAVVEFHLGVNHIDT
FT                   EELSAGEEHLVRCLSLLRPYRLSLGCVSLYIQAQNNLGILWSEREEIETARTYLESSEA
FT                   LYSQYMKEIGSPPLDPTEHFLPEEEKLTEQERSKRFEKVYTHNLYYLAQVYQHMEMFEK
FT                   AAHYCHSTLKRQLEHNAYHPMEWAINAATLSQFYINKLCFMEARHCLSAANVIFGQTGK
FT                   IPATEDNET"
FT   mRNA            complement(join(3916940..3917330,3922014..3922112,
FT                   3924928..3926032))
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /product="RIKEN cDNA 2510003E04, transcript variant
FT                   mCT175728"
FT                   /note="gene_id=mCG11325.2 transcript_id=mCT175728.0 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(3917157..3917330,3922014..3922112,
FT                   3924928..3925341))
FT                   /codon_start=1
FT                   /gene="2510003E04Rik"
FT                   /locus_tag="mCG_11325"
FT                   /product="RIKEN cDNA 2510003E04, isoform CRA_c"
FT                   /note="gene_id=mCG11325.2 transcript_id=mCT175728.0
FT                   protein_id=mCP98649.0 isoform=CRA_c"
FT                   /protein_id="EDL32089.1"
FT                   /translation="MANAPGPEIREKFQAALALSRVELHKNPEKEPYKSKYGARALLEE
FT                   VRALLGPAPEDEDEPAADDGPGDQALGAGEPREAEGPGAQRALRLAVVEFHLGVNHIDT
FT                   EELSAGEEHLVRCLSLLRPYRLSLGCVSLYIQAQNNLGILWSEREEIETARTYLESSEA
FT                   LYSQYMKEIGSPPLDPTEHFLPEEEKLTEQERSKRLVFTDSTGIPQSLTRACSRLHTWS
FT                   WSWLRG"
FT   gene            3924658..3926032
FT                   /locus_tag="mCG_148090"
FT                   /note="gene_id=mCG148090.0"
FT   mRNA            3924658..3926032
FT                   /locus_tag="mCG_148090"
FT                   /product="mCG148090"
FT                   /note="gene_id=mCG148090.0 transcript_id=mCT188353.0
FT                   created on 13-JAN-2004"
FT   CDS             3925003..3925356
FT                   /codon_start=1
FT                   /locus_tag="mCG_148090"
FT                   /product="mCG148090"
FT                   /note="gene_id=mCG148090.0 transcript_id=mCT188353.0
FT                   protein_id=mCP108320.0"
FT                   /protein_id="EDL32091.1"
FT                   /translation="MLLAGRQFLRVDVVHTKVELDHREAQRPLRSGALSLPGLTRAQGL
FT                   VARPIVSSRLVLVLGRRAQQRAHLLQQRARAVLGLVRLLLRVLVQLHPRQGQRCLELLA
FT                   DLWPRSVRHRGLS"
FT   gene            complement(3926761..3949240)
FT                   /gene="Ddx21"
FT                   /locus_tag="mCG_11315"
FT                   /note="gene_id=mCG11315.2"
FT   mRNA            complement(join(3926761..3929571,3930018..3930062,
FT                   3931595..3931729,3932489..3932648,3934428..3934501,
FT                   3934968..3935087,3935621..3935782,3936742..3936891,
FT                   3937585..3937730,3938781..3938966,3939974..3940091,
FT                   3940926..3941104,3941996..3942071,3945191..3945850,
FT                   3949087..3949240))
FT                   /gene="Ddx21"
FT                   /locus_tag="mCG_11315"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 21,
FT                   transcript variant mCT12029"
FT                   /note="gene_id=mCG11315.2 transcript_id=mCT12029.2 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(3926761..3929571,3930018..3930062,
FT                   3931595..3931729,3932489..3932648,3934428..3934501,
FT                   3934968..3935087,3935621..3935782,3936742..3936891,
FT                   3937585..3937730,3938781..3938966,3939974..3940091,
FT                   3940926..3941104,3941996..3942071,3945191..3946149))
FT                   /gene="Ddx21"
FT                   /locus_tag="mCG_11315"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 21,
FT                   transcript variant mCT177478"
FT                   /note="gene_id=mCG11315.2 transcript_id=mCT177478.0 created
FT                   on 17-DEC-2002"
FT   CDS             complement(join(3929314..3929571,3930018..3930062,
FT                   3931595..3931729,3932489..3932648,3934428..3934501,
FT                   3934968..3935087,3935621..3935782,3936742..3936891,
FT                   3937585..3937730,3938781..3938966,3939974..3940091,
FT                   3940926..3941104,3941996..3942071,3945191..3945850,
FT                   3949087..3949173))
FT                   /codon_start=1
FT                   /gene="Ddx21"
FT                   /locus_tag="mCG_11315"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 21,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11315.2 transcript_id=mCT12029.2
FT                   protein_id=mCP1504.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9JIK5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012562"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1860494"
FT                   /db_xref="PDB:3ZIN"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JIK5"
FT                   /protein_id="EDL32086.1"
FT                   /translation="MPGKLRSGAKLGSDGAEESMETLPKPSEKKTRKEKTKSKTEEATE
FT                   GMEEAVSSKAKKTNKKGPSEDDVDPPKSRKAKKQEEEPQDDTASTSKTSKKKKEPLEKQ
FT                   ADSETKEIITEEPSEEEADMPKPKKMKKGKEANGDAGEKSPKLKNGLSQPSEEEADIPK
FT                   PKKMKKGKEANGDAGEKSPKLKNGLSQPSEEEVDIPKPKKMKKGKEASGDAGEKSPRLK
FT                   DGLSQPSEPKSNSSDAPGEESSSETEKEIPVEQKEGAFSNFPISEETVKLLKARGVNFL
FT                   FPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLQGGLQERKRGRAPQVLVLAP
FT                   TRELANQVSKDFSDITKKLSVACFYGGTPYGGQIERMRSGIDILVGTPGRIKDHLQNGK
FT                   LDLTKLKHVVLDEVDQMLDMGFADQVEEILCVAYKKDSEDNPQTLLFSATCPHWVFNVA
FT                   KKYMKSTYEQVDLIGKKTQKAAITVEHLAIKCHWTERAAVIGDVIRVYSGHQGRTIIFC
FT                   ETKKDAQELSQNTCIKQDAQSLHGDIPQKQREITLKGFRNGNFGVLVATNVAARGLDIP
FT                   EVDLVVQSCPPKDVESYIHRSGRTGRAGRTGVCICFYQNKEEYQLAQVEQKAGIKFKRI
FT                   GVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVEALAAALAHISGAT
FT                   SVDQRSLINSQAGFVTMILRCSIEMPNISYAWKELKEQLGESIDAKVKGMVFLKGKLGV
FT                   CFDVRTEAVTEIQEKWHDSRRWQLTVATEQPELEGPPDGYRGRMGQRDGSRGAFRGQRG
FT                   GSRNFRGQGQRGGSRNFRGQRPGGGNRGQKRSFSKAFGQ"
FT   CDS             complement(join(3929314..3929571,3930018..3930062,
FT                   3931595..3931729,3932489..3932648,3934428..3934501,
FT                   3934968..3935087,3935621..3935782,3936742..3936891,
FT                   3937585..3937730,3938781..3938966,3939974..3940091,
FT                   3940926..3941104,3941996..3942071,3945191..3945799))
FT                   /codon_start=1
FT                   /gene="Ddx21"
FT                   /locus_tag="mCG_11315"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 21,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11315.2 transcript_id=mCT177478.0
FT                   protein_id=mCP100400.0 isoform=CRA_a"
FT                   /protein_id="EDL32085.1"
FT                   /translation="MEEAVSSKAKKTNKKGPSEDDVDPPKSRKAKKQEEEPQDDTASTS
FT                   KTSKKKKEPLEKQADSETKEIITEEPSEEEADMPKPKKMKKGKEANGDAGEKSPKLKNG
FT                   LSQPSEEEADIPKPKKMKKGKEANGDAGEKSPKLKNGLSQPSEEEVDIPKPKKMKKGKE
FT                   ASGDAGEKSPRLKDGLSQPSEPKSNSSDAPGEESSSETEKEIPVEQKEGAFSNFPISEE
FT                   TVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFAIPLIEKLQGGLQER
FT                   KRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGGQIERMRSGIDILVG
FT                   TPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILCVAYKKDSEDNPQTLL
FT                   FSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKAAITVEHLAIKCHWTERAAVIGDVIR
FT                   VYSGHQGRTIIFCETKKDAQELSQNTCIKQDAQSLHGDIPQKQREITLKGFRNGNFGVL
FT                   VATNVAARGLDIPEVDLVVQSCPPKDVESYIHRSGRTGRAGRTGVCICFYQNKEEYQLA
FT                   QVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEKLIEEKGAVE
FT                   ALAAALAHISGATSVDQRSLINSQAGFVTMILRCSIEMPNISYAWKELKEQLGESIDAK
FT                   VKGMVFLKGKLGVCFDVRTEAVTEIQEKWHDSRRWQLTVATEQPELEGPPDGYRGRMGQ
FT                   RDGSRGAFRGQRGGSRNFRGQGQRGGSRNFRGQRPGGGNRGQKRSFSKAFGQ"
FT   gene            complement(3962660..3996318)
FT                   /locus_tag="mCG_141508"
FT                   /note="gene_id=mCG141508.0"
FT   mRNA            complement(join(3962660..3963384,3966453..3966497,
FT                   3969962..3970121,3970339..3970412,3971356..3971475,
FT                   3972746..3972907,3979202..3979351,3985085..3985230,
FT                   3985671..3985856,3985969..3986086,3988000..3988178,
FT                   3988521..3988596,3992033..3992320,3996144..3996318))
FT                   /locus_tag="mCG_141508"
FT                   /product="mCG141508, transcript variant mCT175726"
FT                   /note="gene_id=mCG141508.0 transcript_id=mCT175726.0
FT                   created on 12-NOV-2002"
FT   mRNA            complement(join(3962660..3963384,3966453..3966497,
FT                   3969962..3970121,3970339..3970412,3971356..3971475,
FT                   3972746..3972907,3979202..3979351,3985085..3985230,
FT                   3985671..3985856,3985969..3986086,3988000..3988178,
FT                   3988521..3988596,3992033..3992320,3992653..3992762,
FT                   3996144..3996318))
FT                   /locus_tag="mCG_141508"
FT                   /product="mCG141508, transcript variant mCT175724"
FT                   /note="gene_id=mCG141508.0 transcript_id=mCT175724.0
FT                   created on 12-NOV-2002"
FT   mRNA            complement(join(3962660..3963384,3966453..3966497,
FT                   3969962..3970121,3970339..3970412,3971356..3971475,
FT                   3972746..3972907,3979202..3979351,3985085..3985230,
FT                   3985671..3985856,3985969..3986086,3988000..3988178,
FT                   3988521..3988596,3992085..3992320,3992653..3992762,
FT                   3996144..3996286))
FT                   /locus_tag="mCG_141508"
FT                   /product="mCG141508, transcript variant mCT175725"
FT                   /note="gene_id=mCG141508.0 transcript_id=mCT175725.0
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(3963106..3963384,3966453..3966497,
FT                   3969962..3970121,3970339..3970412,3971356..3971475,
FT                   3972746..3972907,3979202..3979351,3985085..3985230,
FT                   3985671..3985856,3985969..3986086,3988000..3988178,
FT                   3988521..3988596,3992033..3992320,3996144..3996230))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141508"
FT                   /product="mCG141508, isoform CRA_c"
FT                   /note="gene_id=mCG141508.0 transcript_id=mCT175726.0
FT                   protein_id=mCP98646.0 isoform=CRA_c"
FT                   /protein_id="EDL32084.1"
FT                   /translation="MPGKLLWGDIMELEAPLEESESQRKERQKSDRRKSRHHSESEERT
FT                   ETRENGVTDDLDAPKPKKAKMREKLNGDTKEGLRFSDEFSPSHKSRRKDLPNGDVDEYE
FT                   KRSKRVSSSENSHKSSDKAEETLTREQKEGAFSNFSISEETIKLLKGRGVTYLFPIQVK
FT                   TFGPVYEGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELAN
FT                   QVAKDFKDITRKLSVACFYGGTSYQSQINQIRNGIDILVGTPGRIKDHLQSGRLDLSKL
FT                   RHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKS
FT                   RYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSGSEGRAIIFCETKKNV
FT                   TEMAMNPHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVI
FT                   QSSPPQDVESYIHRSGRTGRAGRTGICVCFYQPRERGQLRYVEQKAGITFKRVGVPSTM
FT                   DLVKSKSMDAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISGASSFEPRS
FT                   LITSDKGVCFDVPTSESERLQAEWHDSDWILSVPAKLPEIEEYYDGNTSSNPRQRSGWS
FT                   GGRSGRSGRSGGRSGGRSGRQSRQGSRSGSRQDGRRRSGNRNRSRSGGHKRNFD"
FT   CDS             complement(join(3963106..3963384,3966453..3966497,
FT                   3969962..3970121,3970339..3970412,3971356..3971475,
FT                   3972746..3972907,3979202..3979351,3985085..3985230,
FT                   3985671..3985856,3985969..3986086,3988000..3988178,
FT                   3988521..3988596,3992033..3992212))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141508"
FT                   /product="mCG141508, isoform CRA_a"
FT                   /note="gene_id=mCG141508.0 transcript_id=mCT175724.0
FT                   protein_id=mCP98647.0 isoform=CRA_a"
FT                   /protein_id="EDL32082.1"
FT                   /translation="MREKLNGDTKEGLRFSDEFSPSHKSRRKDLPNGDVDEYEKRSKRV
FT                   SSSENSHKSSDKAEETLTREQKEGAFSNFSISEETIKLLKGRGVTYLFPIQVKTFGPVY
FT                   EGKDLIAQARTGTGKTFSFAIPLIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDF
FT                   KDITRKLSVACFYGGTSYQSQINQIRNGIDILVGTPGRIKDHLQSGRLDLSKLRHVVLD
FT                   EVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKSRYEQVD
FT                   LVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSGSEGRAIIFCETKKNVTEMAMN
FT                   PHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEVDLVIQSSPPQ
FT                   DVESYIHRSGRTGRAGRTGICVCFYQPRERGQLRYVEQKAGITFKRVGVPSTMDLVKSK
FT                   SMDAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISGASSFEPRSLITSDK
FT                   GVCFDVPTSESERLQAEWHDSDWILSVPAKLPEIEEYYDGNTSSNPRQRSGWSGGRSGR
FT                   SGRSGGRSGGRSGRQSRQGSRSGSRQDGRRRSGNRNRSRSGGHKRNFD"
FT   CDS             complement(join(3963106..3963384,3966453..3966497,
FT                   3969962..3970121,3970339..3970412,3971356..3971475,
FT                   3972746..3972907,3979202..3979351,3985085..3985230,
FT                   3985671..3985731))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141508"
FT                   /product="mCG141508, isoform CRA_b"
FT                   /note="gene_id=mCG141508.0 transcript_id=mCT175725.0
FT                   protein_id=mCP98648.0 isoform=CRA_b"
FT                   /protein_id="EDL32083.1"
FT                   /translation="MLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKK
FT                   YMKSRYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSGSEGRAIIFCET
FT                   KKNVTEMAMNPHIKQNAQCLHGDIAQSQREITLKGFREGSFKVLVATNVAARGLDIPEV
FT                   DLVIQSSPPQDVESYIHRSGRTGRAGRTGICVCFYQPRERGQLRYVEQKAGITFKRVGV
FT                   PSTMDLVKSKSMDAIRSLASVSYAAVDFFRPSAQRLIEEKGAVDALAAALAHISGASSF
FT                   EPRSLITSDKGVCFDVPTSESERLQAEWHDSDWILSVPAKLPEIEEYYDGNTSSNPRQR
FT                   SGWSGGRSGRSGRSGGRSGGRSGRQSRQGSRSGSRQDGRRRSGNRNRSRSGGHKRNFD"
FT   gene            complement(4004245..4069104)
FT                   /locus_tag="mCG_141509"
FT                   /note="gene_id=mCG141509.0"
FT   mRNA            complement(join(4004245..4004847,4011274..4011473,
FT                   4012969..4013121,4068933..4069104))
FT                   /locus_tag="mCG_141509"
FT                   /product="mCG141509, transcript variant mCT175736"
FT                   /note="gene_id=mCG141509.0 transcript_id=mCT175736.0
FT                   created on 12-NOV-2002"
FT   mRNA            complement(join(4004245..4004847,4009103..>4009519))
FT                   /locus_tag="mCG_141509"
FT                   /product="mCG141509, transcript variant mCT175737"
FT                   /note="gene_id=mCG141509.0 transcript_id=mCT175737.0
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(4004700..4004847,4009103..>4009518))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141509"
FT                   /product="mCG141509, isoform CRA_b"
FT                   /note="gene_id=mCG141509.0 transcript_id=mCT175737.0
FT                   protein_id=mCP98658.0 isoform=CRA_b"
FT                   /protein_id="EDL32081.1"
FT                   /translation="YKATGLFSNAGESPNPDLSDNPGQNSRIPWGFNYEGEPTVAHVQT
FT                   PAAAAGRSLLACSTVRTTSFPVEILQESPGDRGKSPIVWRQSLPSQEMKEHFTDKLQLV
FT                   KTSHGPVSAQEPQGEHLEGTENYSMTGDSGIDSPRTQSLVSTNSAILDGFKRRQHFLPN
FT                   REGVQKSQNLASNSLFQLTPAINV"
FT   CDS             complement(join(4004824..4004847,4011274..4011473,
FT                   4012969..4013101))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141509"
FT                   /product="mCG141509, isoform CRA_a"
FT                   /note="gene_id=mCG141509.0 transcript_id=mCT175736.0
FT                   protein_id=mCP98659.0 isoform=CRA_a"
FT                   /protein_id="EDL32080.1"
FT                   /translation="MSPIAQCRFVPLAEVLCCAIADMNAAQVMVTQQSLLEHLIKHYPG
FT                   IAVPSPDILYSTLGALIQERKIYHTGEGYFIVTPSTYFITNTPMQGNKSALLSNEGCSG
FT                   PTSGTYLDAEPGIY"
FT   gene            complement(4088693..4136984)
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /note="gene_id=mCG11327.2"
FT   mRNA            complement(join(4088693..4089587,4090028..4090233,
FT                   4091666..4091851,4092109..4092229,4095308..4095454,
FT                   4095698..4095777,4096504..4096615,4097860..4098099,
FT                   4101170..4101361,4104781..4104966,4108127..4108210,
FT                   4109011..4109221,4109954..4110120,4110629..4110742,
FT                   4111244..4111469,4115542..4115703,4116623..4116714,
FT                   4135563..4135671,4136839..4136984))
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   transcript variant mCT175733"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT175733.0 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(4088693..4089587,4090028..4090233,
FT                   4091666..4091851,4092109..4092229,4095308..4095454,
FT                   4095698..4095777,4096504..4096615,4101170..4101361,
FT                   4104781..4104966,4108127..4108210,4109011..4109221,
FT                   4109954..4110120,4110629..4110742,4111244..4111469,
FT                   4115542..4115703,4116623..4116752,4121255..4121447,
FT                   4121536..4121650,4125128..4125321,4127921..4127953,
FT                   4128570..4128614,4130118..4130281,4135550..4135671,
FT                   4136839..4136984))
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   transcript variant mCT175732"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT175732.0 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(4088693..4089587,4090028..4090233,
FT                   4091666..4091851,4092109..4092229,4095308..4095454,
FT                   4095698..4095777,4096504..4096615,4097860..4098099,
FT                   4101170..4101361,4104781..4104966,4108127..4108210,
FT                   4109011..4109221,4109954..4110120,4110629..4110742,
FT                   4111244..4111469,4115542..4115703,4116623..4116752,
FT                   4121255..4121447,4121536..4121650,4125128..4125321,
FT                   4127921..4127953,4128570..4128614,4130118..4130281,
FT                   4135550..4135671,4136839..4136984))
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   transcript variant mCT12040"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT12040.2 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(4088693..4089587,4090028..4090233,
FT                   4091666..4091851,4092109..4092229,4095308..4095454,
FT                   4095698..4095777,4096504..4096615,4097860..4098099,
FT                   4101170..4101361,4104781..4104966,4108127..4108210,
FT                   4109011..4109221,4109954..4110120,4110629..4110742,
FT                   4111244..4111469,4115542..4115703,4116623..4116752,
FT                   4121255..4121447,4121536..4121650,4125128..4125321,
FT                   4127921..4127953,4128570..4128614,4130118..4130281,
FT                   4135550..4135671,4136828..4136984))
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   transcript variant mCT175734"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT175734.0 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(4089528..4089587,4090028..4090233,
FT                   4091666..4091851,4092109..4092229,4095308..4095454,
FT                   4095698..4095777,4096504..4096615,4097860..4098099,
FT                   4101170..4101361,4104781..4104966,4108127..4108210,
FT                   4109011..4109221,4109954..4110120,4110629..4110742,
FT                   4111244..4111469,4115542..4115703,4116623..4116714,
FT                   4135563..4135622))
FT                   /codon_start=1
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT175733.0
FT                   protein_id=mCP98656.0 isoform=CRA_a"
FT                   /protein_id="EDL32075.1"
FT                   /translation="MAQFGGQKNPPWATQFTATAPQPARRLDPPSRFSGRNDRGDQVPN
FT                   RKDDRSRERDRERRRSRERSPQRKRSRERSPRRERERSPRRVRRVVPRYTVQFSKFSLD
FT                   CPSCDMMELRRRYQNLYIPSDFFDAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEK
FT                   NMAVLDPPDADHLYSAKVMLMASPSMEDLYHKSCALAEDPQDLRDGFQHPARLVKFLVG
FT                   MKGKDEAMAIGGHWSPSLDGPNPEKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIR
FT                   YHRPEETHKGRTVPAHVETVVLFFPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKKA
FT                   DGEQDEEEKDDGEVKEIATPTHWSKLDPKAMKVNDLRKELESRALSSKGLKSQLIARLT
FT                   KQLKIEEQKEEQKELEKSEKEEEDEDDKKSEDDKEEEERKRQEEVERQRQERRYILPDE
FT                   PAIIVHPNWAAKSGKFDCSIMSLSVLLDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVR
FT                   IYKSLLSLPEKEDKKDKEKKSKKEERKDKKEEREDDIDEPKPKRRKSGDDKDKKEDRDE
FT                   RKKEEKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEDDDREEEEVKRDDKRDVSRYCK
FT                   DRPAKDKEKEKPQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLHLSRAQVKK
FT                   LLNKVVLRESCFYRKLTDTSKDDENHEESEALQEDMLGNRLLLPTPTIKQESKDGEENV
FT                   GLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDGKTILNLENSNKSLSG
FT                   ELREVKKDLGQLQENLEVSENMNLQFENQLNKTLRNLSTVMDDIHTVLKKDNVKSEDRD
FT                   EKSKENGSGV"
FT   CDS             complement(join(4089528..4089587,4090028..4090233,
FT                   4091666..4091851,4092109..4092229,4095308..4095454,
FT                   4095698..4095777,4096504..4096615,4101170..4101361,
FT                   4104781..4104966,4108127..4108210,4109011..4109221,
FT                   4109954..4110120,4110629..4110742,4111244..4111469,
FT                   4115542..4115703,4116623..4116752,4121255..4121447,
FT                   4121536..4121650,4125128..4125321,4127921..4127953,
FT                   4128570..4128614,4130118..4130281,4135550..4135622))
FT                   /codon_start=1
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT175732.0
FT                   protein_id=mCP98655.0 isoform=CRA_d"
FT                   /protein_id="EDL32079.1"
FT                   /translation="MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQ
FT                   TALAAAGLTTQTPANYQLTQTAALQQQAAAVLQQQYSQPQQALYSVQQQLQQPQQTILT
FT                   QPAVALPTSLSLSTPQPAAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDE
FT                   DVFFQLGAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPTA
FT                   VIQPIVPQTTFGVQAQPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVR
FT                   IVSQPQPARRLDPPSRFSGRNDRGDQVPNRKDDRSRERDRERRRSRERSPQRKRSRERS
FT                   PRRERERSPRRVRRVVPRYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWV
FT                   DAFPLSRPFQLGNYCNFYVMHREVESLEKNMAVLDPPDADHLYSAKVMLMASPSMEDLY
FT                   HKSCALAEDPQDLRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPNPEKDPSVL
FT                   IKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHC
FT                   LPTRSEWETLSRGYKQQLVEKLQGERKKADGEQDEEEKDDGEVKEIATPTHWSKLDPKA
FT                   MKVNDLRKELESRALSSKGLKSQLIARLTKQLKIEEQKEEQKELEKSEKEEEDEDDKKS
FT                   EDDKEEEERKRQEEVERQRQERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYR
FT                   LEDNKEHSFEKEEKRKDDSKDDDETEEDNNQDEYDPMEAEEAEDEDDDREEEEVKRDDK
FT                   RDVSRYCKDRPAKDKEKEKPQMVTVNRDLLMAFVYFDQSHCGYLLEKDLEEILYTLGLH
FT                   LSRAQVKKLLNKVVLRESCFYRKLTDTSKDDENHEESEALQEDMLGNRLLLPTPTIKQE
FT                   SKDGEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVEQKLQLLEEKTDEDGKTILNLE
FT                   NSNKSLSGELREVKKDLGQLQENLEVSENMNLQFENQLNKTLRNLSTVMDDIHTVLKKD
FT                   NVKSEDRDEKSKENGSGV"
FT   CDS             complement(join(4089528..4089587,4090028..4090233,
FT                   4091666..4091851,4092109..4092229,4095308..4095454,
FT                   4095698..4095777,4096504..4096615,4097860..4098099,
FT                   4101170..4101361,4104781..4104966,4108127..4108210,
FT                   4109011..4109221,4109954..4110120,4110629..4110742,
FT                   4111244..4111469,4115542..4115703,4116623..4116752,
FT                   4121255..4121447,4121536..4121650,4125128..4125321,
FT                   4127921..4127953,4128570..4128614,4130118..4130281,
FT                   4135550..4135622))
FT                   /codon_start=1
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT175734.0
FT                   protein_id=mCP98654.0 isoform=CRA_b"
FT                   /protein_id="EDL32076.1"
FT                   /translation="MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQ
FT                   TALAAAGLTTQTPANYQLTQTAALQQQAAAVLQQQYSQPQQALYSVQQQLQQPQQTILT
FT                   QPAVALPTSLSLSTPQPAAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDE
FT                   DVFFQLGAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPTA
FT                   VIQPIVPQTTFGVQAQPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVR
FT                   IVSQPQPARRLDPPSRFSGRNDRGDQVPNRKDDRSRERDRERRRSRERSPQRKRSRERS
FT                   PRRERERSPRRVRRVVPRYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWV
FT                   DAFPLSRPFQLGNYCNFYVMHREVESLEKNMAVLDPPDADHLYSAKVMLMASPSMEDLY
FT                   HKSCALAEDPQDLRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPNPEKDPSVL
FT                   IKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHC
FT                   LPTRSEWETLSRGYKQQLVEKLQGERKKADGEQDEEEKDDGEVKEIATPTHWSKLDPKA
FT                   MKVNDLRKELESRALSSKGLKSQLIARLTKQLKIEEQKEEQKELEKSEKEEEDEDDKKS
FT                   EDDKEEEERKRQEEVERQRQERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYR
FT                   LEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLPEKEDKKDKEKKSKKEERKDKK
FT                   EEREDDIDEPKPKRRKSGDDKDKKEDRDERKKEEKRKDDSKDDDETEEDNNQDEYDPME
FT                   AEEAEDEDDDREEEEVKRDDKRDVSRYCKDRPAKDKEKEKPQMVTVNRDLLMAFVYFDQ
FT                   SHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVVLRESCFYRKLTDTSKDDENHEESE
FT                   ALQEDMLGNRLLLPTPTIKQESKDGEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVE
FT                   QKLQLLEEKTDEDGKTILNLENSNKSLSGELREVKKDLGQLQENLEVSENMNLQFENQL
FT                   NKTLRNLSTVMDDIHTVLKKDNVKSEDRDEKSKENGSGV"
FT   CDS             complement(join(4089528..4089587,4090028..4090233,
FT                   4091666..4091851,4092109..4092229,4095308..4095454,
FT                   4095698..4095777,4096504..4096615,4097860..4098099,
FT                   4101170..4101361,4104781..4104966,4108127..4108210,
FT                   4109011..4109221,4109954..4110120,4110629..4110742,
FT                   4111244..4111469,4115542..4115703,4116623..4116752,
FT                   4121255..4121447,4121536..4121650,4125128..4125321,
FT                   4127921..4127953,4128570..4128614,4130118..4130281,
FT                   4135550..4135622))
FT                   /codon_start=1
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT12040.2
FT                   protein_id=mCP1445.2 isoform=CRA_b"
FT                   /protein_id="EDL32078.1"
FT                   /translation="MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQ
FT                   TALAAAGLTTQTPANYQLTQTAALQQQAAAVLQQQYSQPQQALYSVQQQLQQPQQTILT
FT                   QPAVALPTSLSLSTPQPAAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDE
FT                   DVFFQLGAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQPLLKTPTA
FT                   VIQPIVPQTTFGVQAQPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAGLLQPPVR
FT                   IVSQPQPARRLDPPSRFSGRNDRGDQVPNRKDDRSRERDRERRRSRERSPQRKRSRERS
FT                   PRRERERSPRRVRRVVPRYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFFDAQFTWV
FT                   DAFPLSRPFQLGNYCNFYVMHREVESLEKNMAVLDPPDADHLYSAKVMLMASPSMEDLY
FT                   HKSCALAEDPQDLRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPNPEKDPSVL
FT                   IKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAHVETVVLFFPDVWHC
FT                   LPTRSEWETLSRGYKQQLVEKLQGERKKADGEQDEEEKDDGEVKEIATPTHWSKLDPKA
FT                   MKVNDLRKELESRALSSKGLKSQLIARLTKQLKIEEQKEEQKELEKSEKEEEDEDDKKS
FT                   EDDKEEEERKRQEEVERQRQERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVLLDYR
FT                   LEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLPEKEDKKDKEKKSKKEERKDKK
FT                   EEREDDIDEPKPKRRKSGDDKDKKEDRDERKKEEKRKDDSKDDDETEEDNNQDEYDPME
FT                   AEEAEDEDDDREEEEVKRDDKRDVSRYCKDRPAKDKEKEKPQMVTVNRDLLMAFVYFDQ
FT                   SHCGYLLEKDLEEILYTLGLHLSRAQVKKLLNKVVLRESCFYRKLTDTSKDDENHEESE
FT                   ALQEDMLGNRLLLPTPTIKQESKDGEENVGLIVYNGAMVDVGSLLQKLEKSEKVRAEVE
FT                   QKLQLLEEKTDEDGKTILNLENSNKSLSGELREVKKDLGQLQENLEVSENMNLQFENQL
FT                   NKTLRNLSTVMDDIHTVLKKDNVKSEDRDEKSKENGSGV"
FT   mRNA            complement(join(<4098004..4098099,4101170..4101361,
FT                   4108127..4108210,4109011..4109221,4109954..4110120,
FT                   4110629..4110742,4111244..4111469,4115542..4115703,
FT                   4116623..4116752,4121255..4121447,4121536..4121650,
FT                   4125128..4125321,4127921..4127953,4128570..4128614,
FT                   4130118..4130281,4135550..4135671,4136839..>4136869))
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   transcript variant mCT192928"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT192928.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<4098004..4098099,4101170..4101361,
FT                   4108127..4108210,4109011..4109221,4109954..4110120,
FT                   4110629..4110742,4111244..4111469,4115542..4115703,
FT                   4116623..4116752,4121255..4121447,4121536..4121650,
FT                   4125128..4125321,4127921..4127953,4128570..4128614,
FT                   4130118..4130281,4135550..>4135643))
FT                   /codon_start=1
FT                   /gene="Ccar1"
FT                   /locus_tag="mCG_11327"
FT                   /product="cell division cycle and apoptosis regulator 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG11327.2 transcript_id=mCT192928.0
FT                   protein_id=mCP113941.0 isoform=CRA_c"
FT                   /protein_id="EDL32077.1"
FT                   /translation="KFSPPCIMAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGAS
FT                   PTIYTQQTALAAAGLTTQTPANYQLTQTAALQQQAAAVLQQQYSQPQQALYSVQQQLQQ
FT                   PQQTILTQPAVALPTSLSLSTPQPAAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHD
FT                   TFGFVDEDVFFQLGAVKGKTPQVGDRVLVEATYNPNMPFKWNAQRIQTLPNQNQSQTQP
FT                   LLKTPTAVIQPIVPQTTFGVQAQPQPQSLLQAQISAASITPLLQTQPQPLLQQPQQKAG
FT                   LLQPPVRIVSQPQPARRLDPPSRFSGRNDRGDQVPNRKDDRSRERDRERRRSRERSPQR
FT                   KRSRERSPRRERERSPRRVRRVVPRYTVQFSKFSLDCPSCDMMELRRRYQNLYIPSDFF
FT                   DAQFTWVDAFPLSRPFQLGNYCNFYVMHREVESLEKNMAVLDPPDADHLYSAKVMLMAS
FT                   PSMEDLYHKSCALAEDPQDLRDGFQHPARLVKFLVGMKGKDEAMAIGGHWSPSLDGPNP
FT                   EKDPSVLIKTAIRCCKALTGIDLSVCTQWYRFAEIRYHRPEETHKGRTVPAHVETVVLF
FT                   FPDVWHCLPTRSEWETLSRGYKQQLVEKLQGERKKADGEQDEEEKDDGEVKEIATPTHW
FT                   SKLDPKAMKEEERKRQEEVERQRQERRYILPDEPAIIVHPNWAAKSGKFDCSIMSLSVL
FT                   LDYRLEDNKEHSFEVSLFAELFNEMLQRDFGVRIYKSLLSLPEKED"
FT   gene            complement(4156532..>4178266)
FT                   /locus_tag="mCG_11334"
FT                   /note="gene_id=mCG11334.2"
FT   mRNA            complement(join(4156532..4158083,4158249..4158495,
FT                   4159107..4159244,4161055..4161144,4164144..4164294,
FT                   4167198..4167409,4177543..4177636,4178187..>4178266))
FT                   /locus_tag="mCG_11334"
FT                   /product="mCG11334"
FT                   /note="gene_id=mCG11334.2 transcript_id=mCT12048.2 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(4157203..4158083,4158249..4158495,
FT                   4159107..4159244,4161055..4161144,4164144..4164294,
FT                   4167198..4167409,4177543..4177636,4178187..>4178266))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11334"
FT                   /product="mCG11334"
FT                   /note="gene_id=mCG11334.2 transcript_id=mCT12048.2
FT                   protein_id=mCP1483.2"
FT                   /protein_id="EDL32074.1"
FT                   /translation="QKEKGPYYTHLGAGPSVAAVRELMETRFGQKGKAIRIEKIVFTGK
FT                   EGKSSQGCPVAKWVIRRSGPEEKLICLVRERVDHHCSTAVIVVLILLWEGIPRLMADRL
FT                   YKELTENLRSYSGHPTDRRCTLNKKRTCTCQGIDPKTCGASFSFGCSWSMYFNGCKFGR
FT                   SENPRKFRLAPNYPLHEKQLEKNLQELATVLAPLYKQMAPVAYQNQVEYEEVAGDCRLG
FT                   NEEGRPFSGVTCCMDFCAHSHKDIHNMHNGSTVVCTLIRADGRDTNCPEDEQLHVLPLY
FT                   RLADTDEFGSVEGMKAKIKSGAIQVNGPTRKRRLRFTEPVPRCGKRAKMKQNHNKSGSH
FT                   NTKSFSSASSTSHLVKDESTDFCPLQASSAETSTCTYSKTASGGFAETSSILHCTMPSG
FT                   AHSGANAAAGECTGTVQPAEVAAHPHQSLPTADSPVHAEPLTSPSEQLTSNQSNQQLPL
FT                   LSNSQKLASCQVEDERHPEADEPQHPEDDNLPQLDEFWSDSEEIYADPSFGGVAIAPIH
FT                   GSVLIECARKELHATTSLRSPKRGVPFRVSLVFYQHKSLNKPNHGFDINKIKCKCKKVT
FT                   KKKPADRECPDVSPEANLSHQIPSRVASTLTRDNVVTVSPYSLTHVAGPYNRWV"
FT   gene            complement(<4198486..>4200866)
FT                   /locus_tag="mCG_1044333"
FT                   /note="gene_id=mCG1044333.1"
FT   mRNA            complement(join(<4198486..4198639,4200348..>4200866))
FT                   /locus_tag="mCG_1044333"
FT                   /product="mCG1044333"
FT                   /note="gene_id=mCG1044333.1 transcript_id=mCT162037.1
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(<4198486..4198639,4200348..>4200494))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044333"
FT                   /product="mCG1044333"
FT                   /note="gene_id=mCG1044333.1 transcript_id=mCT162037.1
FT                   protein_id=mCP55135.1"
FT                   /protein_id="EDL32073.1"
FT                   /translation="TISLSSFFLHSELPATLAKVANGMNRRCNSGRETGYCSFGVFVFV
FT                   FVFLCEFQDSKGYTEKPWLRKKERKKERKKERKKGRKEGRKEGRKEGRKEEKKRP"
FT   gene            4265263..4291121
FT                   /gene="Slc25a16"
FT                   /locus_tag="mCG_11328"
FT                   /note="gene_id=mCG11328.2"
FT   mRNA            join(4265263..4265483,4272903..4272995,4274910..4275043,
FT                   4277326..4277389,4282026..4282147,4282546..4282613,
FT                   4285661..4285823,4287270..4287338,4288934..4291121)
FT                   /gene="Slc25a16"
FT                   /locus_tag="mCG_11328"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   Graves disease autoantigen), member 16, transcript variant
FT                   mCT12042"
FT                   /note="gene_id=mCG11328.2 transcript_id=mCT12042.2 created
FT                   on 12-NOV-2002"
FT   mRNA            join(4265263..4265483,4272903..4272995,4274910..4275043,
FT                   4282026..4282147,4282546..4282613,4285661..4285823,
FT                   4287270..4287338,4288934..4291121)
FT                   /gene="Slc25a16"
FT                   /locus_tag="mCG_11328"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   Graves disease autoantigen), member 16, transcript variant
FT                   mCT175735"
FT                   /note="gene_id=mCG11328.2 transcript_id=mCT175735.0 created
FT                   on 12-NOV-2002"
FT   CDS             join(4265354..4265483,4272903..4272995,4274910..4275043,
FT                   4277326..4277389,4282026..4282147,4282546..4282613,
FT                   4285661..4285823,4287270..4287281)
FT                   /codon_start=1
FT                   /gene="Slc25a16"
FT                   /locus_tag="mCG_11328"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   Graves disease autoantigen), member 16, isoform CRA_a"
FT                   /note="gene_id=mCG11328.2 transcript_id=mCT12042.2
FT                   protein_id=mCP1480.2 isoform=CRA_a"
FT                   /protein_id="EDL32071.1"
FT                   /translation="MAALVAAAALAAAEPAPAVPQAAGSGGPTSRRDFYWLRSFLAGGI
FT                   AGCCAKTTVAPLDRVKVLLQAHNRHYKHLGVLSTLRAVPQKEGYLGLYKGNGAMMIRIF
FT                   PYGAIQFMAFEHYKTFITTKLGVSGHVHRLMAGSMAGMTAVICTYPLDVVRVRLAFQVK
FT                   GEHTYSGIIHAFKTIYAKEGGFPWILPRSDAYYIRNGSICRCLLFYLWYLEECWAFLCS
FT                   CPAWPTFVRQPQCLSFENSHKPPLWWCCWSNSTDDILPI"
FT   CDS             join(4265354..4265483,4272903..4272995,4274910..4275043,
FT                   4282026..4282031)
FT                   /codon_start=1
FT                   /gene="Slc25a16"
FT                   /locus_tag="mCG_11328"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   Graves disease autoantigen), member 16, isoform CRA_b"
FT                   /note="gene_id=mCG11328.2 transcript_id=mCT175735.0
FT                   protein_id=mCP98657.0 isoform=CRA_b"
FT                   /protein_id="EDL32072.1"
FT                   /translation="MAALVAAAALAAAEPAPAVPQAAGSGGPTSRRDFYWLRSFLAGGI
FT                   AGCCAKTTVAPLDRVKVLLQAHNRHYKHLGVLSTLRAVPQKEGYLGLYKGNGAMMIRIF
FT                   PYGAIQFMAFEHYKTA"
FT   gene            4291670..4318794
FT                   /gene="Dna2l"
FT                   /locus_tag="mCG_11337"
FT                   /note="gene_id=mCG11337.2"
FT   mRNA            join(4291670..4291788,4293804..4293986,4295356..4295539,
FT                   4298805..4298950,4299935..4300066,4301551..4301770,
FT                   4302674..4302791,4303517..4303679,4303796..4303990,
FT                   4305017..4305055,4306036..4306152,4306229..4306338,
FT                   4307011..4307120,4308420..4308644,4309516..4309709,
FT                   4311033..4311122,4311216..4311420,4312269..4312358,
FT                   4314392..4314574,4316460..4316606,4317867..4318794)
FT                   /gene="Dna2l"
FT                   /locus_tag="mCG_11337"
FT                   /product="DNA2 DNA replication helicase 2-like (yeast)"
FT                   /note="gene_id=mCG11337.2 transcript_id=mCT12051.2 created
FT                   on 12-NOV-2002"
FT   CDS             join(4291712..4291788,4293804..4293986,4295356..4295539,
FT                   4298805..4298950,4299935..4300066,4301551..4301770,
FT                   4302674..4302791,4303517..4303679,4303796..4303990,
FT                   4305017..4305055,4306036..4306152,4306229..4306338,
FT                   4307011..4307120,4308420..4308644,4309516..4309709,
FT                   4311033..4311122,4311216..4311420,4312269..4312358,
FT                   4314392..4314574,4316460..4316606,4317867..4317935)
FT                   /codon_start=1
FT                   /gene="Dna2l"
FT                   /locus_tag="mCG_11337"
FT                   /product="DNA2 DNA replication helicase 2-like (yeast)"
FT                   /note="gene_id=mCG11337.2 transcript_id=mCT12051.2
FT                   protein_id=mCP1510.2"
FT                   /protein_id="EDL32070.1"
FT                   /translation="MEPLDELDLLLLEEDGGAEAVPRVELLRKKADALFPETVLSRGVD
FT                   NRYLVLAVETSQNERGAEEKRLHVTASQDREHEVLCILRNGWSSVPVEPGDIVHLEGDC
FT                   TSEPWIIDDDFGYFILYPDMMISGTSVASSIRCLRRAVLSETFRGSDPATRQMLIGTIL
FT                   HEVFQKAISESFAPERLQELALQTLREVRHLKEMYRLNLSQDEILCEVEEYLPSFSKWA
FT                   EDFMRKGPSSEFPQMQLSLPSDGSNRSSPCNIEVVKSLDIEESIWSPRFGLKGKIDVTV
FT                   GVKIHRDCKMKYKVMPLELKTGKESNSIEHRSQVVLYTLLSQERREDPEAGWLLYLKTG
FT                   QMYPVPANHLDKRELLKLRNWLAASLLHRVSRAAPGEEARLSALPQIIEEEKTCKYCSQ
FT                   IGNCALYSRAVEEQGDDASIPEAMLSKIQEETRHLQLAHLKYFSLWCLMLTLESQSKDN
FT                   RKTHQSIWLTPASELKMNKAAVTCLLDRNLSTLPATTVFRLDREERHGDISTPLGNLSK
FT                   LMESTDPSKRLRELIIDFREPQFIAYLSSVLPHDAKDTVANILKGLNKPQRQAMKRVLL
FT                   SKDYTLIVGMPGTGKTTTICALVRILSACGFSVLLTSYTHSAVDNILLKLAKFKVGFLR
FT                   LGQSHKVHPDIQKFTEEEICRSRSIASLAHLEELYNSHPIVATTCMGINHPIFSRKTFD
FT                   FCIVDEASQISQPVCLGPLFFSRRFVLVGDHQQLPPLVVNREARALGMSESLFKRLERN
FT                   ESAVVQLTVQYRMNRKIMSLSNKLTYAGKLECGSDRVANAVLALPNLKDARLSLQLYAD
FT                   YSDSPWLAGVLEPDNPVCFLNTDKVPAPEQVENGGVSNVTEARLIVFLTSTFIKAGCSP
FT                   SDIGVIAPYRQQLRIISDLLARSSVGMVEVNTVDKYQGRDKSLILVSFVRSNEDGTLGE
FT                   LLKDWRRLNVALTRAKHKLILLGSVSSLKRFPPLGTLFDHLNAEQLILDLPSREHESLS
FT                   HILGDCQRD"
FT   gene            4325032..4356725
FT                   /gene="Rufy2"
FT                   /locus_tag="mCG_11320"
FT                   /note="gene_id=mCG11320.2"
FT   mRNA            join(4325032..4325142,4327481..4327654,4333933..4334050,
FT                   4335790..4335891,4337927..4338050,4338790..4338851,
FT                   4339554..4339619,4340159..4340228,4342697..4342798,
FT                   4342895..4343011,4345049..4345216,4346999..4347096,
FT                   4349473..4349592,4351441..4351570,4352490..4352584,
FT                   4354172..4354220,4356234..4356311,4356406..4356725)
FT                   /gene="Rufy2"
FT                   /locus_tag="mCG_11320"
FT                   /product="RUN and FYVE domain-containing 2"
FT                   /note="gene_id=mCG11320.2 transcript_id=mCT12035.2 created
FT                   on 12-NOV-2002"
FT   CDS             join(4325139..4325142,4327481..4327654,4333933..4334050,
FT                   4335790..4335891,4337927..4338050,4338790..4338851,
FT                   4339554..4339619,4340159..4340228,4342697..4342798,
FT                   4342895..4343011,4345049..4345216,4346999..4347096,
FT                   4349473..4349592,4351441..4351570,4352490..4352584,
FT                   4354172..4354220,4356234..4356311,4356406..4356549)
FT                   /codon_start=1
FT                   /gene="Rufy2"
FT                   /locus_tag="mCG_11320"
FT                   /product="RUN and FYVE domain-containing 2"
FT                   /note="gene_id=mCG11320.2 transcript_id=mCT12035.2
FT                   protein_id=mCP1494.2"
FT                   /db_xref="GOA:B2RQ36"
FT                   /db_xref="InterPro:IPR000306"
FT                   /db_xref="InterPro:IPR004012"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017455"
FT                   /db_xref="MGI:MGI:1917682"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQ36"
FT                   /protein_id="EDL32069.1"
FT                   /translation="MATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQ
FT                   FFVVMEHCLKHGLKGRKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLKTPLGR
FT                   ARAWLRLALMQKKMADYLRCLIIQRELLSEFYEYHALMMEEEGAVIVGLLVGLNVIDAN
FT                   LCVKGEDLDSQVGVIDFSMYLKNEEEIGNKERNVQIAAILDQKNYVEELNRQLNSTVSS
FT                   LHSRVDSLEKSNTKLIEELAIAKNNIIKLQEENHQLRSENELILMRTRQHLEVTKVDVE
FT                   TELQTYKHSRQGLDEMYNDARRQLRDESQLRQDVENELSVQVGMKHEMELAMKLLEKDI
FT                   HEKQDTLIGLRQQLEEVKAINIEMYQRLQGSEDGLKEKNEIIARLEEKTNKITTAMRQL
FT                   EQRLQQAEKAQKEAEAEDEKYAQECLSQSDSLQRQISQKEQQLVQLETDLKIEKEWRQT
FT                   LQEDLQKEKDVLSHLRHETQKVISLKKEFLNLQDENQQLKRIYQEQEQALQELGSKLCE
FT                   SKLKIDDIKEANKALQGLVWLKDKDATHCKLCEKEFSLSKRKHHCRNCGEIFCNACSDN
FT                   ELPLPSSPKPVRVCDSCHAMLIQRCSSNMP"
FT   gene            complement(4358359..4359263)
FT                   /locus_tag="mCG_1044331"
FT                   /note="gene_id=mCG1044331.1"
FT   mRNA            complement(join(4358359..4358905,4359102..4359263))
FT                   /locus_tag="mCG_1044331"
FT                   /product="mCG1044331"
FT                   /note="gene_id=mCG1044331.1 transcript_id=mCT162035.1
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(4358888..4358905,4359102..4359245))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044331"
FT                   /product="mCG1044331"
FT                   /note="gene_id=mCG1044331.1 transcript_id=mCT162035.1
FT                   protein_id=mCP55128.1"
FT                   /protein_id="EDL32068.1"
FT                   /translation="MGLTWCLHTSHRSHKHFKLLTSQSRWLKSTSVGRVVKSTCCGLER
FT                   CSAVISLA"
FT   gene            complement(4359571..4364337)
FT                   /locus_tag="mCG_11326"
FT                   /note="gene_id=mCG11326.2"
FT   mRNA            complement(join(4359571..4360524,4360612..4360704,
FT                   4360890..4360985,4361217..4361352,4362032..4362147,
FT                   4362334..4362420,4362851..4363035,4363570..4363708,
FT                   4364203..4364337))
FT                   /locus_tag="mCG_11326"
FT                   /product="mCG11326, transcript variant mCT12041"
FT                   /note="gene_id=mCG11326.2 transcript_id=mCT12041.2 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(4359571..4360524,4360612..4360704,
FT                   4360890..4360985,4361217..4361352,4362032..4362147,
FT                   4362334..4362420,4362896..4363035,4363570..4363708,
FT                   4364203..4364335))
FT                   /locus_tag="mCG_11326"
FT                   /product="mCG11326, transcript variant mCT175729"
FT                   /note="gene_id=mCG11326.2 transcript_id=mCT175729.0 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(4359571..4360524,4360612..4360704,
FT                   4360890..4360985,4361217..4361352,4362334..4362420,
FT                   4362851..4363035,4363570..4363708,4364203..4364335))
FT                   /locus_tag="mCG_11326"
FT                   /product="mCG11326, transcript variant mCT175730"
FT                   /note="gene_id=mCG11326.2 transcript_id=mCT175730.0 created
FT                   on 12-NOV-2002"
FT   mRNA            complement(join(4359571..4360524,4360612..4360704,
FT                   4361217..4361352,4362032..4362147,4362334..4362420,
FT                   4362851..4363035,4363570..4363708,4364203..4364335))
FT                   /locus_tag="mCG_11326"
FT                   /product="mCG11326, transcript variant mCT175731"
FT                   /note="gene_id=mCG11326.2 transcript_id=mCT175731.0 created
FT                   on 12-NOV-2002"
FT   CDS             complement(join(4360448..4360524,4360612..4360704,
FT                   4360890..4360985,4361217..4361352,4362032..4362147,
FT                   4362334..4362420,4362896..4363035,4363570..4363708,
FT                   4364203..4364314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11326"
FT                   /product="mCG11326, isoform CRA_b"
FT                   /note="gene_id=mCG11326.2 transcript_id=mCT175729.0
FT                   protein_id=mCP98653.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3YWT1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1926462"
FT                   /db_xref="UniProtKB/TrEMBL:D3YWT1"
FT                   /protein_id="EDL32065.1"
FT                   /translation="MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNG
FT                   ITLTMDYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPR
FT                   RLLGQRPGPYDRPIGGRGGYYGAGRGSYGGFDDYGGYNNYGYGNDGFDDRMRDGRGMGG
FT                   HGYGGAGDASSGFHGGHFVHMRGLPFRATENDIANFFSPLNPIRVHIDIGADGRATGEA
FT                   DVEFVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGSGMGGYGRDGMDNQGGY
FT                   GSVGRMGMGNSYSGGYGAPDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY"
FT   CDS             complement(join(4360448..4360524,4360612..4360704,
FT                   4361217..4361352,4362032..4362147,4362334..4362420,
FT                   4362851..4363035,4363570..4363708,4364203..4364314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11326"
FT                   /product="mCG11326, isoform CRA_c"
FT                   /note="gene_id=mCG11326.2 transcript_id=mCT175731.0
FT                   protein_id=mCP98651.0 isoform=CRA_c"
FT                   /protein_id="EDL32066.1"
FT                   /translation="MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNG
FT                   ITLTMDYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPR
FT                   RLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGGDGYDGGYGGFDDYGGYNNYGYGN
FT                   DGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVHMRGLPFRATENDIANFFSPLNPIR
FT                   VHIDIGADGRATGEADVEFVTHEDAVAAMSKDKNNMHNQGGYGSVGRMGMGNSYSGGYG
FT                   APDGLGGYGRGGGGSGGYYGQGGMSGGGWRGMY"
FT   CDS             complement(join(4360448..4360524,4360612..4360704,
FT                   4360890..4360985,4361217..4361352,4362032..4362147,
FT                   4362334..4362420,4362851..4363035,4363570..4363708,
FT                   4364203..4364314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11326"
FT                   /product="mCG11326, isoform CRA_a"
FT                   /note="gene_id=mCG11326.2 transcript_id=mCT12041.2
FT                   protein_id=mCP1455.2 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z3N4"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1926462"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3N4"
FT                   /protein_id="EDL32064.1"
FT                   /translation="MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNG
FT                   ITLTMDYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPR
FT                   RLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGGDGYDGGYGGFDDYGGYNNYGYGN
FT                   DGFDDRMRDGRGMGGHGYGGAGDASSGFHGGHFVHMRGLPFRATENDIANFFSPLNPIR
FT                   VHIDIGADGRATGEADVEFVTHEDAVAAMSKDKNNMQHRYIELFLNSTPGGGSGMGGSG
FT                   MGGYGRDGMDNQGGYGSVGRMGMGNSYSGGYGAPDGLGGYGRGGGGSGGYYGQGGMSGG
FT                   GWRGMY"
FT   CDS             complement(join(4361315..4361352,4362334..4362420,
FT                   4362851..4363035,4363570..4363708,4364203..4364314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11326"
FT                   /product="mCG11326, isoform CRA_d"
FT                   /note="gene_id=mCG11326.2 transcript_id=mCT175730.0
FT                   protein_id=mCP98652.0 isoform=CRA_d"
FT                   /protein_id="EDL32067.1"
FT                   /translation="MDWVMKHNGPNDASDGTVRLRGLPFGCSKEEIVQFFQGLEIVPNG
FT                   ITLTMDYQGRSTGEAFVQFASKEIAENALGKHKERIGHRYIEIFRSSRSEIKGFYDPPR
FT                   RLLGQRPGPYDRPIGGRGGYYGAGRGSMYDRMRRGGDGYDGGYGGFDDYGGYNNYGYGN
FT                   DGFDDRMRDGRVLLTAQSNTCSY"
FT   gene            4368853..4403822
FT                   /locus_tag="mCG_11316"
FT                   /note="gene_id=mCG11316.2"
FT   mRNA            join(4368853..4369546,4383899..4384042,4392431..4392530,
FT                   4392907..4393005,4397166..4397275,4397394..4397423,
FT                   4398874..4398962,4399337..4399515,4401789..4401851,
FT                   4402651..4403822)
FT                   /locus_tag="mCG_11316"
FT                   /product="mCG11316, transcript variant mCT12030"
FT                   /note="gene_id=mCG11316.2 transcript_id=mCT12030.1 created
FT                   on 26-SEP-2002"
FT   mRNA            join(4368853..4369275,4383899..4384042,4392431..4392530,
FT                   4392907..4393005,4397166..4397275,4397394..4397423,
FT                   4398874..4398962,4399337..4399515,4401789..4401851,
FT                   4402651..4403822)
FT                   /locus_tag="mCG_11316"
FT                   /product="mCG11316, transcript variant mCT173588"
FT                   /note="gene_id=mCG11316.2 transcript_id=mCT173588.0 created
FT                   on 26-SEP-2002"
FT   CDS             join(4369153..4369275,4383899..4384042,4392431..4392530,
FT                   4392907..4393005,4397166..4397275,4397394..4397423,
FT                   4398874..4398962,4399337..4399515,4401789..4401851,
FT                   4402651..4402763)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11316"
FT                   /product="mCG11316, isoform CRA_a"
FT                   /note="gene_id=mCG11316.2 transcript_id=mCT173588.0
FT                   protein_id=mCP96507.0 isoform=CRA_a"
FT                   /protein_id="EDL32062.1"
FT                   /translation="MLRLRRYKASKPSRIPVLAWGIPFVPLRRQPWRLDWFPTCQLEVK
FT                   RAPSRAGSPQTEPARKMKLPIFIADAFTATAFRGNPAAVCLLERTLDEDAHQDIAREMN
FT                   LSETAFVRKLQPTDDFTQSSRFGLRWFTPEAEFPLCGHATLASAAVLFQKRKNTNSTLT
FT                   FVTMSGELKARREEDGIVLDFPVYPTFPQDFHEVEDLIKAAIGDTLVQDIRYSPDTKNL
FT                   LVRLSDSYDRSFLESLKVNTEPLPAIEKTGKVRGLILTVKGEPGGQTALYDFYSRCFAP
FT                   WVGVAEDPVTGSTHTLLGPYWSEELGKKEMRAFQCSRRGGELDINLRPDGRVDIKGGAV
FT                   IVLEGTLTA"
FT   CDS             join(4383959..4384042,4392431..4392530,4392907..4393005,
FT                   4397166..4397275,4397394..4397423,4398874..4398962,
FT                   4399337..4399515,4401789..4401851,4402651..4402763)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11316"
FT                   /product="mCG11316, isoform CRA_b"
FT                   /note="gene_id=mCG11316.2 transcript_id=mCT12030.1
FT                   protein_id=mCP1459.1 isoform=CRA_b"
FT                   /protein_id="EDL32063.1"
FT                   /translation="MKLPIFIADAFTATAFRGNPAAVCLLERTLDEDAHQDIAREMNLS
FT                   ETAFVRKLQPTDDFTQSSRFGLRWFTPEAEFPLCGHATLASAAVLFQKRKNTNSTLTFV
FT                   TMSGELKARREEDGIVLDFPVYPTFPQDFHEVEDLIKAAIGDTLVQDIRYSPDTKNLLV
FT                   RLSDSYDRSFLESLKVNTEPLPAIEKTGKVRGLILTVKGEPGGQTALYDFYSRCFAPWV
FT                   GVAEDPVTGSTHTLLGPYWSEELGKKEMRAFQCSRRGGELDINLRPDGRVDIKGGAVIV
FT                   LEGTLTA"
FT   gene            4405172..4422299
FT                   /locus_tag="mCG_123414"
FT                   /note="gene_id=mCG123414.1"
FT   mRNA            join(4405172..4405551,4405683..4405925,4406307..4406476,
FT                   4406568..4406711,4408868..4409139)
FT                   /locus_tag="mCG_123414"
FT                   /product="mCG123414, transcript variant mCT175739"
FT                   /note="gene_id=mCG123414.1 transcript_id=mCT175739.0
FT                   created on 12-NOV-2002"
FT   mRNA            join(4405172..4405551,4405683..4405925,4406568..4406711,
FT                   4408868..4409139)
FT                   /locus_tag="mCG_123414"
FT                   /product="mCG123414, transcript variant mCT175738"
FT                   /note="gene_id=mCG123414.1 transcript_id=mCT175738.0
FT                   created on 12-NOV-2002"
FT   CDS             join(4406441..4406476,4406568..4406711,4408868..4408897)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123414"
FT                   /product="mCG123414, isoform CRA_c"
FT                   /note="gene_id=mCG123414.1 transcript_id=mCT175739.0
FT                   protein_id=mCP98661.0 isoform=CRA_c"
FT                   /protein_id="EDL32061.1"
FT                   /translation="MLKLVRGLVSLKLEVKRAPSRAGSPQTKPARKMKLPIFIADAFTA
FT                   TAFRGNPAAVCLLERAPVTPASSQ"
FT   mRNA            join(4406599..4406711,4410793..4410892,4411534..4411632,
FT                   4412438..4412547,4412667..4412696,4415429..4415517,
FT                   4415891..4416069,4419083..4419145,4420371..4422299)
FT                   /locus_tag="mCG_123414"
FT                   /product="mCG123414, transcript variant mCT124646"
FT                   /note="gene_id=mCG123414.1 transcript_id=mCT124646.1
FT                   created on 12-NOV-2002"
FT   CDS             join(4406628..4406711,4410793..4410892,4411534..4411632,
FT                   4412438..4412547,4412667..4412696,4415429..4415517,
FT                   4415891..4416069,4419083..4419145,4420371..4420483)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123414"
FT                   /product="mCG123414, isoform CRA_a"
FT                   /note="gene_id=mCG123414.1 transcript_id=mCT124646.1
FT                   protein_id=mCP54969.1 isoform=CRA_a"
FT                   /protein_id="EDL32059.1"
FT                   /translation="MKLPIFIADAFTATAFRGNPAAVCLLERTLEEDAHQQIAREMNLS
FT                   ETAFIRKLQPTDSFTQSSRFGLRWFTPVSEVPLCGHATLASAAVLFHKIQNRNSTLTFV
FT                   TMSGELKARRAEDGIVLDFPVYPTFPQDFHEVEDLIKAAIGDTLVQDIRYSTDTRKLLV
FT                   RLSDSYDRSFLESLKVNTEPLPAIEKTGKVRGLILTVKGEPGGQTAPYDFYSRYFAPWV
FT                   GIAEDPVTGSAHTVLSSYWSQQLRKKEMRAFQCSRRGGELDISLRPDGRVDIKGGAVIV
FT                   LEGTLTA"
FT   CDS             4408897..4409091
FT                   /codon_start=1
FT                   /locus_tag="mCG_123414"
FT                   /product="mCG123414, isoform CRA_b"
FT                   /note="gene_id=mCG123414.1 transcript_id=mCT175738.0
FT                   protein_id=mCP98660.0 isoform=CRA_b"
FT                   /protein_id="EDL32060.1"
FT                   /translation="MSEWEIRESSGSLQSSQAGPHCVVAETTAALPCVSTVTRKLPSDL
FT                   CTCAYSLFPPSLSLNTYLI"
FT   gene            4443918..4445581
FT                   /locus_tag="mCG_11319"
FT                   /note="gene_id=mCG11319.2"
FT   mRNA            join(4443918..4444376,4444601..4445581)
FT                   /locus_tag="mCG_11319"
FT                   /product="mCG11319, transcript variant mCT12032"
FT                   /note="gene_id=mCG11319.2 transcript_id=mCT12032.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(4443918..4444376,4444601..4444841,4445041..4445581)
FT                   /locus_tag="mCG_11319"
FT                   /product="mCG11319, transcript variant mCT173589"
FT                   /note="gene_id=mCG11319.2 transcript_id=mCT173589.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(4444294..4444376,4444601..4444841,4445041..4445049)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11319"
FT                   /product="mCG11319, isoform CRA_b"
FT                   /note="gene_id=mCG11319.2 transcript_id=mCT173589.0
FT                   protein_id=mCP96508.0 isoform=CRA_b"
FT                   /protein_id="EDL32058.1"
FT                   /translation="MKSACKPHGPPAGARGAPPCAGAAERAVARERRRMQGLNTAFDRL
FT                   RRVVPQWGQDKKLSKYETLQMALSYIIALTRILAEAERDWVGLRCEQRGRDHPYLPFPG
FT                   ARLQVS"
FT   CDS             join(4444294..4444376,4444601..4444910)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11319"
FT                   /product="mCG11319, isoform CRA_a"
FT                   /note="gene_id=mCG11319.2 transcript_id=mCT12032.2
FT                   protein_id=mCP1489.1 isoform=CRA_a"
FT                   /protein_id="EDL32057.1"
FT                   /translation="MKSACKPHGPPAGARGAPPCAGAAERAVARERRRMQGLNTAFDRL
FT                   RRVVPQWGQDKKLSKYETLQMALSYIIALTRILAEAERDWVGLRCEQRGRDHPYLPFPG
FT                   ARLQVDPEPYGQRLFGFQPEPFPMAS"
FT   gene            complement(4459448..4547473)
FT                   /locus_tag="mCG_123411"
FT                   /note="gene_id=mCG123411.1"
FT   mRNA            complement(join(4459448..4460679,4462074..4462207,
FT                   4463682..4463847,4465555..4465762,4466924..4467050,
FT                   4469322..4469401,4471279..4471428,4474637..4474858,
FT                   4478587..4478725,4479362..4479949,4489512..4489884,
FT                   4491553..4491669,4496471..4496612,4505902..4505973,
FT                   4507193..4507304,4510989..4511040,4513011..4513186,
FT                   4536110..4537006,4547283..4547473))
FT                   /locus_tag="mCG_123411"
FT                   /product="mCG123411"
FT                   /note="gene_id=mCG123411.1 transcript_id=mCT124643.1
FT                   created on 12-NOV-2002"
FT   CDS             complement(join(4460510..4460679,4462074..4462207,
FT                   4463682..4463847,4465555..4465762,4466924..4467050,
FT                   4469322..4469401,4471279..4471428,4474637..4474858,
FT                   4478587..4478725,4479362..4479949,4489512..4489884,
FT                   4491553..4491669,4496471..4496612,4505902..4505973,
FT                   4507193..4507304,4510989..4511040,4513011..4513186,
FT                   4536110..4537005))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123411"
FT                   /product="mCG123411"
FT                   /note="gene_id=mCG123411.1 transcript_id=mCT124643.1
FT                   protein_id=mCP54996.0"
FT                   /protein_id="EDL32056.1"
FT                   /translation="MQEDSIEASTSISQLLRESYLAETRHRGDNERSRAEPSSNPFHFS
FT                   GPGAAEGGGPEDLPDLSAFLSQEELDESVNLARLAINHDPLERVDEAQARKRLSSDQTK
FT                   HASKPSFEPAFHQDSSRGPASPKDSPPETKRPQYSSETQSKKVFLNKAADFIEELSSLF
FT                   KAHSSKRIRPRACKNHKSKTESQNKVLQENSPTFSDLTERRERASVPIPIPADSRDNEL
FT                   NHAIEQREAKRREAELAAGEAAAGDSTPGSSPSSLYYEEPLGQPPRFTQKLRSREVPEG
FT                   SRVQLDCIVVGIPPPQVRWYCEGKELENSPDIHIVQAGNLHSLTIAEAFEEDTGRYSCF
FT                   ASNIYGTDSTSAEIYIEGVSSSDSEGDPNKEEMNRIQKPNEVSSPPTTSAAIPPAAEAQ
FT                   PLAAQPRVSTVQQCQSPTNYLQGLNGKPIIAAPVFTKMLQNLSASEGQLVVFECRVKGA
FT                   PSPKVEWYREGTLIEDSPDFRILQKKEICTLVIAEVFSEDSGCFTCTASNKYGTVSSIA
FT                   QLDVRGNEDISDNGALHSANSTTNPAVAEHQPSPLNPQPLSEEQPPKPKLEGVLVNHNE
FT                   PRSSSRIGLRVHFNLPEDDKDMEASSGSGAANTSQTRPNSFPERFNGQEARIPEPSSPI
FT                   KEPPPVLAKPKLDSTQLQQLHNQVLLEQQQLQNTSPSSPKESLHMSALNSAPPAVTISS
FT                   KQVKGPAPQMFNLARPKHFFPASSTSTATVSPSSSPVFTLSNTPQTIQRTVSKESLLMA
FT                   HPSTQGRSPGGLSIQNEPAPPSPAEPAAPPTAAYSIPSGNQFQPHCVSPTPVSPTGRIQ
FT                   NPVAFLSSVLPSLPSIPPTNAMGLPKSAPSVPSQGLMKKTTKAPQAVSDDYIRETKNSV
FT                   ILDLGKKVNFGDVRSHQQEYKISSFEQRLMNEIEFRLERTPVDESDDEIEHDEIPTGKC
FT                   IAPIFDKRLKHFRVTEGSPVTFTCKIVGIPVPKVYWFKDGKQISKRNEHCKMRREGDGT
FT                   CSLHIESTHGDDDGNYTIMAANPQGRISCSGHLMVQGLPIRSRLSPALSHRGRSRMQER
FT                   DKEPLQERFFRPHFLQAPGDMVAHEGRLCRLDCKVSGLPPPELTWLLNGQPVLPDASHK
FT                   MLVRETGVHSLLIDPLTQRDAGTYTCVATNKTGQNSFSLELTVVAKEVKKAPVILEKLQ
FT                   NSGVPEGHPVRLEGRVIGMPPPVFYWKKDNETIPFTRERISMHQDTTGYVCLLIQPAKK
FT                   SDAGWYTLSAKNEAGIVSCTARLDIYAQWHQQIPTPISIRPSGSRYGSLTSKGLDIFSA
FT                   FSSVESTMLYSCTSRSVVESDEL"
FT   gene            4587819..4661371
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /note="gene_id=mCG123412.1"
FT   mRNA            join(4587819..4588169,4589424..4589454,4589828..4590131,
FT                   4608045..4608204,4613647..4613723,4617442..4617663,
FT                   4618988..4619079,4622375..4622505,4627221..4627381,
FT                   4629692..4629768,4630057..4630181,4631550..4631609,
FT                   4631929..4632040,4633083..4633272,4634535..4634707,
FT                   4642613..4642732,4649841..4649939,4651235..4651402,
FT                   4651800..4651943,4654960..4655126,4655341..4655407,
FT                   4657980..4658062,4659153..4659336,4660193..4660295,
FT                   4660773..4661371)
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, transcript variant
FT                   mCT124644"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT124644.1
FT                   created on 12-NOV-2002"
FT   mRNA            join(4587819..4588169,4589424..4589454,4589828..4590131,
FT                   4608045..4608204,4613647..4613723,4617442..4617663,
FT                   4618988..4619079,4622375..4622505,4627221..4627381,
FT                   4629692..4629768,4630057..4630181,4631550..4631609,
FT                   4631929..4632040,4633083..4633272,4642613..4642732,
FT                   4649841..4649939,4651235..4651402,4651800..4651943,
FT                   4654960..4655126,4655341..4655407,4657980..4658062,
FT                   4659153..4659336,4660193..4660295,4660773..4661371)
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, transcript variant
FT                   mCT176011"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT176011.0
FT                   created on 12-NOV-2002"
FT   mRNA            join(4587819..4588169,4589424..4589454,4589828..4590131,
FT                   4608045..4608204,4613647..4613723,4617442..4617663,
FT                   4618988..4619079,4622375..4622505,4627221..4627381,
FT                   4629692..4629768,4630057..4630181,4631550..4631609,
FT                   4631929..4632040,4642613..4642732,4649841..4649939,
FT                   4651235..4651402,4651800..4651943,4654960..4655126,
FT                   4655341..4655407,4657980..4658062,4659153..4659336,
FT                   4660193..4660295,4660773..4661371)
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, transcript variant
FT                   mCT176010"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT176010.0
FT                   created on 12-NOV-2002"
FT   mRNA            join(4587819..4588169,4589424..4589454,4589828..4590131,
FT                   4608045..4608204,4613647..4613723,4617442..4618424)
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, transcript variant
FT                   mCT176009"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT176009.0
FT                   created on 12-NOV-2002"
FT   mRNA            join(<4589845..4590131,4608045..4608204,4613647..4613723,
FT                   4617442..4617663,4618988..4619079,4622375..4622505,
FT                   4627221..4627381,4629692..4629768,4630057..4630181,
FT                   4631550..4631609,4631929..4632040,4633083..4633272,
FT                   4634535..4634707,4642613..4642732,4647338..4647361,
FT                   4649841..4649939,4651235..4651402,4651800..4651943,
FT                   4654960..4655126,4655341..4655407,4657980..4658062,
FT                   4659153..4659336,4660193..4660295,4660773..4661249)
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, transcript variant
FT                   mCT192974"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT192974.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<4589879..4590131,4608045..4608204,4613647..4613723,
FT                   4617442..4617663,4618988..4619079,4622375..4622505,
FT                   4627221..4627381,4629692..4629768,4630057..4630181,
FT                   4631550..4631609,4631929..4632040,4633083..4633272,
FT                   4634535..4634707,4642613..4642732,4647338..4647361,
FT                   4649841..4649939,4651235..4651402,4651800..4651943,
FT                   4654960..4655126,4655341..4655407,4657980..4658062,
FT                   4659153..4659336,4660193..4660295,4660773..4660981)
FT                   /codon_start=1
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, isoform CRA_b"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT192974.0
FT                   protein_id=mCP113970.0 isoform=CRA_b"
FT                   /protein_id="EDL32052.1"
FT                   /translation="NWKTKVIPSMLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVNKKV
FT                   RDVGCGLRHTVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALDAQNIVAVACGEAH
FT                   TLALNDKGQVYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSK
FT                   ASEVFCWGQNKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFG
FT                   WGRNKFGQLGLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYG
FT                   QLGHNSTSHEINPRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGS
FT                   TSNRKSPFTVKGNWFSYNGQCPQDIGSEDYFCVKRIFSGGDQSFSHYSSPQNCGPPDDF
FT                   RCSDPSKQIWTVNEALIQKWLSYPSGRFPVEIANEIDGTFSSSGCLNGSFLAISNDDHY
FT                   RTGTRFSGVDMNAARLLFHKLIQPDHPQISQQVAASLEKNLIPKLTSSLPDVEALRFYL
FT                   TLPECPLMSDCNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLKIVELFKEVV
FT                   VHLLKLYKIGIPPSERRIFNSFLHTALKVLEILHRVNEKTGQLIQYDKFYIHEVQELID
FT                   IRNDYINWVQQQAYGVDVSHGVTELADIPVTICTYPFVFDAQAKTTLLQTDAVLQMQMA
FT                   IDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIFVG
FT                   EDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICG
FT                   LAIYNFTIVDLHFPLALYKKLLKRKPSLDDLKELMPAVGRSMQQLLDYPEDDIEETFCL
FT                   NFTITVENFGATEVKELVLNGADTAVNRQNRQEFVDAYVDYIFNKSVASLFDAFHAGFH
FT                   KVCGGKVLLLFQPNELQAMVIGNTNYDWKELEKNTEYKGEYWADHPTIKIFWEVFHELP
FT                   LEKKKQFLLFLTGSDRIPILGMKSLKLVIQSTGGGESYLPVSHTCFNLLDLPKYTEKET
FT                   LRCKLIQAIDHNEGFSLI"
FT   CDS             join(4589906..4590131,4608045..4608204,4613647..4613723,
FT                   4617442..4617663,4618988..4619079,4622375..4622505,
FT                   4627221..4627381,4629692..4629768,4630057..4630181,
FT                   4631550..4631609,4631929..4632040,4633083..4633272,
FT                   4634535..4634707,4642613..4642732,4649841..4649939,
FT                   4651235..4651402,4651800..4651943,4654960..4655126,
FT                   4655341..4655407,4657980..4658062,4659153..4659336,
FT                   4660193..4660295,4660773..4660981)
FT                   /codon_start=1
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, isoform CRA_c"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT124644.1
FT                   protein_id=mCP55026.1 isoform=CRA_c"
FT                   /protein_id="EDL32053.1"
FT                   /translation="MLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVNKKVRDVGCGLRH
FT                   TVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALDAQNIVAVACGEAHTLALNDKGQ
FT                   VYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQ
FT                   NKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQL
FT                   GLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSH
FT                   EINPRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFT
FT                   VKGNWFSYNGQCPQDIGSEDYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCSDPSKQI
FT                   WTVNEALIQKWLSYPSGRFPVEIANEIDGTFSSSGCLNGSFLAISNDDHYRTGTRFSGV
FT                   DMNAARLLFHKLIQPDHPQISQQVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMS
FT                   DCNNFTTIAIPFGTALVNLEKAPLKVLENWWSVLEPPLFLKIVELFKEVVVHLLKLYKI
FT                   GIPPSERRIFNSFLHTALKVLEILHRVNEKTGQLIQYDKFYIHEVQELIDIRNDYINWV
FT                   QQQAYGVLADIPVTICTYPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVI
FT                   ESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLI
FT                   MRELLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICGLAIYNFTIVDLHFPLAL
FT                   YKKLLKRKPSLDDLKELMPAVGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKEL
FT                   VLNGADTAVNRQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQ
FT                   AMVIGNTNYDWKELEKNTEYKGEYWADHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRI
FT                   PILGMKSLKLVIQSTGGGESYLPVSHTCFNLLDLPKYTEKETLRCKLIQAIDHNEGFSL
FT                   I"
FT   CDS             join(4589906..4590131,4608045..4608204,4613647..4613723,
FT                   4617442..4617663,4618988..4619079,4622375..4622505,
FT                   4627221..4627381,4629692..4629768,4630057..4630181,
FT                   4631550..4631609,4631929..4632040,4642613..4642732,
FT                   4649841..4649939,4651235..4651402,4651800..4651943,
FT                   4654960..4655126,4655341..4655407,4657980..4658062,
FT                   4659153..4659336,4660193..4660295,4660773..4660981)
FT                   /codon_start=1
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, isoform CRA_e"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT176010.0
FT                   protein_id=mCP98931.0 isoform=CRA_e"
FT                   /protein_id="EDL32055.1"
FT                   /translation="MLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVNKKVRDVGCGLRH
FT                   TVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALDAQNIVAVACGEAHTLALNDKGQ
FT                   VYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQ
FT                   NKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQL
FT                   GLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSH
FT                   EINPRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFT
FT                   VKGNWFSYNGQCPQDIGSEDYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCSDPSKQI
FT                   WTVNEALIQKWLSYPSGRFPVEIANEIDGTFSSSGCLNGSFLAISNDDHYRTGTRFSGV
FT                   DMNAARLLFHKLIQPDHPQISQQVNEKTGQLIQYDKFYIHEVQELIDIRNDYINWVQQQ
FT                   AYGVLADIPVTICTYPFVFDAQAKTTLLQTDAVLQMQMAIDQAHRQNVSSLFLPVIESV
FT                   NPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIFVGEDAVDAGGVRKEFFLLIMRE
FT                   LLDPKYGMFRYYEDSRLIWFSDKTFEDSDLFHLIGVICGLAIYNFTIVDLHFPLALYKK
FT                   LLKRKPSLDDLKELMPAVGRSMQQLLDYPEDDIEETFCLNFTITVENFGATEVKELVLN
FT                   GADTAVNRQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQPNELQAMV
FT                   IGNTNYDWKELEKNTEYKGEYWADHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPIL
FT                   GMKSLKLVIQSTGGGESYLPVSHTCFNLLDLPKYTEKETLRCKLIQAIDHNEGFSLI"
FT   CDS             join(4589906..4590131,4608045..4608204,4613647..4613723,
FT                   4617442..4617663,4618988..4619079,4622375..4622505,
FT                   4627221..4627381,4629692..4629768,4630057..4630181,
FT                   4631550..4631609,4631929..4632040,4633083..4633272,
FT                   4642613..4642620)
FT                   /codon_start=1
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, isoform CRA_a"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT176011.0
FT                   protein_id=mCP98932.0 isoform=CRA_a"
FT                   /protein_id="EDL32051.1"
FT                   /translation="MLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVNKKVRDVGCGLRH
FT                   TVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALDAQNIVAVACGEAHTLALNDKGQ
FT                   VYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQ
FT                   NKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQL
FT                   GLNDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLGHNSTSH
FT                   EINPRKVFELMGSIVTQVACGRQHTSAFVPSSGRIYSFGLGGNGQLGTGSTSNRKSPFT
FT                   VKGNWFSYNGQCPQDIGSEDYFCVKRIFSGGDQSFSHYSSPQNCGPPDDFRCSDPSKQI
FT                   WTVNEALIQKWLSYPSGRFPVEIANEIDGTFSSSGCLNGSFLAISNDDHYRTGTRFSGV
FT                   DMNAARLLFHKLIQPDHPQISQQVAASLEKNLIPKLTSSLPDVEALRFYLTLPECPLMS
FT                   DCNNFTTIAIPFGTALVNLEKAPLKVLGK"
FT   CDS             join(4589906..4590131,4608045..4608204,4613647..4613723,
FT                   4617442..4617680)
FT                   /codon_start=1
FT                   /gene="Herc4"
FT                   /locus_tag="mCG_123412"
FT                   /product="hect domain and RLD 4, isoform CRA_d"
FT                   /note="gene_id=mCG123412.1 transcript_id=mCT176009.0
FT                   protein_id=mCP98933.0 isoform=CRA_d"
FT                   /protein_id="EDL32054.1"
FT                   /translation="MLCWGNASYGQLGLGGIDEEIVLEPRRSDFFVNKKVRDVGCGLRH
FT                   TVFVLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALDAQNIVAVACGEAHTLALNDKGQ
FT                   VYAWGLDSDGQLGLQGSEECIRVPRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQ
FT                   NKYGQLGLGIDCQKQTSPQLIKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQL
FT                   GLNDENGRCAL"
FT   gene            complement(4662554..>4680591)
FT                   /gene="Sirt1"
FT                   /locus_tag="mCG_11267"
FT                   /note="gene_id=mCG11267.1"
FT   mRNA            complement(join(4662554..4664457,4665242..4665793,
FT                   4667460..4667646,4668619..4668698,4669532..4669679,
FT                   4675238..4675390,4679129..4679370,4680473..>4680591))
FT                   /gene="Sirt1"
FT                   /locus_tag="mCG_11267"
FT                   /product="sirtuin 1 ((silent mating type information
FT                   regulation 2, homolog) 1 (S. cerevisiae), transcript
FT                   variant mCT11311"
FT                   /note="gene_id=mCG11267.1 transcript_id=mCT11311.1 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4664129..4664457,4665242..4665793,
FT                   4667460..4667646,4668619..4668698,4669532..4669679,
FT                   4675238..4675390,4679129..4679370,4680473..>4680590))
FT                   /codon_start=1
FT                   /gene="Sirt1"
FT                   /locus_tag="mCG_11267"
FT                   /product="sirtuin 1 ((silent mating type information
FT                   regulation 2, homolog) 1 (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG11267.1 transcript_id=mCT11311.1
FT                   protein_id=mCP1457.1 isoform=CRA_a"
FT                   /protein_id="EDL32049.1"
FT                   /translation="DNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFV
FT                   QQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAV
FT                   KLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDP
FT                   RPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGS
FT                   FATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHR
FT                   AMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCD
FT                   VIINELCHRLGGEYAKLCCNPVKLSEITEKPPRPQKELVHLSELPPTPLHISEDSSSPE
FT                   RTVPQDSSVIATLVDQATNNNVNDLEVSESSCVEEKPQEVQTSRNVENINVENPDFKAV
FT                   GSSTADKNERTSVAETVRKCWPNRLAKEQISKRLEGNQYLFVPPNRYIFHGAEVYSDSE
FT                   DDVLSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDTERPECAGGSGFGADG
FT                   GDQEVVNEAIATRQELTDVNYPSDKS"
FT   mRNA            complement(join(4670152..4670277,4675238..4675390,
FT                   4679129..4679370,4680473..>4680591))
FT                   /gene="Sirt1"
FT                   /locus_tag="mCG_11267"
FT                   /product="sirtuin 1 ((silent mating type information
FT                   regulation 2, homolog) 1 (S. cerevisiae), transcript
FT                   variant mCT173587"
FT                   /note="gene_id=mCG11267.1 transcript_id=mCT173587.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4670263..4670277,4675238..4675390,
FT                   4679129..4679370,4680473..>4680590))
FT                   /codon_start=1
FT                   /gene="Sirt1"
FT                   /locus_tag="mCG_11267"
FT                   /product="sirtuin 1 ((silent mating type information
FT                   regulation 2, homolog) 1 (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG11267.1 transcript_id=mCT173587.0
FT                   protein_id=mCP96506.0 isoform=CRA_b"
FT                   /protein_id="EDL32050.1"
FT                   /translation="DNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFV
FT                   QQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAV
FT                   KLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDP
FT                   RPFFKFAKKKQH"
FT   gene            4725862..4752425
FT                   /gene="Dnajc12"
FT                   /locus_tag="mCG_11266"
FT                   /note="gene_id=mCG11266.2"
FT   mRNA            join(4725862..4725937,4739482..4739560,4740936..4741075,
FT                   4750560..4750764,4751787..4752425)
FT                   /gene="Dnajc12"
FT                   /locus_tag="mCG_11266"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 12,
FT                   transcript variant mCT173586"
FT                   /note="gene_id=mCG11266.2 transcript_id=mCT173586.0 created
FT                   on 25-SEP-2002"
FT   mRNA            join(<4730071..4730277,4739482..4741075,4750560..4750764,
FT                   4751787..4752384)
FT                   /gene="Dnajc12"
FT                   /locus_tag="mCG_11266"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 12,
FT                   transcript variant mCT192967"
FT                   /note="gene_id=mCG11266.2 transcript_id=mCT192967.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(4730117..4730277,4739482..4739560,4740936..4741075,
FT                   4750560..4750764,4751787..4752425)
FT                   /gene="Dnajc12"
FT                   /locus_tag="mCG_11266"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 12,
FT                   transcript variant mCT11310"
FT                   /note="gene_id=mCG11266.2 transcript_id=mCT11310.2 created
FT                   on 25-SEP-2002"
FT   CDS             join(4730200..4730277,4739482..4739560,4740936..4741075,
FT                   4750560..4750764,4751787..4751881)
FT                   /codon_start=1
FT                   /gene="Dnajc12"
FT                   /locus_tag="mCG_11266"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 12,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG11266.2 transcript_id=mCT11310.2
FT                   protein_id=mCP1450.2 isoform=CRA_c"
FT                   /protein_id="EDL32048.1"
FT                   /translation="MDAILNYRPEGSEDYYALLGCDELSSVEQILAEFKIRALECHPDK
FT                   HPENSKAVETFQKLQKAKEILCNAESRARYDHWRRSQMSMPFEQWEALADSVKTSMHWA
FT                   VRSKKDLMLEGSGQTFTSSVPNKERSEQRETKKGDPDSNPEKMKQKEPKFPEEGISPQN
FT                   PDSPGLSDLNCGHLRFRWSGDAPSELLRKFRNYEI"
FT   CDS             join(<4740815..4741075,4750560..4750764,4751787..4751881)
FT                   /codon_start=1
FT                   /gene="Dnajc12"
FT                   /locus_tag="mCG_11266"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11266.2 transcript_id=mCT192967.0
FT                   protein_id=mCP113939.0 isoform=CRA_b"
FT                   /protein_id="EDL32047.1"
FT                   /translation="SLTRETSSKSQSQNSGESCRMVLEFNPPQESSVHLLSCFPVETFQ
FT                   KLQKAKEILCNAESRARYDHWRRSQMSMPFEQWEALADSVKTSMHWAVRSKKDLMLEGS
FT                   GQTFTSSVPNKERSEQRETKKGDPDSNPEKMKQKEPKFPEEGISPQNPDSPGLSDLNCG
FT                   HLRFRWSGDAPSELLRKFRNYEI"
FT   CDS             join(4741025..4741075,4750560..4750764,4751787..4751881)
FT                   /codon_start=1
FT                   /gene="Dnajc12"
FT                   /locus_tag="mCG_11266"
FT                   /product="DnaJ (Hsp40) homolog, subfamily C, member 12,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11266.2 transcript_id=mCT173586.0
FT                   protein_id=mCP96505.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z0D9"
FT                   /db_xref="MGI:MGI:1353428"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z0D9"
FT                   /protein_id="EDL32046.1"
FT                   /translation="MSMPFEQWEALADSVKTSMHWAVRSKKDLMLEGSGQTFTSSVPNK
FT                   ERSEQRETKKGDPDSNPEKMKQKEPKFPEEGISPQNPDSPGLSDLNCGHLRFRWSGDAP
FT                   SELLRKFRNYEI"
FT   gene            4773755..6338300
FT                   /gene="Ctnna3"
FT                   /locus_tag="mCG_141512"
FT                   /note="gene_id=mCG141512.0"
FT   mRNA            join(4773755..4773837,4847778..4847881,4881496..4881688,
FT                   4910701..4910867,4923749..4923868,5160766..5160948,
FT                   5193233..5193436,5588243..5588323,5598409..5598561,
FT                   5746580..5746672,5824478..5824634,5922950..5923150,
FT                   6012437..6012588,6170800..6170892,6209452..6209633,
FT                   6281374..6281479,6295258..6295392,6337870..6338300)
FT                   /gene="Ctnna3"
FT                   /locus_tag="mCG_141512"
FT                   /product="catenin (cadherin associated protein), alpha 3"
FT                   /note="gene_id=mCG141512.0 transcript_id=mCT175755.0
FT                   created on 11-NOV-2002"
FT   CDS             join(4847783..4847881,4881496..4881688,4910701..4910867,
FT                   4923749..4923868,5160766..5160948,5193233..5193436,
FT                   5588243..5588323,5598409..5598561,5746580..5746672,
FT                   5824478..5824634,5922950..5923150,6012437..6012588,
FT                   6170800..6170892,6209452..6209633,6281374..6281479,
FT                   6295258..6295392,6337870..6338157)
FT                   /codon_start=1
FT                   /gene="Ctnna3"
FT                   /locus_tag="mCG_141512"
FT                   /product="catenin (cadherin associated protein), alpha 3"
FT                   /note="gene_id=mCG141512.0 transcript_id=mCT175755.0
FT                   protein_id=mCP98677.0"
FT                   /protein_id="EDL32043.1"
FT                   /translation="MSAETPITLNMDTQDLQIQTFTVEKLLEPLIIQVTTLVNCPQNPS
FT                   NRKKGRSKRARVLLASVEEATWNLLDKGEMIAKEATVLKEELAAALQEVRKESKALKVS
FT                   AERFTDDPCYLPKREAVVQAARALLAAVTRLLVLADMIDVMCLLQHVSSFQRTFESLKN
FT                   VSNKSDLQRTYQKLGKELESLDYLAFKRQQDLKSPSQRDEIAGARATLKENSPLLHSIC
FT                   SACLEHSDVASLKASKDTVCEEIQNALDVISNNLIVLNPLTVTEEDVRPSLEKRLEAII
FT                   SGAALLADSSCTRDLHRERIIAECNAIRQALQDLLTEYMSNTGKTERSNTLNTAIVNMS
FT                   KKTRDLRRQLRKAIIDHISDSFLDTTVPLLVLIEAAKNGRVKEIKDYAAIFHEHTGRLV
FT                   EVANLACSMSTNEDGIKIVRIAANHLETLCPQIINAALALASRPKSQVVKNTMEMYKRT
FT                   WEHYIHVLTEAVDDITSIDDFLAVSESHILEDVNKCIIALRDQDADNLDRAAGAIRGRA
FT                   ARVAHIVAGEMDSYEPGAYTEGVMRNVNFLTSTVIPEFVTQVNVALDALSKNSLTALDD
FT                   NQFVDISKKIYDTIHDIRCSVMMIRTPEELEDVSDLEDDHEVRSHTSIQTEGKTDRAKM
FT                   TQLPEAEKEKIAEQVADFKKVKSKLDAEIEIWDDTSNDIIVLAKKMCMIMMEMTDFTRG
FT                   KGPLKHTTDVIYAAKMISESGSRMDVLARQIANQCPDPPCKQDLLAYLEQIKFYSHQLK
FT                   ICSQVKAEIQNLGGELIVSALDSVTSLIQAAKNLMNAVVQTVKMSYIASTKIIRIQSSA
FT                   GPRHPVVMWRMKAPAKKPLIKREKPEETWAAVRRGSAKKKIHPVQVMSEFRGRQVY"
FT   gene            complement(5265568..5268136)
FT                   /locus_tag="mCG_148093"
FT                   /note="gene_id=mCG148093.0"
FT   mRNA            complement(5265568..5268136)
FT                   /locus_tag="mCG_148093"
FT                   /product="mCG148093"
FT                   /note="gene_id=mCG148093.0 transcript_id=mCT188356.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(5267509..5267859)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148093"
FT                   /product="mCG148093"
FT                   /note="gene_id=mCG148093.0 transcript_id=mCT188356.0
FT                   protein_id=mCP108323.0"
FT                   /db_xref="GOA:Q8C8J5"
FT                   /db_xref="MGI:MGI:3642340"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C8J5"
FT                   /protein_id="EDL32045.1"
FT                   /translation="MFSFMATAQLSKTRKIAVCLPVAVENWSLPITVTTVAKARQCFKV
FT                   HKSHELSLLAVLNNPVKIHSCLISRDSSKDTELMAGDGLNCFQCLKVVFHYTKSSPISL
FT                   ARDPPEMADRSY"
FT   gene            complement(5269199..>5431086)
FT                   /gene="Lrrtm3"
FT                   /locus_tag="mCG_145498"
FT                   /note="gene_id=mCG145498.0"
FT   mRNA            complement(join(5269199..5270969,5428678..5430212,
FT                   5430540..>5431086))
FT                   /gene="Lrrtm3"
FT                   /locus_tag="mCG_145498"
FT                   /product="leucine rich repeat transmembrane neuronal 3"
FT                   /note="gene_id=mCG145498.0 transcript_id=mCT184922.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(5270760..5270969,5428678..5430212,
FT                   5430540..>5430555))
FT                   /codon_start=1
FT                   /gene="Lrrtm3"
FT                   /locus_tag="mCG_145498"
FT                   /product="leucine rich repeat transmembrane neuronal 3"
FT                   /note="gene_id=mCG145498.0 transcript_id=mCT184922.0
FT                   protein_id=mCP105588.0"
FT                   /protein_id="EDL32044.1"
FT                   /translation="TIQRMGFNVIRLLRGSAVAVVLAPTVLLTMLSSAERGCPKGCRCE
FT                   GKMVYCESQKLQEIPSSISAGCLGLSLRYNSLQKLKYNQFKGLNQLTWLYLDHNHISNI
FT                   DENAFNGIRRLKELILSSNRISYFLNNTFRPVTNLRNLDLSYNQLHSLGSEQFRGLRKL
FT                   LSLHLRSNSLRTIPVRIFQDCRNLELLDLGYNRIRSLARNVFAGMIRLKELHLEHNQFS
FT                   KLNLALFPRLVSLQNLYMQWNKISVIGQTMSWTWSSLQRLDLSGNEIEAFSGPSVFQCV
FT                   PNLQRLNLDSNKLTFIGQEILDSWISLNDISLAGNIWECSRNICSLVNWLRSFKGLREN
FT                   TIICASPKELQGVNVIDAVKNYSICGKSTTTERFDLARALPKPTFKPKLPRPKHESKPP
FT                   LPPTVGATEPSPETDVDTEHISFHKIIAGSVALFLSVLVILLVMYVSWKRYPASMKQLQ
FT                   QRSLMRRHRKKKRQSLKQMTPGTQEFYVDYKPTNTETSEMLLNGTGPCTYSKSGSRECE
FT                   IPLSMNVSTFLAYDQPTISYCGVHHELLSHKSFETNAQEDTMESHLETELDLSTITSAG
FT                   RISDHKPQLA"
FT   gene            6751613..6752536
FT                   /pseudo
FT                   /locus_tag="mCG_1044214"
FT                   /note="gene_id=mCG1044214.1"
FT   mRNA            6751613..6752536
FT                   /pseudo
FT                   /locus_tag="mCG_1044214"
FT                   /note="gene_id=mCG1044214.1 transcript_id=mCT161918.1
FT                   created on 11-NOV-2002"
FT   gene            6869763..6870590
FT                   /pseudo
FT                   /locus_tag="mCG_13681"
FT                   /note="gene_id=mCG13681.1"
FT   mRNA            6869763..6870590
FT                   /pseudo
FT                   /locus_tag="mCG_13681"
FT                   /note="gene_id=mCG13681.1 transcript_id=mCT17089.1 created
FT                   on 11-NOV-2002"
FT   gene            complement(7210827..7242903)
FT                   /locus_tag="mCG_1044322"
FT                   /note="gene_id=mCG1044322.1"
FT   mRNA            complement(join(7210827..7211109,7218347..7218535,
FT                   7228581..7228663,7233766..7233916,7234659..7234723,
FT                   7242864..7242903))
FT                   /locus_tag="mCG_1044322"
FT                   /product="mCG1044322"
FT                   /note="gene_id=mCG1044322.1 transcript_id=mCT162026.1
FT                   created on 07-NOV-2002"
FT   CDS             complement(join(7218447..7218535,7228581..7228653))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044322"
FT                   /product="mCG1044322"
FT                   /note="gene_id=mCG1044322.1 transcript_id=mCT162026.1
FT                   protein_id=mCP54869.1"
FT                   /protein_id="EDL32042.1"
FT                   /translation="MESTWQPKIPITDNTPDIYPGNPHEHVLTQPATWVRSLMIFQTSE
FT                   MTRPQSEV"
FT   gene            complement(7454700..>7458155)
FT                   /locus_tag="mCG_13682"
FT                   /note="gene_id=mCG13682.2"
FT   mRNA            complement(join(7454700..7454933,7456041..7456122,
FT                   7458127..>7458155))
FT                   /locus_tag="mCG_13682"
FT                   /product="mCG13682, transcript variant mCT17090"
FT                   /note="gene_id=mCG13682.2 transcript_id=mCT17090.2 created
FT                   on 07-NOV-2002"
FT   mRNA            complement(join(7454700..7454933,7456041..7456122,
FT                   7457005..7457166))
FT                   /locus_tag="mCG_13682"
FT                   /product="mCG13682, transcript variant mCT175463"
FT                   /note="gene_id=mCG13682.2 transcript_id=mCT175463.0 created
FT                   on 07-NOV-2002"
FT   CDS             complement(join(7454917..7454933,7456041..7456122,
FT                   7458127..>7458153))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13682"
FT                   /product="mCG13682, isoform CRA_b"
FT                   /note="gene_id=mCG13682.2 transcript_id=mCT17090.2
FT                   protein_id=mCP1470.1 isoform=CRA_b"
FT                   /protein_id="EDL32041.1"
FT                   /translation="LPASCFRLQTRAWTWLCSSAEGYSYCCTAVFVQISPDKATM"
FT   CDS             complement(join(7454917..7454933,7456041..7456122,
FT                   7457005..7457106))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13682"
FT                   /product="mCG13682, isoform CRA_a"
FT                   /note="gene_id=mCG13682.2 transcript_id=mCT175463.0
FT                   protein_id=mCP98382.0 isoform=CRA_a"
FT                   /protein_id="EDL32040.1"
FT                   /translation="MGQRLKERPSRDCPTLESIPSEDTKLQHYCGCQETRAWTWLCSSA
FT                   EGYSYCCTAVFVQISPDKATM"
FT   gene            7479335..7513554
FT                   /locus_tag="mCG_1044319"
FT                   /note="gene_id=mCG1044319.0"
FT   mRNA            join(7479335..7479675,7480252..7480385,7490427..7490455,
FT                   7507157..7507412,7513391..7513554)
FT                   /locus_tag="mCG_1044319"
FT                   /product="mCG1044319"
FT                   /note="gene_id=mCG1044319.0 transcript_id=mCT162023.0
FT                   created on 07-NOV-2002"
FT   CDS             join(7479606..7479675,7480252..7480340)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044319"
FT                   /product="mCG1044319"
FT                   /note="gene_id=mCG1044319.0 transcript_id=mCT162023.0
FT                   protein_id=mCP55378.1"
FT                   /protein_id="EDL32039.1"
FT                   /translation="MIGTKVNHMCMCSEVRRNKYLFNKRPHESGILALCSFSCSLTISD
FT                   TSGCKKL"
FT   gene            complement(8026251..8026638)
FT                   /pseudo
FT                   /locus_tag="mCG_141452"
FT                   /note="gene_id=mCG141452.0"
FT   mRNA            complement(8026251..8026638)
FT                   /pseudo
FT                   /locus_tag="mCG_141452"
FT                   /note="gene_id=mCG141452.0 transcript_id=mCT175457.0
FT                   created on 07-NOV-2002"
FT   gene            complement(8075158..8075486)
FT                   /pseudo
FT                   /locus_tag="mCG_1044181"
FT                   /note="gene_id=mCG1044181.1"
FT   mRNA            complement(8075158..8075486)
FT                   /pseudo
FT                   /locus_tag="mCG_1044181"
FT                   /note="gene_id=mCG1044181.1 transcript_id=mCT161885.1
FT                   created on 07-NOV-2002"
FT   gene            8159477..8162711
FT                   /locus_tag="mCG_1044312"
FT                   /note="gene_id=mCG1044312.0"
FT   mRNA            join(8159477..8159515,8160990..8161097,8162433..8162711)
FT                   /locus_tag="mCG_1044312"
FT                   /product="mCG1044312"
FT                   /note="gene_id=mCG1044312.0 transcript_id=mCT162016.0
FT                   created on 07-NOV-2002"
FT   CDS             join(8161043..8161097,8162433..8162521)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044312"
FT                   /product="mCG1044312"
FT                   /note="gene_id=mCG1044312.0 transcript_id=mCT162016.0
FT                   protein_id=mCP55137.1"
FT                   /protein_id="EDL32038.1"
FT                   /translation="MCQLPSLELSRHSAQIVLDSVEHSCHPKLLKHKHETKELLWSTQA
FT                   FM"
FT   gene            complement(8251163..>8253267)
FT                   /locus_tag="mCG_1044311"
FT                   /note="gene_id=mCG1044311.1"
FT   mRNA            complement(join(8251163..8251486,8253203..>8253267))
FT                   /locus_tag="mCG_1044311"
FT                   /product="mCG1044311"
FT                   /note="gene_id=mCG1044311.1 transcript_id=mCT162015.1
FT                   created on 07-NOV-2002"
FT   CDS             complement(8251203..>8251427)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044311"
FT                   /product="mCG1044311"
FT                   /note="gene_id=mCG1044311.1 transcript_id=mCT162015.1
FT                   protein_id=mCP55124.1"
FT                   /protein_id="EDL32037.1"
FT                   /translation="AGFLEVADYEKRDAVVSNPALSYSERGCPGRGAIRQPSGQQAWST
FT                   YLGIVEARETLPQQGGRINSYRLSSELHT"
FT   gene            8256427..8259124
FT                   /locus_tag="mCG_148086"
FT                   /note="gene_id=mCG148086.0"
FT   mRNA            join(8256427..8257441,8258374..8259124)
FT                   /locus_tag="mCG_148086"
FT                   /product="mCG148086"
FT                   /note="gene_id=mCG148086.0 transcript_id=mCT188349.0
FT                   created on 13-JAN-2004"
FT   CDS             8257065..8257334
FT                   /codon_start=1
FT                   /locus_tag="mCG_148086"
FT                   /product="mCG148086"
FT                   /note="gene_id=mCG148086.0 transcript_id=mCT188349.0
FT                   protein_id=mCP108316.0"
FT                   /protein_id="EDL32036.1"
FT                   /translation="MSHQLAAVPENLCSCRTGQTGPAHCHSARPSIKAPVSAHTQLAPR
FT                   TLASSCLEVCPGITGETSEPPSDLPPLIFLGITQLFWNPLERSR"
FT   gene            8340534..>8376849
FT                   /locus_tag="mCG_113646"
FT                   /note="gene_id=mCG113646.1"
FT   mRNA            join(8340534..8340643,8358785..8359012,8365559..8365637,
FT                   8375534..8375657,8376198..8376328,8376483..8376849)
FT                   /locus_tag="mCG_113646"
FT                   /product="mCG113646, transcript variant mCT175462"
FT                   /note="gene_id=mCG113646.1 transcript_id=mCT175462.0
FT                   created on 18-DEC-2002"
FT   mRNA            join(8340534..8340643,8358920..8359012,8365559..8365637,
FT                   8371987..8372166,8375534..8375657,8376198..8376328,
FT                   8376483..8376849)
FT                   /locus_tag="mCG_113646"
FT                   /product="mCG113646, transcript variant mCT114732"
FT                   /note="gene_id=mCG113646.1 transcript_id=mCT114732.1
FT                   created on 18-DEC-2002"
FT   CDS             join(8340549..8340643,8358920..8358950)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113646"
FT                   /product="mCG113646, isoform CRA_a"
FT                   /note="gene_id=mCG113646.1 transcript_id=mCT114732.1
FT                   protein_id=mCP55013.1 isoform=CRA_a"
FT                   /protein_id="EDL32033.1"
FT                   /translation="MGDLFFLFSLKASSLSSLKLKARSMNTTADSRNSSSIPTTS"
FT   CDS             join(8340549..8340643,8358785..8358800)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113646"
FT                   /product="mCG113646, isoform CRA_b"
FT                   /note="gene_id=mCG113646.1 transcript_id=mCT175462.0
FT                   protein_id=mCP98381.0 isoform=CRA_b"
FT                   /protein_id="EDL32034.1"
FT                   /translation="MGDLFFLFSLKASSLSSLKLKARSMNTTADSRHVNV"
FT   mRNA            join(<8340588..8340643,8358920..8359012,8365559..8365637,
FT                   8371987..8372166,8375534..8375653,8376198..8376328,
FT                   8376483..>8376849)
FT                   /locus_tag="mCG_113646"
FT                   /product="mCG113646, transcript variant mCT192948"
FT                   /note="gene_id=mCG113646.1 transcript_id=mCT192948.0
FT                   created on 09-MAR-2004"
FT   gene            complement(8344704..8432452)
FT                   /gene="D10Ucla1"
FT                   /locus_tag="mCG_8500"
FT                   /note="gene_id=mCG8500.2"
FT   mRNA            complement(join(8344704..8349309,8350425..8350570,
FT                   8357272..8357416,8370122..8370235,8371408..8371528,
FT                   8375024..8375100,8398447..8398519,8432408..8432452))
FT                   /gene="D10Ucla1"
FT                   /locus_tag="mCG_8500"
FT                   /product="DNA segment, Chr 10, University of California at
FT                   Los Angeles 1, transcript variant mCT7483"
FT                   /note="gene_id=mCG8500.2 transcript_id=mCT7483.2 created on
FT                   07-NOV-2002"
FT   mRNA            complement(join(8344704..8349309,8350425..8350570,
FT                   8357272..8357416,8370122..8370235,8371408..8371528,
FT                   8375024..8375100,8398447..8398519,8404606..8404678))
FT                   /gene="D10Ucla1"
FT                   /locus_tag="mCG_8500"
FT                   /product="DNA segment, Chr 10, University of California at
FT                   Los Angeles 1, transcript variant mCT175470"
FT                   /note="gene_id=mCG8500.2 transcript_id=mCT175470.0 created
FT                   on 07-NOV-2002"
FT   CDS             complement(join(8349253..8349309,8350425..8350570,
FT                   8357272..8357416,8370122..8370235,8371408..8371528,
FT                   8375024..8375100,8398447..8398506))
FT                   /codon_start=1
FT                   /gene="D10Ucla1"
FT                   /locus_tag="mCG_8500"
FT                   /product="DNA segment, Chr 10, University of California at
FT                   Los Angeles 1, isoform CRA_a"
FT                   /note="gene_id=mCG8500.2 transcript_id=mCT7483.2
FT                   protein_id=mCP9522.2 isoform=CRA_a partial"
FT                   /protein_id="EDL32031.1"
FT                   /translation="MLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLA
FT                   WFPLYYELKIAFVIWLLSPYTRGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMV
FT                   NFGRQGLNLAAAAAVTAAVKSQGAITERLRSFSMHDLTAIQGDEPVGHRPYQTLPEAKR
FT                   KGKQATESPAYGIPLKDGSEQTDEEAEGPFSDDEMVTHKALRRSQSMKSVKTIKGRKEV
FT                   RYGSLKYKVKKRPQVYF"
FT   CDS             complement(join(8349253..8349309,8350425..8350570,
FT                   8357272..8357416,8370122..8370235,8371408..8371528,
FT                   8375024..8375100,8398447..8398506))
FT                   /codon_start=1
FT                   /gene="D10Ucla1"
FT                   /locus_tag="mCG_8500"
FT                   /product="DNA segment, Chr 10, University of California at
FT                   Los Angeles 1, isoform CRA_a"
FT                   /note="gene_id=mCG8500.2 transcript_id=mCT175470.0
FT                   protein_id=mCP98389.0 isoform=CRA_a partial"
FT                   /protein_id="EDL32032.1"
FT                   /translation="MLYPAYYSYKAVKTKNVKEYVRWMMYWIVFALYTVIETVADQTLA
FT                   WFPLYYELKIAFVIWLLSPYTRGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMV
FT                   NFGRQGLNLAAAAAVTAAVKSQGAITERLRSFSMHDLTAIQGDEPVGHRPYQTLPEAKR
FT                   KGKQATESPAYGIPLKDGSEQTDEEAEGPFSDDEMVTHKALRRSQSMKSVKTIKGRKEV
FT                   RYGSLKYKVKKRPQVYF"
FT   CDS             <8376532..>8376849
FT                   /codon_start=1
FT                   /locus_tag="mCG_113646"
FT                   /product="mCG113646, isoform CRA_c"
FT                   /note="gene_id=mCG113646.1 transcript_id=mCT192948.0
FT                   protein_id=mCP113943.0 isoform=CRA_c"
FT                   /protein_id="EDL32035.1"
FT                   /translation="RTCLGCLSPDTPQLCRHLDSPPGTGGAGGCDSPYGWQELNPVQEQ
FT                   QVLLFAGSVLQLCCLSSFPRGRKEGILFVGKLNHHQTISTVYCTHFPCGTHCILLLKIY
FT                   LF"
FT   gene            <8462788..8591810
FT                   /locus_tag="mCG_57125"
FT                   /note="gene_id=mCG57125.1"
FT   mRNA            join(<8462788..8462952,8493501..8493665,8525346..8525459,
FT                   8550814..8550919,8552527..8552651,8553582..8553725,
FT                   8553821..8554013,8554498..8554834,8555837..8556179,
FT                   8559553..8559725,8560282..8562464,8565393..8565594,
FT                   8567517..8567731,8568916..8569068,8573652..8573741,
FT                   8574351..8574478,8574793..8575003,8575406..8575620,
FT                   8576207..8576485,8579316..8579484,8580327..8580417,
FT                   8581050..8581180,8581578..8581700,8583551..8583690,
FT                   8585170..8585346,8589937..8590068,8590934..8591809)
FT                   /locus_tag="mCG_57125"
FT                   /product="mCG57125, transcript variant mCT57308"
FT                   /note="gene_id=mCG57125.1 transcript_id=mCT57308.2 created
FT                   on 07-NOV-2002"
FT   CDS             join(8462788..8462952,8493501..8493665,8525346..8525459,
FT                   8550814..8550919,8552527..8552651,8553582..8553725,
FT                   8553821..8554013,8554498..8554834,8555837..8556179,
FT                   8559553..8559725,8560282..8562464,8565393..8565594,
FT                   8567517..8567731,8568916..8569068,8573652..8573741,
FT                   8574351..8574478,8574793..8575003,8575406..8575620,
FT                   8576207..8576485,8579316..8579484,8580327..8580417,
FT                   8581050..8581180,8581578..8581700,8583551..8583690,
FT                   8585170..8585346,8589937..8590068,8590934..8591023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57125"
FT                   /product="mCG57125, isoform CRA_b"
FT                   /note="gene_id=mCG57125.1 transcript_id=mCT57308.2
FT                   protein_id=mCP31688.2 isoform=CRA_b"
FT                   /protein_id="EDL32030.1"
FT                   /translation="MAVETRPELVGKRFLCVAAGEDARPERGQSGCGRGWRAGVIRAVS
FT                   HRDRGHPDLAVYVEFDDLEWDKREWVRVYEDFSTFLVEYHLIWAKRKDPSQTQGSKSRQ
FT                   IQWPALTFKPLVENSIPSSITAVEFLIDKQLDFLTEDSAFQPYQDDIDSLKPVLRDNPQ
FT                   LHAEVKVWVKEQKVQEIFMQGPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVM
FT                   NDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRASQNISTVHGHYTRAQA
FT                   NSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSSIPDEEKMKEDKYDCVSRGENP
FT                   KGKNKHVVTKRRKPEEAEKRLSMKRLRTDNASDASESSDAESSSKRVTETSSSEPMPEY
FT                   EPKNKVTSKVNGEEGQSQAAEEAGEETLIDTRPPWDQMQEDKNHNEGEKPNGPHHPVHH
FT                   PHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQSPHLLGQAHPS
FT                   ASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNSPSPWLHQPTP
FT                   VTSADGIGLLSHIPVRPSSAEPHRPHKITVHSSPPLTKTLADHHKEELERKAFMEPLRS
FT                   NASTSVKGDLDLNRSQAGKDCHLHRHFVGPRPPQETGERLNKYKEEHRRILQESIDVAP
FT                   FTTKIKGHEVERENYSRVVPSSSSPKSHAIKQDKDVDRSVSEIYKMKHSVPQSLPQSNY
FT                   FTTLSNSVVNEPPRSYPSKEVSNIYTEKQNNNLSATANPQTHSFISSLSKPPPLIKHQP
FT                   ESESLVGKIPDHLPHQSASHSVTTFRSDCRSPTHLTVSSTNALRSMPALHRAPVFHPPI
FT                   HHSLERKESSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDSQSNFKNSSDQSL
FT                   TEMWRSNNNLNREKAEWPVEKSSGKSQAAVASVIVRPPSSTKVDSVPSVPLASKDRVCE
FT                   RSSSGANKTDYLKPEAGETGRIILPNVNLESAHVKSEKNFEAVSQGNVPVSVMSAVNVV
FT                   STTKADVFTSAATTTSVSSLSSAETSYSLSNTISASTPFECTSSKSVVSQAVAQAKDCT
FT                   VSTAVPGTLACSKTGSAVQPGSGFSGTTDFIHLKKHKAALAAAQFKNSSVSEAELNTVR
FT                   NQTVAASLPLDSTMTCTASNKAISVGNGPAAQSSQPNYHTKLKKAWLTRHSEEDKNTNK
FT                   MENSGNSVSEIIKPCSVNLIASTSNDIENRADGRVAVDKYGRDEKVSRRKAKRTYESGS
FT                   ESGDSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEVEEDSKPNGVLSRSAKDKSKLK
FT                   LQNSNSAGVPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSKKGEE
FT                   STHSPVFCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENYEDDEVDVETSK
FT                   YILDIIGDKFCQLVTSEKTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNVHWVCRK
FT                   CGFVACLDCYKAKERKSSRDKELYAWMKCVKGQPHDHKHLMPTQIIPGSVLTDLLDAMH
FT                   ILREKYGIKSHCHCTNRQNLQGGNVPTMNGVSQVLQNVLHHSNKTSVSLPESQQQNSPQ
FT                   KSQTNGNSSPGSASTDSRLTPPESQSPLHWLADLAEQKSREEKQENKEFTLEREIKEDG
FT                   DQDASDSPNGSTSPPASQSNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGTSSG
FT                   KGGRTMPNILDDIIASVVENKIPPNKTSKINIKSEPNEEPKESSLPATDESNKSYRDIP
FT                   HSWICDQHILWLKDYKNSNNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGD
FT                   HQADLLNCKDSIVSNANVKEFWDGFEEVSKRQKNKGGETVVLKLKDCPSGEDFKAMMPT
FT                   RYEDFLRCLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVAAAKDHDIGTTNL
FT                   HIEASDVVNVLVYVGIAKGNGVLSKAGILKKFEEEELDDVLRKRLKDSSEIPGALWHIY
FT                   AGKDVDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNRKLRQRLLEEYGVRACTLIQF
FT                   LGDAIVLPAGTLHQVQNFHSCVQVTEDFVSPEHLVQSFHLTQELRLLKEEINYDDKLQV
FT                   KNILYHAVKEMVRALKMHEDEVEDMEDT"
FT   mRNA            join(8521324..8521921,8525346..8525459,8550814..8550919,
FT                   8552527..8552651,8553582..8553725,8553821..8554013,
FT                   8554498..8554834,8555837..8556179,8559553..8559725,
FT                   8560282..8562464,8565393..8565594,8567517..8567731,
FT                   8568916..8569068,8573652..8573741,8574351..8574478,
FT                   8574793..8575003,8575406..8575620,8576207..8576485,
FT                   8579316..8579484,8580327..8580417,8581050..8581180,
FT                   8581578..8581700,8583551..8583690,8585170..8585346,
FT                   8589937..8590068,8590934..8591810)
FT                   /locus_tag="mCG_57125"
FT                   /product="mCG57125, transcript variant mCT175468"
FT                   /note="gene_id=mCG57125.1 transcript_id=mCT175468.0 created
FT                   on 07-NOV-2002"
FT   CDS             join(8550913..8550919,8552527..8552651,8553582..8553725,
FT                   8553821..8554013,8554498..8554834,8555837..8556179,
FT                   8559553..8559725,8560282..8562464,8565393..8565594,
FT                   8567517..8567731,8568916..8569068,8573652..8573741,
FT                   8574351..8574478,8574793..8575003,8575406..8575620,
FT                   8576207..8576485,8579316..8579484,8580327..8580417,
FT                   8581050..8581180,8581578..8581700,8583551..8583690,
FT                   8585170..8585346,8589937..8590068,8590934..8591023)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57125"
FT                   /product="mCG57125, isoform CRA_a"
FT                   /note="gene_id=mCG57125.1 transcript_id=mCT175468.0
FT                   protein_id=mCP98387.0 isoform=CRA_a"
FT                   /protein_id="EDL32029.1"
FT                   /translation="MQGPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVMNDQV
FT                   LEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRASQNISTVHGHYTRAQANSPR
FT                   PAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSSIPDEEKMKEDKYDCVSRGENPKGKN
FT                   KHVVTKRRKPEEAEKRLSMKRLRTDNASDASESSDAESSSKRVTETSSSEPMPEYEPKN
FT                   KVTSKVNGEEGQSQAAEEAGEETLIDTRPPWDQMQEDKNHNEGEKPNGPHHPVHHPHLL
FT                   PTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQSPHLLGQAHPSASYN
FT                   QLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNSPSPWLHQPTPVTSA
FT                   DGIGLLSHIPVRPSSAEPHRPHKITVHSSPPLTKTLADHHKEELERKAFMEPLRSNAST
FT                   SVKGDLDLNRSQAGKDCHLHRHFVGPRPPQETGERLNKYKEEHRRILQESIDVAPFTTK
FT                   IKGHEVERENYSRVVPSSSSPKSHAIKQDKDVDRSVSEIYKMKHSVPQSLPQSNYFTTL
FT                   SNSVVNEPPRSYPSKEVSNIYTEKQNNNLSATANPQTHSFISSLSKPPPLIKHQPESES
FT                   LVGKIPDHLPHQSASHSVTTFRSDCRSPTHLTVSSTNALRSMPALHRAPVFHPPIHHSL
FT                   ERKESSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDSQSNFKNSSDQSLTEMW
FT                   RSNNNLNREKAEWPVEKSSGKSQAAVASVIVRPPSSTKVDSVPSVPLASKDRVCERSSS
FT                   GANKTDYLKPEAGETGRIILPNVNLESAHVKSEKNFEAVSQGNVPVSVMSAVNVVSTTK
FT                   ADVFTSAATTTSVSSLSSAETSYSLSNTISASTPFECTSSKSVVSQAVAQAKDCTVSTA
FT                   VPGTLACSKTGSAVQPGSGFSGTTDFIHLKKHKAALAAAQFKNSSVSEAELNTVRNQTV
FT                   AASLPLDSTMTCTASNKAISVGNGPAAQSSQPNYHTKLKKAWLTRHSEEDKNTNKMENS
FT                   GNSVSEIIKPCSVNLIASTSNDIENRADGRVAVDKYGRDEKVSRRKAKRTYESGSESGD
FT                   SDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEVEEDSKPNGVLSRSAKDKSKLKLQNS
FT                   NSAGVPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSKKGEESTHS
FT                   PVFCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENYEDDEVDVETSKYILD
FT                   IIGDKFCQLVTSEKTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNVHWVCRKCGFV
FT                   ACLDCYKAKERKSSRDKELYAWMKCVKGQPHDHKHLMPTQIIPGSVLTDLLDAMHILRE
FT                   KYGIKSHCHCTNRQNLQGGNVPTMNGVSQVLQNVLHHSNKTSVSLPESQQQNSPQKSQT
FT                   NGNSSPGSASTDSRLTPPESQSPLHWLADLAEQKSREEKQENKEFTLEREIKEDGDQDA
FT                   SDSPNGSTSPPASQSNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGTSSGKGGR
FT                   TMPNILDDIIASVVENKIPPNKTSKINIKSEPNEEPKESSLPATDESNKSYRDIPHSWI
FT                   CDQHILWLKDYKNSNNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQAD
FT                   LLNCKDSIVSNANVKEFWDGFEEVSKRQKNKGGETVVLKLKDCPSGEDFKAMMPTRYED
FT                   FLRCLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVAAAKDHDIGTTNLHIEA
FT                   SDVVNVLVYVGIAKGNGVLSKAGILKKFEEEELDDVLRKRLKDSSEIPGALWHIYAGKD
FT                   VDKIREFLQKISKEQGLEVLPEHDPIRDQSWYVNRKLRQRLLEEYGVRACTLIQFLGDA
FT                   IVLPAGTLHQVQNFHSCVQVTEDFVSPEHLVQSFHLTQELRLLKEEINYDDKLQVKNIL
FT                   YHAVKEMVRALKMHEDEVEDMEDT"
FT   gene            complement(8602438..8621029)
FT                   /gene="Nrbf2"
FT                   /locus_tag="mCG_10495"
FT                   /note="gene_id=mCG10495.1"
FT   mRNA            complement(join(8602438..8603912,8605852..8605892,
FT                   8611316..8611400,8620843..8621029))
FT                   /gene="Nrbf2"
FT                   /locus_tag="mCG_10495"
FT                   /product="nuclear receptor binding factor 2"
FT                   /note="gene_id=mCG10495.1 transcript_id=mCT11002.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(8603205..8603912,8605852..8605892,
FT                   8611316..8611400,8620843..8620872))
FT                   /codon_start=1
FT                   /gene="Nrbf2"
FT                   /locus_tag="mCG_10495"
FT                   /product="nuclear receptor binding factor 2"
FT                   /note="gene_id=mCG10495.1 transcript_id=mCT11002.0
FT                   protein_id=mCP9515.1"
FT                   /protein_id="EDL32028.1"
FT                   /translation="MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHRKATTYLSEAM
FT                   KLTESEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAQQSTERDGAPHLQAPPRP
FT                   SEDAEGQSPLLSQPYIPSTERRLPEVQGVFDRDPDTLLFLLQQKNEPSEPCIGSKAPKD
FT                   DKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGTAEKELDVDADFV
FT                   EKSELWGLPSHSESAAASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDIL
FT                   KGFMND"
FT   gene            complement(8683667..8684021)
FT                   /pseudo
FT                   /locus_tag="mCG_1044180"
FT                   /note="gene_id=mCG1044180.1"
FT   mRNA            complement(8683667..8684021)
FT                   /pseudo
FT                   /locus_tag="mCG_1044180"
FT                   /note="gene_id=mCG1044180.1 transcript_id=mCT161884.1
FT                   created on 06-NOV-2002"
FT   gene            8870479..8877156
FT                   /gene="Egr2"
FT                   /locus_tag="mCG_10496"
FT                   /note="gene_id=mCG10496.2"
FT   mRNA            join(8870479..8870527,8870630..8870735,8873250..8873358,
FT                   8874714..8877156)
FT                   /gene="Egr2"
FT                   /locus_tag="mCG_10496"
FT                   /product="early growth response 2, transcript variant
FT                   mCT175459"
FT                   /note="gene_id=mCG10496.2 transcript_id=mCT175459.0 created
FT                   on 06-NOV-2002"
FT   CDS             join(8870637..8870735,8873250..8873358,8874714..8875957)
FT                   /codon_start=1
FT                   /gene="Egr2"
FT                   /locus_tag="mCG_10496"
FT                   /product="early growth response 2, isoform CRA_b"
FT                   /note="gene_id=mCG10496.2 transcript_id=mCT175459.0
FT                   protein_id=mCP98377.0 isoform=CRA_b"
FT                   /protein_id="EDL32026.1"
FT                   /translation="MRVGLPTEASSCLWSARGPRDWPERRRSGLAHVLPDSLYPVEDLA
FT                   ASSVTIFPNGELGGPFDQMNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFT
FT                   YMGKFSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLG
FT                   VCTMSQTQPELDHLYSPPPPPPPYSGCTGDLYQDPSAFLSPPSTTSTSSLAYQPPPSYP
FT                   SPKPAMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTI
FT                   RNFTLGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRP
FT                   SKTPVHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHI
FT                   RTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQ
FT                   AGGSLCGNSAIGGPLASCTSRTRTP"
FT   mRNA            join(8872847..8873358,8874714..8877156)
FT                   /gene="Egr2"
FT                   /locus_tag="mCG_10496"
FT                   /product="early growth response 2, transcript variant
FT                   mCT11003"
FT                   /note="gene_id=mCG10496.2 transcript_id=mCT11003.2 created
FT                   on 06-NOV-2002"
FT   mRNA            join(8872847..8873149,8873250..8873358,8874714..8877156)
FT                   /gene="Egr2"
FT                   /locus_tag="mCG_10496"
FT                   /product="early growth response 2, transcript variant
FT                   mCT175458"
FT                   /note="gene_id=mCG10496.2 transcript_id=mCT175458.0 created
FT                   on 06-NOV-2002"
FT   CDS             join(8873190..8873358,8874714..8875957)
FT                   /codon_start=1
FT                   /gene="Egr2"
FT                   /locus_tag="mCG_10496"
FT                   /product="early growth response 2, isoform CRA_c"
FT                   /note="gene_id=mCG10496.2 transcript_id=mCT11003.2
FT                   protein_id=mCP9517.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3U207"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR021849"
FT                   /db_xref="MGI:MGI:95296"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U207"
FT                   /protein_id="EDL32027.1"
FT                   /translation="MMTAKAVDKIPVTLSGFMHQLPDSLYPVEDLAASSVTIFPNGELG
FT                   GPFDQMNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGKFSIDPQYPG
FT                   ASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCTMSQTQPELDH
FT                   LYSPPPPPPPYSGCTGDLYQDPSAFLSPPSTTSTSSLAYQPPPSYPSPKPAMDPGLIPM
FT                   IPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFTLGGPGAGVT
FT                   GPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCP
FT                   AEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDY
FT                   CGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGSLCGNSAIGG
FT                   PLASCTSRTRTP"
FT   CDS             join(8873340..8873358,8874714..8875957)
FT                   /codon_start=1
FT                   /gene="Egr2"
FT                   /locus_tag="mCG_10496"
FT                   /product="early growth response 2, isoform CRA_a"
FT                   /note="gene_id=mCG10496.2 transcript_id=mCT175458.0
FT                   protein_id=mCP98378.0 isoform=CRA_a"
FT                   /protein_id="EDL32025.1"
FT                   /translation="MNGVAGDGMINIDMTGEKRPLDLPYPSSFAPISAPRNQTFTYMGK
FT                   FSIDPQYPGASCYPEGIINIVSAGILQGVTPPASTTASSSVTSASPNPLATGPLGVCTM
FT                   SQTQPELDHLYSPPPPPPPYSGCTGDLYQDPSAFLSPPSTTSTSSLAYQPPPSYPSPKP
FT                   AMDPGLIPMIPDYPGFFPSPCQRDPHGAAGPDRKPFPCPLDSLRVPPPLTPLSTIRNFT
FT                   LGGPGAGVTGPGASGGGEGPRLPGSGSAAVTATPYNPHHLPLRPILRPRKYPNRPSKTP
FT                   VHERPYPCPAEGCDRRFSRSDELTRHIRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHT
FT                   GEKPFACDYCGRKFARSDERKRHTKIHLRQKERKSSAPSAPPSAQSSASGPGGSQAGGS
FT                   LCGNSAIGGPLASCTSRTRTP"
FT   gene            complement(8879254..8882467)
FT                   /locus_tag="mCG_1044209"
FT                   /note="gene_id=mCG1044209.1"
FT   mRNA            complement(8879254..8882467)
FT                   /locus_tag="mCG_1044209"
FT                   /product="mCG1044209"
FT                   /note="gene_id=mCG1044209.1 transcript_id=mCT161913.1
FT                   created on 06-NOV-2002"
FT   CDS             complement(8882150..8882350)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044209"
FT                   /product="mCG1044209"
FT                   /note="gene_id=mCG1044209.1 transcript_id=mCT161913.1
FT                   protein_id=mCP55347.1"
FT                   /protein_id="EDL32024.1"
FT                   /translation="MSFLPWLGSHFWCTQVTFSKKVTYANSLVRPLKLVFPLGLKICRL
FT                   NKFFCCYWGFAFKAKTIIILS"
FT   gene            complement(8882605..8884080)
FT                   /locus_tag="mCG_51191"
FT                   /note="gene_id=mCG51191.2"
FT   mRNA            complement(8882605..8884080)
FT                   /locus_tag="mCG_51191"
FT                   /product="mCG51191"
FT                   /note="gene_id=mCG51191.2 transcript_id=mCT51374.2 created
FT                   on 06-NOV-2002"
FT   CDS             complement(8882972..8883742)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51191"
FT                   /product="mCG51191"
FT                   /note="gene_id=mCG51191.2 transcript_id=mCT51374.2
FT                   protein_id=mCP31676.2"
FT                   /protein_id="EDL32023.1"
FT                   /translation="MPRDNMASLIQRIARQACLTFRGSSTGSEGPAPGFPENLSLLKSL
FT                   LTQVRAEDLNIAPRKALPQPLPRNLPPVTYMHIYETEGFSLGVFLLKSGTCIPLHDHPG
FT                   MHGMLKVLYGTVRISCMDKLDTGAGHRRPPPEQQFEPPLQPLEREAVRPGVLRSRAEYT
FT                   EASGPCVLTPHRDNLHQIDAVDGPAAFLDILAPPYDPEDGRDCHYYRVVEPIRPKEASG
FT                   SACDLPREVWLLETPQADDFWCEGEPYPGPKVLP"
FT   gene            8910848..8921365
FT                   /locus_tag="mCG_57126"
FT                   /note="gene_id=mCG57126.2"
FT   mRNA            join(8910848..8911041,8913086..8913227,8917594..8917707,
FT                   8921326..8921365)
FT                   /locus_tag="mCG_57126"
FT                   /product="mCG57126"
FT                   /note="gene_id=mCG57126.2 transcript_id=mCT57309.2 created
FT                   on 06-NOV-2002"
FT   CDS             join(8913168..8913227,8917594..8917707,8921326..8921334)
FT                   /codon_start=1
FT                   /locus_tag="mCG_57126"
FT                   /product="mCG57126"
FT                   /note="gene_id=mCG57126.2 transcript_id=mCT57309.2
FT                   protein_id=mCP31692.2"
FT                   /protein_id="EDL32022.1"
FT                   /translation="MHLFSLKYRMARGPLVIFSQGAARSYKPETVMVGPTKKGMMGNCP
FT                   SNTGALGAAPCQQVA"
FT   gene            9000182..9002276
FT                   /locus_tag="mCG_1044307"
FT                   /note="gene_id=mCG1044307.1"
FT   mRNA            join(9000182..9000492,9001530..9002276)
FT                   /locus_tag="mCG_1044307"
FT                   /product="mCG1044307"
FT                   /note="gene_id=mCG1044307.1 transcript_id=mCT162011.1
FT                   created on 06-NOV-2002"
FT   CDS             join(9000456..9000492,9001530..9001639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044307"
FT                   /product="mCG1044307"
FT                   /note="gene_id=mCG1044307.1 transcript_id=mCT162011.1
FT                   protein_id=mCP55084.1"
FT                   /protein_id="EDL32021.1"
FT                   /translation="MSKAEHQLKRRTARRSLNKRNSTVRGNQLLGLERKRKMIPCLSMV
FT                   LKT"
FT   gene            complement(9043348..9052805)
FT                   /locus_tag="mCG_141454"
FT                   /note="gene_id=mCG141454.0"
FT   mRNA            complement(join(9043348..9043494,9051345..9051451,
FT                   9052333..9052805))
FT                   /locus_tag="mCG_141454"
FT                   /product="mCG141454"
FT                   /note="gene_id=mCG141454.0 transcript_id=mCT175467.0
FT                   created on 06-NOV-2002"
FT   CDS             complement(9052481..9052573)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141454"
FT                   /product="mCG141454"
FT                   /note="gene_id=mCG141454.0 transcript_id=mCT175467.0
FT                   protein_id=mCP98386.0"
FT                   /protein_id="EDL32020.1"
FT                   /translation="MEVSMGSTHLAPPTWFHTVYCAEDSAGISA"
FT   gene            9120620..9121581
FT                   /locus_tag="mCG_57129"
FT                   /note="gene_id=mCG57129.2"
FT   mRNA            9120620..9121581
FT                   /locus_tag="mCG_57129"
FT                   /product="mCG57129"
FT                   /note="gene_id=mCG57129.2 transcript_id=mCT57312.2 created
FT                   on 06-NOV-2002"
FT   CDS             9121334..9121510
FT                   /codon_start=1
FT                   /locus_tag="mCG_57129"
FT                   /product="mCG57129"
FT                   /note="gene_id=mCG57129.2 transcript_id=mCT57312.2
FT                   protein_id=mCP31682.2"
FT                   /protein_id="EDL32019.1"
FT                   /translation="MGAMVELEETPSASGSIGIKKVTPDFSSYRGQWVTKCCRPSEKIT
FT                   VDSIGILDMASTF"
FT   gene            complement(9127670..9128088)
FT                   /pseudo
FT                   /locus_tag="mCG_55562"
FT                   /note="gene_id=mCG55562.2"
FT   mRNA            complement(9127670..9128088)
FT                   /pseudo
FT                   /locus_tag="mCG_55562"
FT                   /note="gene_id=mCG55562.2 transcript_id=mCT55745.2 created
FT                   on 06-NOV-2002"
FT   gene            complement(9223546..9250001)
FT                   /gene="Zfp365"
FT                   /locus_tag="mCG_10493"
FT                   /note="gene_id=mCG10493.2"
FT   mRNA            complement(join(9223546..9226532,9227390..9227427,
FT                   9234897..9235077,9246673..9247431,9249848..9250001))
FT                   /gene="Zfp365"
FT                   /locus_tag="mCG_10493"
FT                   /product="zinc finger protein 365"
FT                   /note="gene_id=mCG10493.2 transcript_id=mCT11000.2 created
FT                   on 06-NOV-2002"
FT   CDS             complement(join(9226271..9226532,9227390..9227427,
FT                   9234897..9235077,9246673..9247418))
FT                   /codon_start=1
FT                   /gene="Zfp365"
FT                   /locus_tag="mCG_10493"
FT                   /product="zinc finger protein 365"
FT                   /note="gene_id=mCG10493.2 transcript_id=mCT11000.2
FT                   protein_id=mCP9523.2"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:2143676"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXU5"
FT                   /protein_id="EDL32018.1"
FT                   /translation="MQQTTFEESRYHWQDSLENVAVCLPFRCPRCGDHTRFRSLSSLRA
FT                   HLEFSHSYEERTLLTKCSLLPSLKDTELLRSSELPKQGKVLRGHAKVTKQKPSYVNLYS
FT                   ISHGHSKDTKPFEMVAERPVSYVQTYTAVDIRADSLDAPCASPGLPTQDTKAAFEAHVR
FT                   EKFNRMVEAVDRTIEKRIDKLTKELAQKTAELLEVRAAFAQLTQKKQEVQRRERALNKQ
FT                   VDVAVEMIAVLKQRLTESEEELLRKEEEVVTFNHFLEAAAEKEVQGKARLQDFIENLLQ
FT                   RVELAEKQLEYYQSQQASGFSCDTSEHMLTDIPSNRKPRCLSRGHQHSVCNHPELRAHF
FT                   HLKGRSYLKKAKDERAGMQPAKAIHEPAESPREFFRPAKKGEHLGLSRKGNFRPKMAKK
FT                   KPTAIVNII"
FT   gene            complement(9301647..9310799)
FT                   /locus_tag="mCG_148083"
FT                   /note="gene_id=mCG148083.0"
FT   mRNA            complement(join(9301647..9301924,9310597..9310799))
FT                   /locus_tag="mCG_148083"
FT                   /product="mCG148083"
FT                   /note="gene_id=mCG148083.0 transcript_id=mCT188346.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(9301864..9301924,9310597..9310643))
FT                   /codon_start=1
FT                   /locus_tag="mCG_148083"
FT                   /product="mCG148083"
FT                   /note="gene_id=mCG148083.0 transcript_id=mCT188346.0
FT                   protein_id=mCP108313.0"
FT                   /protein_id="EDL32017.1"
FT                   /translation="MKTRCGTEVEPCCIGVGNNFREPSKAFTFKADLEQ"
FT   gene            9318877..9402728
FT                   /locus_tag="mCG_142775"
FT                   /note="gene_id=mCG142775.0"
FT   mRNA            join(9318877..9319120,9326595..9326791,9336948..9337006,
FT                   9341281..9341334,9342569..9342686,9344919..9345113,
FT                   9357144..9357238,9364899..9365005,9365906..9366037,
FT                   9377639..9377801,9382358..9382465,9383835..9385707,
FT                   9386392..9386587,9400876..9401248,9402104..9402728)
FT                   /locus_tag="mCG_142775"
FT                   /product="mCG142775, transcript variant mCT182169"
FT                   /note="gene_id=mCG142775.0 transcript_id=mCT182169.0
FT                   created on 11-JUN-2003"
FT   mRNA            join(9318877..9319120,9326595..9326800,9336948..9337006,
FT                   9341281..9341334,9342569..9342686,9344919..9345113,
FT                   9357144..9357238,9364899..9365005,9365906..9366037,
FT                   9377639..9377801,9382358..9382465,9383835..9386309)
FT                   /locus_tag="mCG_142775"
FT                   /product="mCG142775, transcript variant mCT182168"
FT                   /note="gene_id=mCG142775.0 transcript_id=mCT182168.0
FT                   created on 11-JUN-2003"
FT   CDS             join(9319082..9319120,9326595..9326800,9336948..9337006,
FT                   9341281..9341334,9342569..9342686,9344919..9345113,
FT                   9357144..9357238,9364899..9365005,9365906..9366037,
FT                   9377639..9377801,9382358..9382465,9383835..9384373)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142775"
FT                   /product="mCG142775, isoform CRA_a"
FT                   /note="gene_id=mCG142775.0 transcript_id=mCT182168.0
FT                   protein_id=mCP105089.0 isoform=CRA_a"
FT                   /protein_id="EDL32015.1"
FT                   /translation="MEGQLLRGLAAQQDCSIREKIDLEIRMREGIWKLLSLSTKKDQVL
FT                   HAVKNLMVCSARIQAYTAELQKSKEEIANQTGARLVLDSSSENKEGESCRGKIALSDIR
FT                   IPLMWKDSDHFSNKECTQRFAIFCLFRMGAQVFDTDMVIVDQTVTDICFENVTIFNEAG
FT                   PDFQIKIEVYSCSAEESSLTNTPRKLAKKLKTSISKATGRKISAALQEESPEACLLAGS
FT                   VAGAKYHLLAHTTLTLENAGDCFKTHNLSVHGDEECSFWLPLYGNVCCRLVAQPACMAA
FT                   DAFAGFLNEQQTGKGLVGWRRLYCALRGGKLRCFYGPEEIEAKVEPALVVPIDKETRIQ
FT                   AVEKDSKKMHCFSVLSTAAGRAVSHIFAADSLADFQEWMGAFRQHFFDLSQWKHCCEEL
FT                   MRIEIMSPRKPPLFLAKEATSVYYDMSIDSPVKLESVTDIIQKKIGETNGQFLIGRDDQ
FT                   SAAPPWAAVFDGNHEMVIEKKVLSPTGEPAPDGKRKKRRAPLPPTDQPPFCIKTQGSAN
FT                   QSKDSATQAGVSGASPLPSDPRLLLPTHHLQKPVAAPRKLLPARKNSSADIGHTDTKTS
FT                   LDAKPVPVPRQKSIRDILDPRSWLQAQV"
FT   CDS             join(9319082..9319120,9326595..9326791,9336948..9337006,
FT                   9341281..9341334,9342569..9342686,9344919..9345113,
FT                   9357144..9357238,9364899..9365005,9365906..9366037,
FT                   9377639..9377801,9382358..9382465,9383835..9384373)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142775"
FT                   /product="mCG142775, isoform CRA_b"
FT                   /note="gene_id=mCG142775.0 transcript_id=mCT182169.0
FT                   protein_id=mCP105088.0 isoform=CRA_b"
FT                   /protein_id="EDL32016.1"
FT                   /translation="MEGQLLRGLAAQQDCSIREKIDLEIRMREGIWKLLSLSTKKDQVL
FT                   HAVKNLMVCSARIQAYTAELQKSKEEIANQTGARDSSSENKEGESCRGKIALSDIRIPL
FT                   MWKDSDHFSNKECTQRFAIFCLFRMGAQVFDTDMVIVDQTVTDICFENVTIFNEAGPDF
FT                   QIKIEVYSCSAEESSLTNTPRKLAKKLKTSISKATGRKISAALQEESPEACLLAGSVAG
FT                   AKYHLLAHTTLTLENAGDCFKTHNLSVHGDEECSFWLPLYGNVCCRLVAQPACMAADAF
FT                   AGFLNEQQTGKGLVGWRRLYCALRGGKLRCFYGPEEIEAKVEPALVVPIDKETRIQAVE
FT                   KDSKKMHCFSVLSTAAGRAVSHIFAADSLADFQEWMGAFRQHFFDLSQWKHCCEELMRI
FT                   EIMSPRKPPLFLAKEATSVYYDMSIDSPVKLESVTDIIQKKIGETNGQFLIGRDDQSAA
FT                   PPWAAVFDGNHEMVIEKKVLSPTGEPAPDGKRKKRRAPLPPTDQPPFCIKTQGSANQSK
FT                   DSATQAGVSGASPLPSDPRLLLPTHHLQKPVAAPRKLLPARKNSSADIGHTDTKTSLDA
FT                   KPVPVPRQKSIRDILDPRSWLQAQV"
FT   gene            complement(9438200..>9585594)
FT                   /gene="Arid5b"
FT                   /locus_tag="mCG_18928"
FT                   /note="gene_id=mCG18928.3"
FT   mRNA            complement(join(9438200..9440853,9444113..9444311,
FT                   9460743..9460840,9469161..9469213,9471260..9471464,
FT                   9477461..9477573,9481113..9481248,9528555..9528785,
FT                   9585362..>9585594))
FT                   /gene="Arid5b"
FT                   /locus_tag="mCG_18928"
FT                   /product="AT rich interactive domain 5B (Mrf1 like),
FT                   transcript variant mCT192984"
FT                   /note="gene_id=mCG18928.3 transcript_id=mCT192984.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(9438203..9440853,9444113..9444311,
FT                   9460743..9460840,9469161..9469213,9471260..9471464,
FT                   9477461..9477573,9528555..9528785,9585362..>9585589))
FT                   /gene="Arid5b"
FT                   /locus_tag="mCG_18928"
FT                   /product="AT rich interactive domain 5B (Mrf1 like),
FT                   transcript variant mCT16310"
FT                   /note="gene_id=mCG18928.3 transcript_id=mCT16310.2 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(9438203..9440853,9444113..9444311,
FT                   9460743..9460840,9469161..9469213,9471260..9471464,
FT                   9477461..9477573,9478950..9479090))
FT                   /gene="Arid5b"
FT                   /locus_tag="mCG_18928"
FT                   /product="AT rich interactive domain 5B (Mrf1 like),
FT                   transcript variant mCT173620"
FT                   /note="gene_id=mCG18928.3 transcript_id=mCT173620.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(9438688..9440853,9444113..9444311,
FT                   9460743..9460840,9469161..9469213,9471260..9471464,
FT                   9477461..9477573,9528555..9528785,9585362..>9585587))
FT                   /codon_start=1
FT                   /gene="Arid5b"
FT                   /locus_tag="mCG_18928"
FT                   /product="AT rich interactive domain 5B (Mrf1 like),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG18928.3 transcript_id=mCT16310.2
FT                   protein_id=mCP9514.2 isoform=CRA_c"
FT                   /protein_id="EDL32014.1"
FT                   /translation="DEVIAVSEKVIVKLEDLVKWAHSDFSKWRCGLRATPVKTEAFGRN
FT                   GQKEALLRYRQSTLNSGLNFKDVLKEKADLGEDEEETNVIVLSYPQYCRYRSMLKRIQD
FT                   KPSSILTDQFALALGGIAVVSRNPQILYCRDTFDHPTLIENESVCDEFAPNLKGRPRKK
FT                   KTCPQRRDSFSGSKDPNNNCDGKVISKVKGEARSALTKPKNNHNNCKKTSNEEKPKLSI
FT                   GEECRADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARR
FT                   QWKHIYDELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRKQENNTQE
FT                   NENKTKVSGNKRIKQEMAKNKKEKENTPKPQDTSEVSSEQREEEETLSHKSAPEPLPAP
FT                   EVKGKPEGHKDLGARAPVSRADPEKANETDQGSNSEKEAEEMGDKGLAPLLPSPPLPPE
FT                   KDSAPTPGAGKQPLASPSTQMDSKQEAKPCCFTESPEKDLQGAPFSSFSATKPPLTSQN
FT                   EAEEEQLPATANYIANCTVKVDQLGSDDIHTALKQTPKVLVVQSFDMFKDKDLTGPMNE
FT                   NHGLNYTPLLYSRGNPGIMSPLAKKKLLSQVSGASLSSSYPYGSPPPLISKKKLIARED
FT                   LCSGLSQGHHSQSSDHTAVSRPSVIQHVQSFKNKASEDRKSINDIFKHDKLSRSDAHRC
FT                   GFSKHQLGSLADSYILKQETQEGKDKLLEKRAVSHAHVPSFLADFYSSPHLHSLYRHTE
FT                   HHLHNEQSSKYAARDAYQESENGAFLSHKHPEKIHVNYLASLHLQDKKVAAAEASTDDQ
FT                   PTDLSLPKNPHKLTSKVLGLAHSASGSQEIKGASQFQVVSNQSRDCHPKACRVSPMTMS
FT                   GPKKYPESLARSGKPHQVRLENFRKMEGMVHPILHRKMSPQNIGAARPIKRSLEDLDLV
FT                   IAGKKARAVSPLDPAKEASGKEKASEQESEGNKSAYGGHSGAASEGHKLPLSTPIFPGL
FT                   YSGSLCNSGLNSRLPAGYSHSLQYLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQL
FT                   YRHLAAATPVGSSYGDLLHNSIYPLAGINPQAAFPSSQLSSVHPSTKL"
FT   CDS             complement(join(9438688..9440853,9444113..9444311,
FT                   9460743..9460840,9469161..9469213,9471260..9471464,
FT                   9477461..9477573,9481113..>9481146))
FT                   /codon_start=1
FT                   /gene="Arid5b"
FT                   /locus_tag="mCG_18928"
FT                   /product="AT rich interactive domain 5B (Mrf1 like),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18928.3 transcript_id=mCT192984.0
FT                   protein_id=mCP113960.0 isoform=CRA_b"
FT                   /protein_id="EDL32013.1"
FT                   /translation="EKERSPRSMHKTPNLKGRPRKKKTCPQRRDSFSGSKDPNNNCDGK
FT                   VISKVKGEARSALTKPKNNHNNCKKTSNEEKPKLSIGEECRADEQAFLVALYKYMKERK
FT                   TPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTR
FT                   RHYERLILPYERFIKGEEDKPLPPIKPRKQENNTQENENKTKVSGNKRIKQEMAKNKKE
FT                   KENTPKPQDTSEVSSEQREEEETLSHKSAPEPLPAPEVKGKPEGHKDLGARAPVSRADP
FT                   EKANETDQGSNSEKEAEEMGDKGLAPLLPSPPLPPEKDSAPTPGAGKQPLASPSTQMDS
FT                   KQEAKPCCFTESPEKDLQGAPFSSFSATKPPLTSQNEAEEEQLPATANYIANCTVKVDQ
FT                   LGSDDIHTALKQTPKVLVVQSFDMFKDKDLTGPMNENHGLNYTPLLYSRGNPGIMSPLA
FT                   KKKLLSQVSGASLSSSYPYGSPPPLISKKKLIAREDLCSGLSQGHHSQSSDHTAVSRPS
FT                   VIQHVQSFKNKASEDRKSINDIFKHDKLSRSDAHRCGFSKHQLGSLADSYILKQETQEG
FT                   KDKLLEKRAVSHAHVPSFLADFYSSPHLHSLYRHTEHHLHNEQSSKYAARDAYQESENG
FT                   AFLSHKHPEKIHVNYLASLHLQDKKVAAAEASTDDQPTDLSLPKNPHKLTSKVLGLAHS
FT                   ASGSQEIKGASQFQVVSNQSRDCHPKACRVSPMTMSGPKKYPESLARSGKPHQVRLENF
FT                   RKMEGMVHPILHRKMSPQNIGAARPIKRSLEDLDLVIAGKKARAVSPLDPAKEASGKEK
FT                   ASEQESEGNKSAYGGHSGAASEGHKLPLSTPIFPGLYSGSLCNSGLNSRLPAGYSHSLQ
FT                   YLKNQTVLSPLMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIY
FT                   PLAGINPQAAFPSSQLSSVHPSTKL"
FT   CDS             complement(join(9438688..9440853,9444113..9444311,
FT                   9460743..9460840,9469161..9469213,9471260..9471464,
FT                   9477461..9477573,9478950..9478953))
FT                   /codon_start=1
FT                   /gene="Arid5b"
FT                   /locus_tag="mCG_18928"
FT                   /product="AT rich interactive domain 5B (Mrf1 like),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18928.3 transcript_id=mCT173620.0
FT                   protein_id=mCP96539.0 isoform=CRA_a"
FT                   /protein_id="EDL32012.1"
FT                   /translation="MAPNLKGRPRKKKTCPQRRDSFSGSKDPNNNCDGKVISKVKGEAR
FT                   SALTKPKNNHNNCKKTSNEEKPKLSIGEECRADEQAFLVALYKYMKERKTPIERIPYLG
FT                   FKQINLWTMFQAAQKLGGYETITARRQWKHIYDELGGNPGSTSAATCTRRHYERLILPY
FT                   ERFIKGEEDKPLPPIKPRKQENNTQENENKTKVSGNKRIKQEMAKNKKEKENTPKPQDT
FT                   SEVSSEQREEEETLSHKSAPEPLPAPEVKGKPEGHKDLGARAPVSRADPEKANETDQGS
FT                   NSEKEAEEMGDKGLAPLLPSPPLPPEKDSAPTPGAGKQPLASPSTQMDSKQEAKPCCFT
FT                   ESPEKDLQGAPFSSFSATKPPLTSQNEAEEEQLPATANYIANCTVKVDQLGSDDIHTAL
FT                   KQTPKVLVVQSFDMFKDKDLTGPMNENHGLNYTPLLYSRGNPGIMSPLAKKKLLSQVSG
FT                   ASLSSSYPYGSPPPLISKKKLIAREDLCSGLSQGHHSQSSDHTAVSRPSVIQHVQSFKN
FT                   KASEDRKSINDIFKHDKLSRSDAHRCGFSKHQLGSLADSYILKQETQEGKDKLLEKRAV
FT                   SHAHVPSFLADFYSSPHLHSLYRHTEHHLHNEQSSKYAARDAYQESENGAFLSHKHPEK
FT                   IHVNYLASLHLQDKKVAAAEASTDDQPTDLSLPKNPHKLTSKVLGLAHSASGSQEIKGA
FT                   SQFQVVSNQSRDCHPKACRVSPMTMSGPKKYPESLARSGKPHQVRLENFRKMEGMVHPI
FT                   LHRKMSPQNIGAARPIKRSLEDLDLVIAGKKARAVSPLDPAKEASGKEKASEQESEGNK
FT                   SAYGGHSGAASEGHKLPLSTPIFPGLYSGSLCNSGLNSRLPAGYSHSLQYLKNQTVLSP
FT                   LMQPLAFHSLVMQRGIFTSPTNSQQLYRHLAAATPVGSSYGDLLHNSIYPLAGINPQAA
FT                   FPSSQLSSVHPSTKL"
FT   gene            9612129..>9631404
FT                   /locus_tag="mCG_148088"
FT                   /note="gene_id=mCG148088.0"
FT   mRNA            join(9612129..9613643,9631373..>9631404)
FT                   /locus_tag="mCG_148088"
FT                   /product="mCG148088"
FT                   /note="gene_id=mCG148088.0 transcript_id=mCT188351.0
FT                   created on 13-JAN-2004"
FT   CDS             join(9613406..9613643,9631373..>9631404)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148088"
FT                   /product="mCG148088"
FT                   /note="gene_id=mCG148088.0 transcript_id=mCT188351.0
FT                   protein_id=mCP108318.0"
FT                   /protein_id="EDL32011.1"
FT                   /translation="MCLDFPPNFSVLSIIPIFWEKKLRLRFLQLSKVKLRLSCRIEMCL
FT                   FSLSFSLSLFLPPHVCECERERERERERERERERERERERERERE"
FT   gene            9652140..9666664
FT                   /locus_tag="mCG_148080"
FT                   /note="gene_id=mCG148080.0"
FT   mRNA            join(9652140..9652344,9664637..9666664)
FT                   /locus_tag="mCG_148080"
FT                   /product="mCG148080"
FT                   /note="gene_id=mCG148080.0 transcript_id=mCT188343.0
FT                   created on 13-JAN-2004"
FT   gene            complement(9658733..>9660804)
FT                   /locus_tag="mCG_146039"
FT                   /note="gene_id=mCG146039.0"
FT   mRNA            complement(join(9658733..9658904,9659858..9660362,
FT                   9660719..>9660804))
FT                   /locus_tag="mCG_146039"
FT                   /product="mCG146039"
FT                   /note="gene_id=mCG146039.0 transcript_id=mCT186147.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(9658798..9658904,9659858..>9659969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146039"
FT                   /product="mCG146039"
FT                   /note="gene_id=mCG146039.0 transcript_id=mCT186147.0
FT                   protein_id=mCP107463.0"
FT                   /protein_id="EDL32010.1"
FT                   /translation="ELNLDPGEEQAVLSTSEPRLQLLSDYQPGIRLLTSVQVILHEEER
FT                   PSLECGEVSREDFMAFHKFLLASETAK"
FT   CDS             9664681..9664872
FT                   /codon_start=1
FT                   /locus_tag="mCG_148080"
FT                   /product="mCG148080"
FT                   /note="gene_id=mCG148080.0 transcript_id=mCT188343.0
FT                   protein_id=mCP108311.0"
FT                   /protein_id="EDL32009.1"
FT                   /translation="MPMFRNQRPEWSVQPASSRCLASGETALGDSVSLYLPAPVNELLN
FT                   FFLVCKILCEEYSPKLCA"
FT   gene            complement(9771145..9881740)
FT                   /gene="1700040L02Rik"
FT                   /locus_tag="mCG_18925"
FT                   /note="gene_id=mCG18925.2"
FT   mRNA            complement(join(9771145..9771515,9776472..9776612,
FT                   9777035..9777157,9849494..9849566,9856173..9856317,
FT                   9865505..9865674,9873676..9873764,9881611..9881740))
FT                   /gene="1700040L02Rik"
FT                   /locus_tag="mCG_18925"
FT                   /product="RIKEN cDNA 1700040L02"
FT                   /note="gene_id=mCG18925.2 transcript_id=mCT16085.1 created
FT                   on 05-NOV-2002"
FT   CDS             complement(join(9771441..9771515,9776472..9776612,
FT                   9777035..9777157,9849494..9849566,9856173..9856317,
FT                   9865505..9865674,9873676..9873764,9881611..9881721))
FT                   /codon_start=1
FT                   /gene="1700040L02Rik"
FT                   /locus_tag="mCG_18925"
FT                   /product="RIKEN cDNA 1700040L02"
FT                   /note="gene_id=mCG18925.2 transcript_id=mCT16085.1
FT                   protein_id=mCP9516.1"
FT                   /protein_id="EDL32008.1"
FT                   /translation="MKAASSKENVSGSSTGLTSWALTTPGVSPVGSTSDSEENERILSP
FT                   DILSSDQIIDLLGEENENGIQEKLGVFLNFKNLQTCLRDAILLDYYVSGFCWAKEMNFS
FT                   IEQYSKFMTLLDMLLHNLQTLHMSLEDSIKWLGEVMAEIGPNHSQKSEDFHVFEVKEAN
FT                   AIIDYLKISLFQHYRLYEFLFYSTREEIVIGTEQTIEVVKPADYPFPAPLEEGISLDTY
FT                   STFIEPLPTPDMEQKVLDQEQGTQEALLESEMREEDPLGGFTIDDVKSALERVTDEVLI
FT                   SMQKEISEKLQVQEEAFNARIEKLKKA"
FT   gene            complement(10032483..10033346)
FT                   /pseudo
FT                   /locus_tag="mCG_18926"
FT                   /note="gene_id=mCG18926.1"
FT   mRNA            complement(10032483..10033346)
FT                   /pseudo
FT                   /locus_tag="mCG_18926"
FT                   /note="gene_id=mCG18926.1 transcript_id=mCT16086.1 created
FT                   on 05-NOV-2002"
FT   gene            10065219..10119949
FT                   /gene="Tmem26"
FT                   /locus_tag="mCG_1044208"
FT                   /note="gene_id=mCG1044208.1"
FT   mRNA            join(10065219..10065663,10082494..10082572,
FT                   10089819..10089932,10092551..10092771,10114610..10114686,
FT                   10117741..10119949)
FT                   /gene="Tmem26"
FT                   /locus_tag="mCG_1044208"
FT                   /product="transmembrane protein 26"
FT                   /note="gene_id=mCG1044208.1 transcript_id=mCT175456.1
FT                   created on 16-JUN-2003"
FT   CDS             join(10065473..10065663,10082494..10082572,
FT                   10089819..10089932,10092551..10092771,10114610..10114686,
FT                   10117741..10118159)
FT                   /codon_start=1
FT                   /gene="Tmem26"
FT                   /locus_tag="mCG_1044208"
FT                   /product="transmembrane protein 26"
FT                   /note="gene_id=mCG1044208.1 transcript_id=mCT175456.1
FT                   protein_id=mCP98375.1"
FT                   /protein_id="EDL32007.1"
FT                   /translation="MEGLVLLKALVTRLLFLLHSLVAVWRVTWVKEEHRYWLLALLNLL
FT                   LVLETVLTLKFKRGRGYKWLSPAIFVYLVNIMPSLWLLEMHHGNQYCSTQSERMAQNFS
FT                   RRGDVNQTLSSHRATNGMGNILELARGFVDNLSMVCEPVWTLGLHQTLLLILIIGRWLL
FT                   PIGGTITRDQLSELLLMFVGTAADILEFTTETLKENNVRTNPTLVSGILVVWTWSMLQF
FT                   PLDLAVQLKLVCPASVKARGFLRVFLCQYSADLWAIGLSFFIQDGPFLVVRLVLMIYFK
FT                   VINHMLVFFAVKNSLVMALHFYRLVALIMATRDFMRDHPESPKPEHSGPDQPSESGPSE
FT                   WEDASPEALPLRTSPVTSEESYPTTP"
FT   gene            complement(<10489242..>10492600)
FT                   /locus_tag="mCG_64517"
FT                   /note="gene_id=mCG64517.2"
FT   mRNA            complement(join(<10489242..10489392,10489645..10489754,
FT                   10492403..>10492600))
FT                   /locus_tag="mCG_64517"
FT                   /product="mCG64517"
FT                   /note="gene_id=mCG64517.2 transcript_id=mCT64700.2 created
FT                   on 01-NOV-2002"
FT   CDS             complement(join(<10489242..10489392,10489645..>10489738))
FT                   /codon_start=1
FT                   /locus_tag="mCG_64517"
FT                   /product="mCG64517"
FT                   /note="gene_id=mCG64517.2 transcript_id=mCT64700.2
FT                   protein_id=mCP37749.2"
FT                   /protein_id="EDL32006.1"
FT                   /translation="RQGTSEVIHCLPPVSGRQQVAGKDVSWKLNTGLPFGNPLSHPFFP
FT                   CLYEGAPLPTHSLLSSRAGLPLHRGIGHPQAHGPLLS"
FT   gene            10492739..10625217
FT                   /locus_tag="mCG_113695"
FT                   /note="gene_id=mCG113695.1"
FT   mRNA            join(10492739..10492796,10492851..10492956,
FT                   10496722..10496815,10555868..10555918,10582572..10582773,
FT                   10583393..10583496,10599588..10599773,10603272..10604242,
FT                   10606104..10606222,10612580..10612730,10619123..10619211,
FT                   10622386..10622491,10622956..10625217)
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, transcript variant mCT175043"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT175043.0
FT                   created on 01-NOV-2002"
FT   mRNA            join(10492739..10492796,10492851..10492942,
FT                   10496722..10496820,10582570..10582773,10583393..10583496,
FT                   10599588..10599773,10603272..10604242,10606104..10606222,
FT                   10612580..10612730,10619123..10619211,10622386..10622491,
FT                   10622956..10625217)
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, transcript variant mCT175045"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT175045.0
FT                   created on 01-NOV-2002"
FT   mRNA            join(10549096..10549156,10555868..10555918,
FT                   10582572..10582773,10583393..10583496,10599588..10599773,
FT                   10603272..10604242,10606104..10606222,10612580..10612730,
FT                   10619123..10619211,10622386..10622491,10622956..10625217)
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, transcript variant mCT175044"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT175044.0
FT                   created on 01-NOV-2002"
FT   gene            complement(10552470..10553570)
FT                   /locus_tag="mCG_1044298"
FT                   /note="gene_id=mCG1044298.1"
FT   mRNA            complement(join(10552470..10552926,10553224..10553570))
FT                   /locus_tag="mCG_1044298"
FT                   /product="mCG1044298"
FT                   /note="gene_id=mCG1044298.1 transcript_id=mCT162002.1
FT                   created on 31-OCT-2002"
FT   CDS             complement(join(10552868..10552926,10553224..10553476))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044298"
FT                   /product="mCG1044298"
FT                   /note="gene_id=mCG1044298.1 transcript_id=mCT162002.1
FT                   protein_id=mCP55343.1"
FT                   /db_xref="GOA:G5E8X6"
FT                   /db_xref="MGI:MGI:2444562"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8X6"
FT                   /protein_id="EDL32005.1"
FT                   /translation="MKPGPGVSELWDARWRRCCGCTHTGGAWAPGPGSACVPLPRGPGL
FT                   KPSGDQSRAGCVRAVPAPPPRSIPPTPEHPLALSPGLRKRNLGRENQFRGHCGLSSRL"
FT   mRNA            join(10553109..10553846,10555868..10555918,
FT                   10560015..10560107,10582572..10582773,10583393..10583496,
FT                   10599588..10599773,10603272..10604242,10606104..10606222,
FT                   10612580..10612730,10619123..10619211,10622386..10622491,
FT                   10622956..10625217)
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, transcript variant mCT114781"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT114781.1
FT                   created on 01-NOV-2002"
FT   mRNA            join(10553109..10553205,10555868..10555918,
FT                   10582572..10582773,10583393..10583496,10599588..10599773,
FT                   10603272..10604242,10606104..10606222,10612580..10612730,
FT                   10619123..10619211,10622386..10622491,10622956..10625217)
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, transcript variant mCT175046"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT175046.0
FT                   created on 01-NOV-2002"
FT   CDS             join(10582582..10582773,10583393..10583496,
FT                   10599588..10599773,10603272..10604242,10606104..10606222,
FT                   10612580..10612730,10619123..10619211,10622386..10622491,
FT                   10622956..10623125)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, isoform CRA_a"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT175043.0
FT                   protein_id=mCP97964.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DAK3"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1916538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAK3"
FT                   /protein_id="EDL32000.1"
FT                   /translation="MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQL
FT                   LATHVPTVWAIDQYRVCQEVLERSRDVVDEVSISLRLWDTFGDHHKDRRFAYGRSDVVV
FT                   LCFSIANPNSLNHVKTMWYQEIKHFCPRTPVVLVGCQLDLRYADLEAVNRARRPLARPI
FT                   KRGDILPPEKGREVAKELGIPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLK
FT                   KVQKPLLQAPFLPPKAPPPVIKVPECPSAGTSDAACLLDNPLCADVLFVLHDEEHIFAH
FT                   RIYLATSSSKFYDLFLMECEESPCWGGGAGEEVPCRDFQGRTQSLGSAEEGKEGPQRTP
FT                   QADPGASSGQDLPESLALQMEASGSEGHALSGWSKGFVSMHREVRVNPISKRVGPVTVV
FT                   RLDPSMQSGPFRTLLRFLYSGQLDEKEKDLLGLAQMAEVLEMFDLRMMVENIMNKEAFM
FT                   NQEITKAFHVRKANRIKECLSKGTFSDVTFTLDDGAISAHKPLLICSCEWMAAMFGGSF
FT                   VESANREVHLPNINKMSMQAVLEYLYTKQLSPNLDLDPLELIALANRFCLTHLVALVEQ
FT                   HAVQELTKAAVSGVSIDGEVLSYLELAQFHNANQLAAWCLHHICTNYNSVCSKFRKEIK
FT                   SKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDLALNKHHSRRKWCFWHSSPAV
FT                   A"
FT   CDS             join(10582582..10582773,10583393..10583496,
FT                   10599588..10599773,10603272..10604242,10606104..10606222,
FT                   10612580..10612730,10619123..10619211,10622386..10622491,
FT                   10622956..10623125)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, isoform CRA_a"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT175044.0
FT                   protein_id=mCP97963.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DAK3"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1916538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAK3"
FT                   /protein_id="EDL32001.1"
FT                   /translation="MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQL
FT                   LATHVPTVWAIDQYRVCQEVLERSRDVVDEVSISLRLWDTFGDHHKDRRFAYGRSDVVV
FT                   LCFSIANPNSLNHVKTMWYQEIKHFCPRTPVVLVGCQLDLRYADLEAVNRARRPLARPI
FT                   KRGDILPPEKGREVAKELGIPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLK
FT                   KVQKPLLQAPFLPPKAPPPVIKVPECPSAGTSDAACLLDNPLCADVLFVLHDEEHIFAH
FT                   RIYLATSSSKFYDLFLMECEESPCWGGGAGEEVPCRDFQGRTQSLGSAEEGKEGPQRTP
FT                   QADPGASSGQDLPESLALQMEASGSEGHALSGWSKGFVSMHREVRVNPISKRVGPVTVV
FT                   RLDPSMQSGPFRTLLRFLYSGQLDEKEKDLLGLAQMAEVLEMFDLRMMVENIMNKEAFM
FT                   NQEITKAFHVRKANRIKECLSKGTFSDVTFTLDDGAISAHKPLLICSCEWMAAMFGGSF
FT                   VESANREVHLPNINKMSMQAVLEYLYTKQLSPNLDLDPLELIALANRFCLTHLVALVEQ
FT                   HAVQELTKAAVSGVSIDGEVLSYLELAQFHNANQLAAWCLHHICTNYNSVCSKFRKEIK
FT                   SKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDLALNKHHSRRKWCFWHSSPAV
FT                   A"
FT   CDS             join(10582582..10582773,10583393..10583496,
FT                   10599588..10599773,10603272..10604242,10606104..10606222,
FT                   10612580..10612730,10619123..10619211,10622386..10622491,
FT                   10622956..10623125)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, isoform CRA_a"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT175045.0
FT                   protein_id=mCP97962.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DAK3"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1916538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAK3"
FT                   /protein_id="EDL32002.1"
FT                   /translation="MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQL
FT                   LATHVPTVWAIDQYRVCQEVLERSRDVVDEVSISLRLWDTFGDHHKDRRFAYGRSDVVV
FT                   LCFSIANPNSLNHVKTMWYQEIKHFCPRTPVVLVGCQLDLRYADLEAVNRARRPLARPI
FT                   KRGDILPPEKGREVAKELGIPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLK
FT                   KVQKPLLQAPFLPPKAPPPVIKVPECPSAGTSDAACLLDNPLCADVLFVLHDEEHIFAH
FT                   RIYLATSSSKFYDLFLMECEESPCWGGGAGEEVPCRDFQGRTQSLGSAEEGKEGPQRTP
FT                   QADPGASSGQDLPESLALQMEASGSEGHALSGWSKGFVSMHREVRVNPISKRVGPVTVV
FT                   RLDPSMQSGPFRTLLRFLYSGQLDEKEKDLLGLAQMAEVLEMFDLRMMVENIMNKEAFM
FT                   NQEITKAFHVRKANRIKECLSKGTFSDVTFTLDDGAISAHKPLLICSCEWMAAMFGGSF
FT                   VESANREVHLPNINKMSMQAVLEYLYTKQLSPNLDLDPLELIALANRFCLTHLVALVEQ
FT                   HAVQELTKAAVSGVSIDGEVLSYLELAQFHNANQLAAWCLHHICTNYNSVCSKFRKEIK
FT                   SKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDLALNKHHSRRKWCFWHSSPAV
FT                   A"
FT   CDS             join(10582582..10582773,10583393..10583496,
FT                   10599588..10599773,10603272..10604242,10606104..10606222,
FT                   10612580..10612730,10619123..10619211,10622386..10622491,
FT                   10622956..10623125)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, isoform CRA_a"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT114781.1
FT                   protein_id=mCP55301.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DAK3"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1916538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAK3"
FT                   /protein_id="EDL32003.1"
FT                   /translation="MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQL
FT                   LATHVPTVWAIDQYRVCQEVLERSRDVVDEVSISLRLWDTFGDHHKDRRFAYGRSDVVV
FT                   LCFSIANPNSLNHVKTMWYQEIKHFCPRTPVVLVGCQLDLRYADLEAVNRARRPLARPI
FT                   KRGDILPPEKGREVAKELGIPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLK
FT                   KVQKPLLQAPFLPPKAPPPVIKVPECPSAGTSDAACLLDNPLCADVLFVLHDEEHIFAH
FT                   RIYLATSSSKFYDLFLMECEESPCWGGGAGEEVPCRDFQGRTQSLGSAEEGKEGPQRTP
FT                   QADPGASSGQDLPESLALQMEASGSEGHALSGWSKGFVSMHREVRVNPISKRVGPVTVV
FT                   RLDPSMQSGPFRTLLRFLYSGQLDEKEKDLLGLAQMAEVLEMFDLRMMVENIMNKEAFM
FT                   NQEITKAFHVRKANRIKECLSKGTFSDVTFTLDDGAISAHKPLLICSCEWMAAMFGGSF
FT                   VESANREVHLPNINKMSMQAVLEYLYTKQLSPNLDLDPLELIALANRFCLTHLVALVEQ
FT                   HAVQELTKAAVSGVSIDGEVLSYLELAQFHNANQLAAWCLHHICTNYNSVCSKFRKEIK
FT                   SKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDLALNKHHSRRKWCFWHSSPAV
FT                   A"
FT   CDS             join(10582582..10582773,10583393..10583496,
FT                   10599588..10599773,10603272..10604242,10606104..10606222,
FT                   10612580..10612730,10619123..10619211,10622386..10622491,
FT                   10622956..10623125)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113695"
FT                   /product="mCG113695, isoform CRA_a"
FT                   /note="gene_id=mCG113695.1 transcript_id=mCT175046.0
FT                   protein_id=mCP97965.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9DAK3"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003578"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1916538"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DAK3"
FT                   /protein_id="EDL32004.1"
FT                   /translation="MDSDMDYERPNVETIKCVVVGDNAVGKTRLICARACNTTLTQYQL
FT                   LATHVPTVWAIDQYRVCQEVLERSRDVVDEVSISLRLWDTFGDHHKDRRFAYGRSDVVV
FT                   LCFSIANPNSLNHVKTMWYQEIKHFCPRTPVVLVGCQLDLRYADLEAVNRARRPLARPI
FT                   KRGDILPPEKGREVAKELGIPYYETSVFDQFGIKDVFDNAIRAALISRRHLQFWKSHLK
FT                   KVQKPLLQAPFLPPKAPPPVIKVPECPSAGTSDAACLLDNPLCADVLFVLHDEEHIFAH
FT                   RIYLATSSSKFYDLFLMECEESPCWGGGAGEEVPCRDFQGRTQSLGSAEEGKEGPQRTP
FT                   QADPGASSGQDLPESLALQMEASGSEGHALSGWSKGFVSMHREVRVNPISKRVGPVTVV
FT                   RLDPSMQSGPFRTLLRFLYSGQLDEKEKDLLGLAQMAEVLEMFDLRMMVENIMNKEAFM
FT                   NQEITKAFHVRKANRIKECLSKGTFSDVTFTLDDGAISAHKPLLICSCEWMAAMFGGSF
FT                   VESANREVHLPNINKMSMQAVLEYLYTKQLSPNLDLDPLELIALANRFCLTHLVALVEQ
FT                   HAVQELTKAAVSGVSIDGEVLSYLELAQFHNANQLAAWCLHHICTNYNSVCSKFRKEIK
FT                   SKSADNQEYFERHRWPPVWYLKEEDHYQRVKREREKEDLALNKHHSRRKWCFWHSSPAV
FT                   A"
FT   gene            10658841..10659303
FT                   /locus_tag="mCG_14434"
FT                   /note="gene_id=mCG14434.0"
FT   mRNA            10658841..10659303
FT                   /locus_tag="mCG_14434"
FT                   /product="mCG14434"
FT                   /note="gene_id=mCG14434.0 transcript_id=mCT17026.1 created
FT                   on 31-OCT-2002"
FT   CDS             10658911..10659258
FT                   /codon_start=1
FT                   /locus_tag="mCG_14434"
FT                   /product="mCG14434"
FT                   /note="gene_id=mCG14434.0 transcript_id=mCT17026.1
FT                   protein_id=mCP16954.2"
FT                   /protein_id="EDL31999.1"
FT                   /translation="MVASKKTKKSLESINSRLQLVVKSEKYMLGYKQTLKMIRQGKLKL
FT                   VILANSCPALRKSEIEYYAMLAKTGVHHYRGNNIELGTACGKHYRVCTLAIIDPGDSDI
FT                   IRSMPEQTGEK"
FT   gene            complement(10670271..10686606)
FT                   /gene="Cdc2a"
FT                   /locus_tag="mCG_14428"
FT                   /note="gene_id=mCG14428.3"
FT   mRNA            complement(join(10670271..10672232,10674107..10674248,
FT                   10674341..10674504,10676166..10676336,10678687..10678810,
FT                   10679701..10679857,10683766..10683828,10686507..10686606))
FT                   /gene="Cdc2a"
FT                   /locus_tag="mCG_14428"
FT                   /product="cell division cycle 2 homolog A (S. pombe),
FT                   transcript variant mCT16820"
FT                   /note="gene_id=mCG14428.3 transcript_id=mCT16820.2 created
FT                   on 23-NOV-2004"
FT   mRNA            complement(join(10670271..10672232,10674107..10674248,
FT                   10674341..10674504,10676166..10676336,10678687..10678810,
FT                   10679701..10679857,10683766..10683828,10684434..10684500))
FT                   /gene="Cdc2a"
FT                   /locus_tag="mCG_14428"
FT                   /product="cell division cycle 2 homolog A (S. pombe),
FT                   transcript variant mCT173616"
FT                   /note="gene_id=mCG14428.3 transcript_id=mCT173616.1 created
FT                   on 23-NOV-2004"
FT   CDS             complement(join(10672134..10672232,10674107..10674248,
FT                   10674341..10674504,10676166..10676336,10678687..10678810,
FT                   10679701..10679857,10683766..10683802))
FT                   /codon_start=1
FT                   /gene="Cdc2a"
FT                   /locus_tag="mCG_14428"
FT                   /product="cell division cycle 2 homolog A (S. pombe),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14428.3 transcript_id=mCT16820.2
FT                   protein_id=mCP16956.2 isoform=CRA_a"
FT                   /protein_id="EDL31997.1"
FT                   /translation="MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVP
FT                   STAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSL
FT                   VKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHE
FT                   VVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGT
FT                   PNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMA
FT                   LKHPYFDDLDNQIKKM"
FT   CDS             complement(join(10672134..10672232,10674107..10674248,
FT                   10674341..10674504,10676166..10676336,10678687..10678810,
FT                   10679701..10679857,10683766..10683802))
FT                   /codon_start=1
FT                   /gene="Cdc2a"
FT                   /locus_tag="mCG_14428"
FT                   /product="cell division cycle 2 homolog A (S. pombe),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG14428.3 transcript_id=mCT173616.1
FT                   protein_id=mCP96535.1 isoform=CRA_a"
FT                   /protein_id="EDL31998.1"
FT                   /translation="MEDYIKIEKIGEGTYGVVYKGRHRVTGQIVAMKKIRLESEEEGVP
FT                   STAIREISLLKELRHPNIVSLQDVLMQDSRLYLIFEFLSMDLKKYLDSIPPGQFMDSSL
FT                   VKSYLHQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPIRVYTHE
FT                   VVTLWYRSPEVLLGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGT
FT                   PNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLVYDPAKRISGKMA
FT                   LKHPYFDDLDNQIKKM"
FT   gene            complement(10706520..10707273)
FT                   /locus_tag="mCG_52082"
FT                   /note="gene_id=mCG52082.2"
FT   mRNA            complement(join(10706520..10706995,10707175..10707273))
FT                   /locus_tag="mCG_52082"
FT                   /product="mCG52082"
FT                   /note="gene_id=mCG52082.2 transcript_id=mCT52265.2 created
FT                   on 31-OCT-2002"
FT   CDS             complement(join(10706619..10706995,10707175))
FT                   /codon_start=1
FT                   /locus_tag="mCG_52082"
FT                   /product="mCG52082"
FT                   /note="gene_id=mCG52082.2 transcript_id=mCT52265.2
FT                   protein_id=mCP37741.2"
FT                   /protein_id="EDL31996.1"
FT                   /translation="MLLTAEPSLQPESLEGVDRRFVRKMRFAKKHKKSLQKMPVNNAKA
FT                   VSARTDAIEALVKPKAVKSQDAKGPRPQTQHLAFITHPKLGKRIQSYVAKGRRLCQPKP
FT                   KAEAAAPAQAPKGAQASGKAP"
FT   gene            <10732861..10936407
FT                   /locus_tag="mCG_144847"
FT                   /note="gene_id=mCG144847.0"
FT   mRNA            join(<10732861..10733218,10818257..10818295,
FT                   10935722..10936407)
FT                   /locus_tag="mCG_144847"
FT                   /product="mCG144847"
FT                   /note="gene_id=mCG144847.0 transcript_id=mCT184271.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<10732863..10733218,10818257..10818295,
FT                   10935722..10935833)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144847"
FT                   /product="mCG144847"
FT                   /note="gene_id=mCG144847.0 transcript_id=mCT184271.0
FT                   protein_id=mCP105587.0"
FT                   /protein_id="EDL31995.1"
FT                   /translation="LSGGPCGGQHWACSGGSGPGGSPRLHLAVPPPASQPSSTWRRPAG
FT                   GGEGAGRRCAFPSRGPTFTPTFPPGGAVPGSGVEETPTRAQSRVPGRRSARVPTVWPAR
FT                   APRPQWARGAPILSRVTLDPVIHEALKRETDKQESACQKRKDPECDLCGSGVHCITTIM
FT                   FLGHI"
FT   gene            complement(10756738..10757805)
FT                   /pseudo
FT                   /locus_tag="mCG_50943"
FT                   /note="gene_id=mCG50943.2"
FT   mRNA            complement(10756738..10757805)
FT                   /pseudo
FT                   /locus_tag="mCG_50943"
FT                   /note="gene_id=mCG50943.2 transcript_id=mCT51126.2 created
FT                   on 31-OCT-2002"
FT   gene            10867768..11361976
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /note="gene_id=mCG14429.2"
FT   mRNA            join(10867768..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11254799..11254852,11262144..11262267,11266843..11266945,
FT                   11285368..11285474,11290342..11290566,11293333..11293487,
FT                   11308182..11308393,11310508..11310715,11312173..11312269,
FT                   11312931..11313159,11313778..11313903,11314732..11314854,
FT                   11316576..11316657,11328833..11328907,11332557..11332688,
FT                   11333817..11333960,11336385..11337063,11339072..11339453,
FT                   11350030..11350115,11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT173962"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173962.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(10867768..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11254799..11254852,11262144..11262267,11266843..11266945,
FT                   11285368..11285474,11290342..11290566,11293333..11293487,
FT                   11308182..11308393,11310508..11310715,11312173..11312269,
FT                   11312931..11313159,11313778..11313903,11314732..11314854,
FT                   11316576..11316657,11328833..11328907,11332557..11332688,
FT                   11333817..11333960,11336973..11337063,11339072..11339453,
FT                   11350030..11350115,11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT180020"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT180020.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(10867768..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11262144..11262267,11266843..11266945,11285368..11285474,
FT                   11290342..11290566,11293333..11293487,11308182..11308393,
FT                   11310508..11310715,11312173..11312269,11312931..11313159,
FT                   11313778..11313903,11314732..11314854,11316576..11316657,
FT                   11328833..11328907,11332557..11332688,11333817..11333960,
FT                   11336385..11337063,11339072..11339453,11350030..11350115,
FT                   11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT173960"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173960.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(10867768..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11254799..11254852,
FT                   11262144..11262267,11266843..11266945,11285368..11285474,
FT                   11290342..11290566,11293333..11293487,11308182..11308393,
FT                   11310508..11310715,11312173..11312269,11312931..11313159,
FT                   11313778..11313903,11314732..11314854,11316576..11316657,
FT                   11328833..11328907,11332557..11332688,11333817..11333960,
FT                   11336385..11337063,11339072..11339453,11350030..11350115,
FT                   11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT180021"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT180021.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(10867768..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11262144..11262267,
FT                   11266843..11266945,11285368..11285474,11290342..11290566,
FT                   11293333..11293487,11308182..11308393,11310508..11310715,
FT                   11312173..11312269,11312931..11313159,11313778..11313903,
FT                   11314732..11314854,11316576..11316657,11328833..11328907,
FT                   11332557..11332688,11333817..11333960,11336385..11337063,
FT                   11339072..11339453,11350030..11350115,11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT173959"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173959.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(10867768..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11262144..11262267,
FT                   11266843..11266945,11285368..11285474,11290342..11290566,
FT                   11293333..11293487,11308182..11308393,11310508..11310715,
FT                   11312173..11312269,11312931..11313159,11313778..11313903,
FT                   11314732..11314854,11316576..11316657,11328833..11328907,
FT                   11332557..11332688,11333817..11333960,11336973..11337063,
FT                   11339072..11339453,11350030..11350115,11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT173965"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173965.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(10867768..10868320,11285368..11285474,
FT                   11290342..11290566,11293333..11293487,11308182..11308393,
FT                   11310508..11310715,11312173..11312269,11312931..11313159,
FT                   11313778..11313903,11314732..11314854,11316576..11316657,
FT                   11328833..11328907,11332557..11332688,11333817..11333960,
FT                   11336973..11337063,11339072..11339453,11350030..11350115,
FT                   11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT173961"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173961.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(10868258..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11254799..11254852,11262144..11262267,11266843..11266945,
FT                   11285368..11285474,11290342..11290566,11293333..11293487,
FT                   11308182..11308393,11310508..11310715,11312173..11312269,
FT                   11312931..11313159,11313778..11313903,11314732..11314854,
FT                   11316576..11316657,11328833..11328907,11332557..11332688,
FT                   11333817..11333960,11336385..11337063,11339072..11339453,
FT                   11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_c"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173962.0
FT                   protein_id=mCP96884.0 isoform=CRA_c"
FT                   /db_xref="GOA:G5E8K5"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR000906"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:88026"
FT                   /db_xref="UniProtKB/Swiss-Prot:G5E8K5"
FT                   /protein_id="EDL31985.1"
FT                   /translation="MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIK
FT                   NGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAE
FT                   VVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVA
FT                   LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPL
FT                   HIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT
FT                   RDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHN
FT                   VPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVM
FT                   ELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAAR
FT                   SGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYT
FT                   PLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA
FT                   AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE
FT                   YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN
FT                   VAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQA
FT                   AQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTIT
FT                   EKHKMNVPETMNEVLDMSDDEVRKASAPEKLSDGEYISDGEEGDKCTWFKIPKVQEVLV
FT                   KSEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSS
FT                   YARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSF
FT                   MVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLV
FT                   EMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNG
FT                   MDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQAS
FT                   FPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPP
FT                   PSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARF
FT                   WLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTL
FT                   EQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKI
FT                   RDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRKRY
FT                   SYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLIS
FT                   QSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENN
FT                   VFHDPVDGHPSFQVELETPMGLYCTPPNPFQQDDHFSDISSIESPFRTPSRLSDGLVPS
FT                   QGNIEHPTGGPPVVTAEDTSLEDSKMDDSVTVTDPADPLDVDESQLKDLCQSECAQCWA
FT                   SVPGIPNDGRQAEPLRPQTRKVGMSSEQQEKGKSGPDEEVTEDKVKSLFEDIQLEEVEA
FT                   EEMTEDQGQAMLNRVQRAELAMSSLAGWQNETPSGSLESPAQARRLTGGLLDRLDDSSD
FT                   QARDSITSYLTGEPGKIEANGNHTAEVIPEAKAKPYFPESQNDIGKQSIKENLKPKTHG
FT                   CGRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEEG
FT                   STRSEPKQGEGYKVKTKKEIRNVEKKTH"
FT   CDS             join(10868258..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11254799..11254852,11262144..11262267,11266843..11266945,
FT                   11285368..11285474,11290342..11290566,11293333..11293487,
FT                   11308182..11308393,11310508..11310715,11312173..11312269,
FT                   11312931..11313159,11313778..11313903,11314732..11314854,
FT                   11316576..11316657,11328833..11328907,11332557..11332688,
FT                   11333817..11333960,11336973..11337063,11339072..11339453,
FT                   11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_f"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT180020.0
FT                   protein_id=mCP102943.0 isoform=CRA_f"
FT                   /protein_id="EDL31988.1"
FT                   /translation="MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIK
FT                   NGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAE
FT                   VVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVA
FT                   LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPL
FT                   HIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT
FT                   RDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHN
FT                   VPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVM
FT                   ELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAAR
FT                   SGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYT
FT                   PLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA
FT                   AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE
FT                   YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN
FT                   VAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQA
FT                   AQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTIT
FT                   EKHKMNVPETMNEVLDMSDDEVRKASAPEKLSDGEYISDGEEGDKCTWFKIPKVQEVLV
FT                   KSEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSS
FT                   YARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSF
FT                   MVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLV
FT                   EMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNG
FT                   MDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQAS
FT                   FPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPP
FT                   PSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARF
FT                   WLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTL
FT                   EQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKI
FT                   RDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRKRY
FT                   SYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLIS
FT                   QSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENN
FT                   VFHDPVDGWQNETPSGSLESPAQARRLTGGLLDRLDDSSDQARDSITSYLTGEPGKIEA
FT                   NGNHTAEVIPEAKAKPYFPESQNDIGKQSIKENLKPKTHGCGRTEEPVSPLTAYQKSLE
FT                   ETSKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEEGSTRSEPKQGEGYKVKTKKE
FT                   IRNVEKKTH"
FT   CDS             join(10868258..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11262144..11262267,11266843..11266945,11285368..11285474,
FT                   11290342..11290566,11293333..11293487,11308182..11308393,
FT                   11310508..11310715,11312173..11312269,11312931..11313159,
FT                   11313778..11313903,11314732..11314854,11316576..11316657,
FT                   11328833..11328907,11332557..11332688,11333817..11333960,
FT                   11336385..11337063,11339072..11339453,11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_b"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173960.0
FT                   protein_id=mCP96878.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8K3"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR000906"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:88026"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8K3"
FT                   /protein_id="EDL31984.1"
FT                   /translation="MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIK
FT                   NGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAE
FT                   VVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVA
FT                   LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPL
FT                   HIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT
FT                   RDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHN
FT                   VPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVM
FT                   ELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAAR
FT                   SGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYT
FT                   PLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA
FT                   AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE
FT                   YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN
FT                   VAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQA
FT                   AQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTIT
FT                   EKHKMNVPETMNEVLDMSDDEVRKASAPEKLSDGEYISDGEEGEDAITGDTDKYLGPQD
FT                   LKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQ
FT                   HLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMR
FT                   IIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIP
FT                   HFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICR
FT                   IITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQP
FT                   VPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNL
FT                   RLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQL
FT                   YRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVL
FT                   EGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPK
FT                   TTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTD
FT                   IRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNAT
FT                   TDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGHPSFQVELET
FT                   PMGLYCTPPNPFQQDDHFSDISSIESPFRTPSRLSDGLVPSQGNIEHPTGGPPVVTAED
FT                   TSLEDSKMDDSVTVTDPADPLDVDESQLKDLCQSECAQCWASVPGIPNDGRQAEPLRPQ
FT                   TRKVGMSSEQQEKGKSGPDEEVTEDKVKSLFEDIQLEEVEAEEMTEDQGQAMLNRVQRA
FT                   ELAMSSLAGWQNETPSGSLESPAQARRLTGGLLDRLDDSSDQARDSITSYLTGEPGKIE
FT                   ANGNHTAEVIPEAKAKPYFPESQNDIGKQSIKENLKPKTHGCGRTEEPVSPLTAYQKSL
FT                   EETSKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEEGSTRSEPKQGEGYKVKTKK
FT                   EIRNVEKKTH"
FT   CDS             join(10868258..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11254799..11254852,
FT                   11262144..11262267,11266843..11266945,11285368..11285474,
FT                   11290342..11290566,11293333..11293487,11308182..11308393,
FT                   11310508..11310715,11312173..11312269,11312931..11313159,
FT                   11313778..11313903,11314732..11314854,11316576..11316657,
FT                   11328833..11328907,11332557..11332688,11333817..11333960,
FT                   11336385..11337063,11339072..11339453,11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_l"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT180021.0
FT                   protein_id=mCP102941.0 isoform=CRA_l"
FT                   /db_xref="GOA:G5E8K2"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR000906"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:88026"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8K2"
FT                   /protein_id="EDL31994.1"
FT                   /translation="MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIK
FT                   NGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAE
FT                   VVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVA
FT                   LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPL
FT                   HIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT
FT                   RDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHN
FT                   VPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVM
FT                   ELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAAR
FT                   SGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYT
FT                   PLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA
FT                   AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE
FT                   YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN
FT                   VAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQA
FT                   AQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTIT
FT                   EKHKMNVPETMNEVLDMSDDEGDKCTWFKIPKVQEVLVKSEDAITGDTDKYLGPQDLKE
FT                   LGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLT
FT                   FTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIII
FT                   PPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFG
FT                   SMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIIT
FT                   KDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPE
FT                   ETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLL
FT                   CSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRE
FT                   LICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGK
FT                   PIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTK
FT                   GLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRM
FT                   AIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDA
FT                   LTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGHPSFQVELETPMG
FT                   LYCTPPNPFQQDDHFSDISSIESPFRTPSRLSDGLVPSQGNIEHPTGGPPVVTAEDTSL
FT                   EDSKMDDSVTVTDPADPLDVDESQLKDLCQSECAQCWASVPGIPNDGRQAEPLRPQTRK
FT                   VGMSSEQQEKGKSGPDEEVTEDKVKSLFEDIQLEEVEAEEMTEDQGQAMLNRVQRAELA
FT                   MSSLAGWQNETPSGSLESPAQARRLTGGLLDRLDDSSDQARDSITSYLTGEPGKIEANG
FT                   NHTAEVIPEAKAKPYFPESQNDIGKQSIKENLKPKTHGCGRTEEPVSPLTAYQKSLEET
FT                   SKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEEGSTRSEPKQGEGYKVKTKKEIR
FT                   NVEKKTH"
FT   CDS             join(10868258..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11262144..11262267,
FT                   11266843..11266945,11285368..11285474,11290342..11290566,
FT                   11293333..11293487,11308182..11308393,11310508..11310715,
FT                   11312173..11312269,11312931..11313159,11313778..11313903,
FT                   11314732..11314854,11316576..11316657,11328833..11328907,
FT                   11332557..11332688,11333817..11333960,11336385..11337063,
FT                   11339072..11339453,11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_a"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173959.0
FT                   protein_id=mCP96881.0 isoform=CRA_a"
FT                   /protein_id="EDL31983.1"
FT                   /translation="MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIK
FT                   NGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAE
FT                   VVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVA
FT                   LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPL
FT                   HIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT
FT                   RDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHN
FT                   VPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVM
FT                   ELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAAR
FT                   SGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYT
FT                   PLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA
FT                   AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE
FT                   YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN
FT                   VAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQA
FT                   AQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTIT
FT                   EKHKMNVPETMNEVLDMSDDEGEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGA
FT                   RSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAAD
FT                   TLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKR
FT                   HKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGE
FT                   TWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESN
FT                   QIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVT
FT                   VEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGT
FT                   TPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTND
FT                   PVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQ
FT                   QLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHK
FT                   KAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELAREL
FT                   NFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLE
FT                   GPIFDYGNISGTRSFADENNVFHDPVDGHPSFQVELETPMGLYCTPPNPFQQDDHFSDI
FT                   SSIESPFRTPSRLSDGLVPSQGNIEHPTGGPPVVTAEDTSLEDSKMDDSVTVTDPADPL
FT                   DVDESQLKDLCQSECAQCWASVPGIPNDGRQAEPLRPQTRKVGMSSEQQEKGKSGPDEE
FT                   VTEDKVKSLFEDIQLEEVEAEEMTEDQGQAMLNRVQRAELAMSSLAGWQNETPSGSLES
FT                   PAQARRLTGGLLDRLDDSSDQARDSITSYLTGEPGKIEANGNHTAEVIPEAKAKPYFPE
FT                   SQNDIGKQSIKENLKPKTHGCGRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMK
FT                   KMTRTTADGKARLNLQEEEGSTRSEPKQGEGYKVKTKKEIRNVEKKTH"
FT   CDS             join(10868258..10868320,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11262144..11262267,
FT                   11266843..11266945,11285368..11285474,11290342..11290566,
FT                   11293333..11293487,11308182..11308393,11310508..11310715,
FT                   11312173..11312269,11312931..11313159,11313778..11313903,
FT                   11314732..11314854,11316576..11316657,11328833..11328907,
FT                   11332557..11332688,11333817..11333960,11336973..11337063,
FT                   11339072..11339453,11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_k"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173965.0
FT                   protein_id=mCP96879.0 isoform=CRA_k"
FT                   /protein_id="EDL31993.1"
FT                   /translation="MSEEPKEKPAKPAHRKRKGKKSDANASYLRAARAGHLEKALDYIK
FT                   NGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAE
FT                   VVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVA
FT                   LQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPL
FT                   HIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKT
FT                   RDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHN
FT                   VPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVM
FT                   ELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAAR
FT                   SGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYT
FT                   PLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDA
FT                   AGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLE
FT                   YGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVN
FT                   VAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQA
FT                   AQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTIT
FT                   EKHKMNVPETMNEVLDMSDDEGEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGA
FT                   RSASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAAD
FT                   TLDNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKR
FT                   HKLANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGE
FT                   TWKEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESN
FT                   QIGPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVT
FT                   VEPRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGT
FT                   TPLTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTND
FT                   PVESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQ
FT                   QLVFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHK
FT                   KAEKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELAREL
FT                   NFSVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLE
FT                   GPIFDYGNISGTRSFADENNVFHDPVDGWQNETPSGSLESPAQARRLTGGLLDRLDDSS
FT                   DQARDSITSYLTGEPGKIEANGNHTAEVIPEAKAKPYFPESQNDIGKQSIKENLKPKTH
FT                   GCGRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEE
FT                   GSTRSEPKQGEGYKVKTKKEIRNVEKKTH"
FT   CDS             join(10868258..10868320,11285368..11285474,
FT                   11290342..11290566,11293333..11293487,11308182..11308393,
FT                   11310508..11310715,11312173..11312269,11312931..11313159,
FT                   11313778..11313903,11314732..11314854,11316576..11316657,
FT                   11328833..11328907,11332557..11332688,11333817..11333960,
FT                   11336973..11337063,11339072..11339453,11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_i"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173961.0
FT                   protein_id=mCP96882.0 isoform=CRA_i"
FT                   /db_xref="GOA:G3X971"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR000906"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="MGI:MGI:88026"
FT                   /db_xref="UniProtKB/TrEMBL:G3X971"
FT                   /protein_id="EDL31991.1"
FT                   /translation="MSEEPKEKPAKPAHRKRKGKKHLTFTREFDSDSLRHYSWAADTLD
FT                   NVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKL
FT                   ANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWK
FT                   EHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIG
FT                   PEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEP
FT                   RRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPL
FT                   TFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVE
FT                   SSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLV
FT                   FNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAE
FT                   KADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFS
FT                   VDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPI
FT                   FDYGNISGTRSFADENNVFHDPVDGWQNETPSGSLESPAQARRLTGGLLDRLDDSSDQA
FT                   RDSITSYLTGEPGKIEANGNHTAEVIPEAKAKPYFPESQNDIGKQSIKENLKPKTHGCG
FT                   RTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEEGST
FT                   RSEPKQGEGYKVKTKKEIRNVEKKTH"
FT   mRNA            join(11041042..11041668,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11254799..11254852,11262144..11262267,11266843..11266945,
FT                   11285368..11285474,11290342..11290566,11293333..11293487,
FT                   11308182..11308393,11310508..11310715,11312173..11312269,
FT                   11312931..11313159,11313778..11313903,11314732..11314854,
FT                   11316576..11316657,11328833..11328907,11332557..11332688,
FT                   11333817..11333960,11336385..11337063,11339072..11339453,
FT                   11350030..11350115,11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT180019"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT180019.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(11041555..11041668,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11254799..11254852,11262144..11262267,11266843..11266945,
FT                   11285368..11285474,11290342..11290566,11293333..11293487,
FT                   11308182..11308393,11310508..11310715,11312173..11312269,
FT                   11312931..11313159,11313778..11313903,11314732..11314854,
FT                   11316576..11316657,11328833..11328907,11332557..11332688,
FT                   11333817..11333960,11336385..11337063,11339072..11339453,
FT                   11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_e"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT180019.0
FT                   protein_id=mCP102942.0 isoform=CRA_e"
FT                   /protein_id="EDL31987.1"
FT                   /translation="MAHAASQLKKNRDLEINAEEETEKKRKHRKRSRDRKKKSDANASY
FT                   LRAARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAAT
FT                   KKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNG
FT                   ASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLL
FT                   QNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNA
FT                   NMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHM
FT                   ATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALN
FT                   GFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGAS
FT                   PNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQ
FT                   LLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYG
FT                   KLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPL
FT                   HIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSN
FT                   KSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHS
FT                   AKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVV
FT                   DTLKVVTEEIMTTTTITEKHKMNVPETMNEVLDMSDDEVRKASAPEKLSDGEYISDGEE
FT                   GDKCTWFKIPKVQEVLVKSEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARSA
FT                   SLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTLD
FT                   NVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKL
FT                   ANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETWK
FT                   EHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQIG
FT                   PEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVEP
FT                   RRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTPL
FT                   TFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPVE
FT                   SSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLV
FT                   FNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAE
FT                   KADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNFS
FT                   VDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGPI
FT                   FDYGNISGTRSFADENNVFHDPVDGHPSFQVELETPMGLYCTPPNPFQQDDHFSDISSI
FT                   ESPFRTPSRLSDGLVPSQGNIEHPTGGPPVVTAEDTSLEDSKMDDSVTVTDPADPLDVD
FT                   ESQLKDLCQSECAQCWASVPGIPNDGRQAEPLRPQTRKVGMSSEQQEKGKSGPDEEVTE
FT                   DKVKSLFEDIQLEEVEAEEMTEDQGQAMLNRVQRAELAMSSLAGWQNETPSGSLESPAQ
FT                   ARRLTGGLLDRLDDSSDQARDSITSYLTGEPGKIEANGNHTAEVIPEAKAKPYFPESQN
FT                   DIGKQSIKENLKPKTHGCGRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMT
FT                   RTTADGKARLNLQEEEGSTRSEPKQGEGYKVKTKKEIRNVEKKTH"
FT   mRNA            join(11120164..11120324,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11254799..11254852,11262144..11262267,11266843..11266945,
FT                   11285368..11285474,11290342..11290566,11293333..11293487,
FT                   11308182..11308393,11310508..11310715,11312173..11312269,
FT                   11312931..11313159,11313778..11313903,11314732..11314854,
FT                   11316576..11316657,11328833..11328907,11332557..11332688,
FT                   11333817..11333960,11336385..11337063,11339072..11339453,
FT                   11350030..11350115,11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT173963"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173963.0 created
FT                   on 14-FEB-2003"
FT   mRNA            join(11120164..11120324,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11193215..11193515)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT173964"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173964.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(11120289..11120324,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11202078..11202176,11205695..11205892,11209543..11209641,
FT                   11212583..11212681,11214646..11214744,11217114..11217311,
FT                   11219500..11219598,11219892..11219990,11227114..11227311,
FT                   11228237..11228335,11232507..11232605,11232694..11232792,
FT                   11233460..11233555,11238647..11238719,11238897..11238959,
FT                   11254799..11254852,11262144..11262267,11266843..11266945,
FT                   11285368..11285474,11290342..11290566,11293333..11293487,
FT                   11308182..11308393,11310508..11310715,11312173..11312269,
FT                   11312931..11313159,11313778..11313903,11314732..11314854,
FT                   11316576..11316657,11328833..11328907,11332557..11332688,
FT                   11333817..11333960,11336385..11337063,11339072..11339453,
FT                   11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_j"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173963.0
FT                   protein_id=mCP96883.0 isoform=CRA_j"
FT                   /protein_id="EDL31992.1"
FT                   /translation="MAVEEPEGFPEESDANASYLRAARAGHLEKALDYIKNGVDVNICN
FT                   QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNG
FT                   ANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVV
FT                   SLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNI
FT                   NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHC
FT                   GARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTND
FT                   YLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGAS
FT                   IQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRY
FT                   LVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREG
FT                   HEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPL
FT                   HVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVT
FT                   RQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQG
FT                   AHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHII
FT                   NVLLQNNASPNELTVNGNTALAIARRLGYISVVDTLKVVTEEIMTTTTITEKHKMNVPE
FT                   TMNEVLDMSDDEVRKASAPEKLSDGEYISDGEEGDKCTWFKIPKVQEVLVKSEDAITGD
FT                   TDKYLGPQDLKELGDDSLPAEGYVGFSLGARSASLRSFSSDRSYTLNRSSYARDSMMIE
FT                   ELLVPSKEQHLTFTREFDSDSLRHYSWAADTLDNVNLVSSPVHSGFLVSFMVDARGGSM
FT                   RGSRHHGMRIIIPPRKCTAPTRITCRLVKRHKLANPPPMVEGEGLASRLVEMGPAGAQF
FT                   LGPVIVEIPHFGSMRGKERELIVLRSENGETWKEHQFDSKNEDLAELLNGMDEELDSPE
FT                   ELGTKRICRIITKDFPQYFAVVSRIKQESNQIGPEGGILSSTTVPLVQASFPEGALTKR
FT                   IRVGLQAQPVPEETVKKILGNKATFSPIVTVEPRRRKFHKPITMTIPVPPPSGEGVSNG
FT                   YKGDATPNLRLLCSITGGTSPAQWEDITGTTPLTFIKDCVSFTTNVSARFWLADCHQVL
FT                   ETVGLASQLYRELICVPYMAKFVVFAKTNDPVESSLRCFCMTDDRVDKTLEQQENFEEV
FT                   ARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQLVFNFYSFKENRLPFSIKIRDTSQEPCG
FT                   RLSFLKEPKTTKGLPQTAVCNLNITLPAHKKAEKADRRQSFASLALRKRYSYLTEPSMS
FT                   PQSPCERTDIRMAIVADHLGLSWTELARELNFSVDEINQIRVENPNSLISQSFMLLKKW
FT                   VTRDGKNATTDALTSVLTKINRIDIVTLLEGPIFDYGNISGTRSFADENNVFHDPVDGH
FT                   PSFQVELETPMGLYCTPPNPFQQDDHFSDISSIESPFRTPSRLSDGLVPSQGNIEHPTG
FT                   GPPVVTAEDTSLEDSKMDDSVTVTDPADPLDVDESQLKDLCQSECAQCWASVPGIPNDG
FT                   RQAEPLRPQTRKVGMSSEQQEKGKSGPDEEVTEDKVKSLFEDIQLEEVEAEEMTEDQGQ
FT                   AMLNRVQRAELAMSSLAGWQNETPSGSLESPAQARRLTGGLLDRLDDSSDQARDSITSY
FT                   LTGEPGKIEANGNHTAEVIPEAKAKPYFPESQNDIGKQSIKENLKPKTHGCGRTEEPVS
FT                   PLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEEGSTRSEPKQG
FT                   EGYKVKTKKEIRNVEKKTH"
FT   CDS             join(11120289..11120324,11143063..11143164,
FT                   11143520..11143618,11143818..11143916,11150342..11150440,
FT                   11156855..11157040,11158965..11159063,11185098..11185196,
FT                   11193215..11193271)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_d"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT173964.0
FT                   protein_id=mCP96880.0 isoform=CRA_d"
FT                   /db_xref="GOA:W4VSQ0"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:88026"
FT                   /db_xref="UniProtKB/TrEMBL:W4VSQ0"
FT                   /protein_id="EDL31986.1"
FT                   /translation="MAVEEPEGFPEESDANASYLRAARAGHLEKALDYIKNGVDVNICN
FT                   QNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNG
FT                   ANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVV
FT                   SLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNI
FT                   NVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRRLNSGTIR
FT                   KRRKRVYVHI"
FT   mRNA            join(11259941..11260640,11262144..11262267,
FT                   11266843..11266945,11285368..11285474,11290342..11290566,
FT                   11293333..11293487,11308182..11308393,11310508..11310715,
FT                   11312173..11312269,11312931..11313159,11313778..11313903,
FT                   11314732..11314854,11316576..11316657,11328833..11328907,
FT                   11332557..11332688,11333817..11333960,11336385..11337063,
FT                   11339072..11339453,11350030..11350115,11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT16821"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT16821.2 created
FT                   on 14-FEB-2003"
FT   mRNA            join(11259941..11260640,11262144..11262267,
FT                   11266843..11266945,11285368..11285474,11290342..11290566,
FT                   11293333..11293487,11308182..11308393,11310508..11310715,
FT                   11312173..11312269,11312931..11313159,11313778..11313903,
FT                   11314732..11314854,11316576..11316657,11328833..11328907,
FT                   11332557..11332688,11333817..11333960,11336973..11337063,
FT                   11339072..11339453,11350030..11350115,11358372..11361976)
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, transcript variant
FT                   mCT180022"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT180022.0 created
FT                   on 14-FEB-2003"
FT   CDS             join(11260625..11260640,11262144..11262267,
FT                   11266843..11266945,11285368..11285474,11290342..11290566,
FT                   11293333..11293487,11308182..11308393,11310508..11310715,
FT                   11312173..11312269,11312931..11313159,11313778..11313903,
FT                   11314732..11314854,11316576..11316657,11328833..11328907,
FT                   11332557..11332688,11333817..11333960,11336385..11337063,
FT                   11339072..11339453,11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_h"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT16821.2
FT                   protein_id=mCP16959.1 isoform=CRA_h"
FT                   /db_xref="GOA:G5E8K5"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR000906"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:88026"
FT                   /db_xref="UniProtKB/Swiss-Prot:G5E8K5"
FT                   /protein_id="EDL31990.1"
FT                   /translation="MALPHSEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARS
FT                   ASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL
FT                   DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHK
FT                   LANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETW
FT                   KEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQI
FT                   GPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVE
FT                   PRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTP
FT                   LTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPV
FT                   ESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQL
FT                   VFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKA
FT                   EKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNF
FT                   SVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGP
FT                   IFDYGNISGTRSFADENNVFHDPVDGHPSFQVELETPMGLYCTPPNPFQQDDHFSDISS
FT                   IESPFRTPSRLSDGLVPSQGNIEHPTGGPPVVTAEDTSLEDSKMDDSVTVTDPADPLDV
FT                   DESQLKDLCQSECAQCWASVPGIPNDGRQAEPLRPQTRKVGMSSEQQEKGKSGPDEEVT
FT                   EDKVKSLFEDIQLEEVEAEEMTEDQGQAMLNRVQRAELAMSSLAGWQNETPSGSLESPA
FT                   QARRLTGGLLDRLDDSSDQARDSITSYLTGEPGKIEANGNHTAEVIPEAKAKPYFPESQ
FT                   NDIGKQSIKENLKPKTHGCGRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKM
FT                   TRTTADGKARLNLQEEEGSTRSEPKQGEGYKVKTKKEIRNVEKKTH"
FT   CDS             join(11260625..11260640,11262144..11262267,
FT                   11266843..11266945,11285368..11285474,11290342..11290566,
FT                   11293333..11293487,11308182..11308393,11310508..11310715,
FT                   11312173..11312269,11312931..11313159,11313778..11313903,
FT                   11314732..11314854,11316576..11316657,11328833..11328907,
FT                   11332557..11332688,11333817..11333960,11336973..11337063,
FT                   11339072..11339453,11350030..11350095)
FT                   /codon_start=1
FT                   /gene="Ank3"
FT                   /locus_tag="mCG_14429"
FT                   /product="ankyrin 3, epithelial, isoform CRA_g"
FT                   /note="gene_id=mCG14429.2 transcript_id=mCT180022.0
FT                   protein_id=mCP102944.0 isoform=CRA_g"
FT                   /db_xref="GOA:G5E8K5"
FT                   /db_xref="InterPro:IPR000488"
FT                   /db_xref="InterPro:IPR000906"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:88026"
FT                   /db_xref="UniProtKB/Swiss-Prot:G5E8K5"
FT                   /protein_id="EDL31989.1"
FT                   /translation="MALPHSEDAITGDTDKYLGPQDLKELGDDSLPAEGYVGFSLGARS
FT                   ASLRSFSSDRSYTLNRSSYARDSMMIEELLVPSKEQHLTFTREFDSDSLRHYSWAADTL
FT                   DNVNLVSSPVHSGFLVSFMVDARGGSMRGSRHHGMRIIIPPRKCTAPTRITCRLVKRHK
FT                   LANPPPMVEGEGLASRLVEMGPAGAQFLGPVIVEIPHFGSMRGKERELIVLRSENGETW
FT                   KEHQFDSKNEDLAELLNGMDEELDSPEELGTKRICRIITKDFPQYFAVVSRIKQESNQI
FT                   GPEGGILSSTTVPLVQASFPEGALTKRIRVGLQAQPVPEETVKKILGNKATFSPIVTVE
FT                   PRRRKFHKPITMTIPVPPPSGEGVSNGYKGDATPNLRLLCSITGGTSPAQWEDITGTTP
FT                   LTFIKDCVSFTTNVSARFWLADCHQVLETVGLASQLYRELICVPYMAKFVVFAKTNDPV
FT                   ESSLRCFCMTDDRVDKTLEQQENFEEVARSKDIEVLEGKPIYVDCYGNLAPLTKGGQQL
FT                   VFNFYSFKENRLPFSIKIRDTSQEPCGRLSFLKEPKTTKGLPQTAVCNLNITLPAHKKA
FT                   EKADRRQSFASLALRKRYSYLTEPSMSPQSPCERTDIRMAIVADHLGLSWTELARELNF
FT                   SVDEINQIRVENPNSLISQSFMLLKKWVTRDGKNATTDALTSVLTKINRIDIVTLLEGP
FT                   IFDYGNISGTRSFADENNVFHDPVDGWQNETPSGSLESPAQARRLTGGLLDRLDDSSDQ
FT                   ARDSITSYLTGEPGKIEANGNHTAEVIPEAKAKPYFPESQNDIGKQSIKENLKPKTHGC
FT                   GRTEEPVSPLTAYQKSLEETSKLVIEDAPKPCVPVGMKKMTRTTADGKARLNLQEEEGS
FT                   TRSEPKQGEGYKVKTKKEIRNVEKKTH"
FT   gene            11382825..11523993
FT                   /locus_tag="mCG_115019"
FT                   /note="gene_id=mCG115019.0"
FT   mRNA            join(11382825..11382840,11431631..11432074,
FT                   11477208..11477357,11489337..11489465,11501617..11501720,
FT                   11503707..11503867,11509581..11509737,11516750..11516850,
FT                   11522281..11522405,11523668..11523993)
FT                   /locus_tag="mCG_115019"
FT                   /product="mCG115019"
FT                   /note="gene_id=mCG115019.0 transcript_id=mCT116117.1
FT                   created on 31-OCT-2002"
FT   CDS             join(11431793..11432074,11477208..11477357,
FT                   11489337..11489465,11501617..11501720,11503707..11503867,
FT                   11509581..11509737,11516750..11516850,11522281..11522405,
FT                   11523668..11523868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115019"
FT                   /product="mCG115019"
FT                   /note="gene_id=mCG115019.0 transcript_id=mCT116117.1
FT                   protein_id=mCP54948.1"
FT                   /db_xref="GOA:D3YZP9"
FT                   /db_xref="InterPro:IPR019152"
FT                   /db_xref="MGI:MGI:1923801"
FT                   /db_xref="UniProtKB/Swiss-Prot:D3YZP9"
FT                   /protein_id="EDL31982.1"
FT                   /translation="MADSASESDTDAAGGGPAAMQSSCSATSGGSGGGGGGKSGGIVIS
FT                   PFRLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEF
FT                   ISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQ
FT                   VNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKR
FT                   ILQEKLDQPVSAPPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMA
FT                   QYLEEERHMREENLRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRP
FT                   RTVSSPIPYTPSPSSSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGAS
FT                   HGITRPSPRRSSSPDKFKRPTPPPSPNTQSPVQPPPPPPPPPMQPAVPSAAPTQPAPTQ
FT                   PQHPVHPSSQP"
FT   gene            <11539283..11554312
FT                   /locus_tag="mCG_146286"
FT                   /note="gene_id=mCG146286.0"
FT   mRNA            join(<11539283..11539358,11551554..11551668,
FT                   11554079..11554312)
FT                   /locus_tag="mCG_146286"
FT                   /product="mCG146286"
FT                   /note="gene_id=mCG146286.0 transcript_id=mCT186389.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<11539283..11539358,11551554..11551668,
FT                   11554079..11554238)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146286"
FT                   /product="mCG146286"
FT                   /note="gene_id=mCG146286.0 transcript_id=mCT186389.0
FT                   protein_id=mCP107467.0"
FT                   /db_xref="GOA:Q9CV60"
FT                   /db_xref="MGI:MGI:1916813"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CV60"
FT                   /protein_id="EDL31981.1"
FT                   /translation="RADGVFERKGGHSQDFGLGSVAPLNRTNVARRTPVPQHFGPARAG
FT                   EESWKLVELCYLLPPEALREQENLNMSGKSWVLISTTSPQSLEDEILGRLLKILFVLFV
FT                   DLMSIMYVVITS"
FT   gene            11579743..11617961
FT                   /gene="Slc16a9"
FT                   /locus_tag="mCG_1004"
FT                   /note="gene_id=mCG1004.2"
FT   mRNA            join(11579743..11579997,11590473..11590705,
FT                   11601620..11601763,11614280..11615189,11615866..11617961)
FT                   /gene="Slc16a9"
FT                   /locus_tag="mCG_1004"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 9"
FT                   /note="gene_id=mCG1004.2 transcript_id=mCT8662.2 created on
FT                   31-OCT-2002"
FT   CDS             join(11590510..11590705,11601620..11601763,
FT                   11614280..11614488)
FT                   /codon_start=1
FT                   /gene="Slc16a9"
FT                   /locus_tag="mCG_1004"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 9"
FT                   /note="gene_id=mCG1004.2 transcript_id=mCT8662.2
FT                   protein_id=mCP16966.2"
FT                   /protein_id="EDL31978.1"
FT                   /translation="MEFQKSPDGGWGWVIVVVSFFTQFLSYGSPLAVGVLYVEWLDAFG
FT                   EGKGKTAWVGSLASGVGLLASPVCSLFVSSFGARPVTIFSGFLVAGGLMLSSLAPNIYF
FT                   LFFSYGIVVGSSVGLFIYAALQRMLIEFYGLDGCLLIVGALALNILACGSLMRPLQTSD
FT                   CPFPEKTAPEECSRQILHV"
FT   gene            complement(11616227..11616975)
FT                   /locus_tag="mCG_1005"
FT                   /note="gene_id=mCG1005.2"
FT   mRNA            complement(join(11616227..11616502,11616731..11616975))
FT                   /locus_tag="mCG_1005"
FT                   /product="mCG1005, transcript variant mCT8663"
FT                   /note="gene_id=mCG1005.2 transcript_id=mCT8663.2 created on
FT                   18-DEC-2002"
FT   mRNA            complement(join(11616227..11616482,11616718..11616975))
FT                   /locus_tag="mCG_1005"
FT                   /product="mCG1005, transcript variant mCT177468"
FT                   /note="gene_id=mCG1005.2 transcript_id=mCT177468.0 created
FT                   on 18-DEC-2002"
FT   CDS             complement(join(11616321..11616502,11616731..11616902))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1005"
FT                   /product="mCG1005, isoform CRA_b"
FT                   /note="gene_id=mCG1005.2 transcript_id=mCT8663.2
FT                   protein_id=mCP16967.2 isoform=CRA_b"
FT                   /protein_id="EDL31980.1"
FT                   /translation="MQARPCNPFSRCSKQMGASHWPDFGMVQRSISKAETGKPTGYLET
FT                   SAEWLPINTSEQGLTSRRQPLLLHANPIVRSAQFKTGPTEHLRELTGKAETLNFIQRKL
FT                   CEANSELMNNEQP"
FT   CDS             complement(join(11616452..11616482,11616718..11616902))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1005"
FT                   /product="mCG1005, isoform CRA_a"
FT                   /note="gene_id=mCG1005.2 transcript_id=mCT177468.0
FT                   protein_id=mCP100390.0 isoform=CRA_a"
FT                   /protein_id="EDL31979.1"
FT                   /translation="MQARPCNPFSRCSKQMGASHWPDFGMVQRSISKAETGKPTGYLET
FT                   SAEWLPINTSEQGPRSRHYSFTQIQL"
FT   gene            complement(11617541..11620167)
FT                   /locus_tag="mCG_148095"
FT                   /note="gene_id=mCG148095.0"
FT   mRNA            complement(11617541..11620167)
FT                   /locus_tag="mCG_148095"
FT                   /product="mCG148095"
FT                   /note="gene_id=mCG148095.0 transcript_id=mCT188358.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11617751..11618269)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148095"
FT                   /product="mCG148095"
FT                   /note="gene_id=mCG148095.0 transcript_id=mCT188358.0
FT                   protein_id=mCP108325.0"
FT                   /protein_id="EDL31977.1"
FT                   /translation="MMTFESALVQSRPKLYPITYIFKFIWSVTVSGKKNNKQSFSMFFI
FT                   VTRSYTMSRQWLMHTCVISMRKDTSALIVNIDGCRHVSKIKPLKSPGILDTLLTKTRLG
FT                   IQTSIIFIYLFGLKKIIALNFKDIFFYFYLCVGVYIYIYIIYIYIPPIHRWLWGTEEGA
FT                   GSPGAGVRL"
FT   gene            11772729..11893074
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /note="gene_id=mCG1002.1"
FT   mRNA            join(11772729..11773148,11773287..11773325,
FT                   11781008..11781064,11783277..11783478,11809940..11810058,
FT                   11832649..11832712,11854472..11854619,11868381..11868591,
FT                   11870064..11870202,11876511..11876592,11878195..11878397,
FT                   11885562..11885657,11886896..11887092,11888355..11888456,
FT                   11891107..11893074)
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, transcript variant
FT                   mCT173585"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT173585.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(<11772955..11773148,11773287..11773325,
FT                   11781008..11781064,11783277..11783478,11809940..11810058,
FT                   11832649..11832712,11854472..11854619,11868381..11868591,
FT                   11870064..11870202,11876511..11876592,11878195..11879660)
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, transcript variant
FT                   mCT192958"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192958.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11772967..11773148,11773287..11773325,
FT                   11781008..11781064,11783277..11783478,11809940..11810058,
FT                   11832649..11832712,11854472..11854619,11868381..11868591,
FT                   11870064..11870202,11876511..11876592,11878195..11878631)
FT                   /codon_start=1
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, isoform CRA_c"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192958.0
FT                   protein_id=mCP113934.0 isoform=CRA_c"
FT                   /protein_id="EDL31972.1"
FT                   /translation="LPTRVARSSSRFLRLKPPVARRRAPPHRPRSLAGCWALWFAGAAG
FT                   PLLGVSSGACADSSPSLQDNSFGSAAVTECDEDTVSVHEDEDDCSGLRDEDNKENYPQV
FT                   AARLDELALPSHEAQQHVEQTLPVDGVLRTSMGNFKSRKPKSILRAESGRNHGESQETE
FT                   HVVPSQSECQGRAGTPAHESPQSSIFRCQETVRLQPRIDQRATIWPKDAFGTQQDLHEN
FT                   SLLKLQALESGLCSAFLTTQEEDGQVHGVKDPAPASTQSAPADSADPADPMPAHKDAPG
FT                   DADGTSEDLQSAGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSSQQFM
FT                   MPRSSSRCGSGDGKEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEV
FT                   LKWMNDLAKGRKQLKELKLKLSEEQGSTPKGPRRNLSCEQPPVPRENGKSEAVGPEPGS
FT                   SGEETSDAVVPEKREQTPPQDDGKVPQQPQHGGARTCFWSPVRALHHQSHIFRRLLSSW
FT                   WVNDCDVGALLWDSRRFHFRRRGVLEDDGKDRIWSLLHHISK"
FT   mRNA            join(<11772995..11773148,11773287..11773325,
FT                   11781008..11781064,11783277..11783478,11809940..11810058,
FT                   11832649..11832712,11854472..11854619,11868381..11868591,
FT                   11870064..11870202,11876511..11876592,11878195..11878397,
FT                   11885562..11886114)
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, transcript variant
FT                   mCT192960"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192960.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11772997..11773148,11773287..11773325,
FT                   11781008..11781064,11783277..11783478,11809940..11810058,
FT                   11832649..11832712,11854472..11854619,11868381..11868591,
FT                   11870064..11870202,11876511..11876592,11878195..11878397,
FT                   11885562..11885750)
FT                   /codon_start=1
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, isoform CRA_e"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192960.0
FT                   protein_id=mCP113936.0 isoform=CRA_e"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BLN2"
FT                   /protein_id="EDL31974.1"
FT                   /translation="RFLRLKPPVARRRAPPHRPRSLAGCWALWFAGAAGPLLGVSSGAC
FT                   ADSSPSLQDNSFGSAAVTECDEDTVSVHEDEDDCSGLRDEDNKENYPQVAARLDELALP
FT                   SHEAQQHVEQTLPVDGVLRTSMGNFKSRKPKSILRAESGRNHGESQETEHVVPSQSECQ
FT                   GRAGTPAHESPQSSIFRCQETVRLQPRIDQRATIWPKDAFGTQQDLHENSLLKLQALES
FT                   GLCSAFLTTQEEDGQVHGVKDPAPASTQSAPADSADPADPMPAHKDAPGDADGTSEDLQ
FT                   SAGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSSQQFMMPRSSSRCGS
FT                   GDGKEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKG
FT                   RKQLKELKLKLSEEQGSTPKGPRRNLSCEQPPVPRENGKSEAVGPEPGSSGEETSDAVV
FT                   PEKREQTPPQDDGKGTKQDKNLIKPLYDRCRGIKQILPTPSLIPTIVSKHGGTNWKLSS
FT                   TLNRCCLVPYHRPHHEC"
FT   mRNA            join(<11773106..11773148,11773287..11773325,
FT                   11781008..11781064,11783277..11783478,11809940..11810058,
FT                   11832649..11832712,11854472..11854619,11868381..11868591,
FT                   11870064..11870202,11876511..11876592,11878195..11878227,
FT                   11878303..11878397,11885562..11885657,11886896..11887092,
FT                   11888355..11888456,11891107..11891919)
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, transcript variant
FT                   mCT192959"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192959.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11773108..11773148,11773287..11773325,
FT                   11781008..11781064,11783277..11783478,11809940..11810058,
FT                   11832649..11832712,11854472..11854619,11868381..11868591,
FT                   11870064..11870202,11876511..11876592,11878195..11878227,
FT                   11878303..11878397,11885562..11885657,11886896..11887092,
FT                   11888355..11888456,11891107..11891230)
FT                   /codon_start=1
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, isoform CRA_d"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192959.0
FT                   protein_id=mCP113935.0 isoform=CRA_d"
FT                   /protein_id="EDL31973.1"
FT                   /translation="LGVSSGACADSSPSLQDNSFGSAAVTECDEDTVSVHEDEDDCSGL
FT                   RDEDNKENYPQVAARLDELALPSHEAQQHVEQTLPVDGVLRTSMGNFKSRKPKSILRAE
FT                   SGRNHGESQETEHVVPSQSECQGRAGTPAHESPQSSIFRCQETVRLQPRIDQRATIWPK
FT                   DAFGTQQDLHENSLLKLQALESGLCSAFLTTQEEDGQVHGVKDPAPASTQSAPADSADP
FT                   ADPMPAHKDAPGDADGTSEDLQSAGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPE
FT                   SAPSPPSSQQFMMPRSSSRCGSGDGKEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYR
FT                   PSHGDKTSNPEVLKWMNDLAKGRKQLKELKLKLSEEQGTVGPEPGSSGEETSDAVVPEK
FT                   REQTPPQDDGKGTKQDKNLIKPLYDRCRGIKQILPTPSLIPTIQEEEDSDEDCPQGSQQ
FT                   PSLPDPVSRLPVGDHLIYSETEPVRTLLPDEKKEGKQPALSMSNLHEATMPVLLDHLRE
FT                   TRADKKRLRKALREFEEQFFKQTGRSPQKEDRMPMADEYCEYKHIKAKLRLLEVLISKQ
FT                   DVAKTI"
FT   mRNA            join(<11773158..11773325,11781008..11781064,
FT                   11783277..11783478,11809940..11810058,11832649..11832712,
FT                   11854472..11854619,11868381..11868591,11870064..11870202,
FT                   11876511..11876592,11878195..11878397,11885562..11885657,
FT                   11886899..11887092,11888355..11888456,11891107..11892596)
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, transcript variant
FT                   mCT192957"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192957.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11773159..11773325,11781008..11781064,
FT                   11783277..11783478,11809940..11810058,11832649..11832712,
FT                   11854472..11854619,11868381..11868591,11870064..11870202,
FT                   11876511..11876592,11878195..11878397,11885562..11885657,
FT                   11886899..11887092,11888355..11888456,11891107..11891230)
FT                   /codon_start=1
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, isoform CRA_b"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192957.0
FT                   protein_id=mCP113933.0 isoform=CRA_b"
FT                   /protein_id="EDL31971.1"
FT                   /translation="RAGRALRLAWQCHVCVGALTPGEQLGRRLPGRTWLMFSCFCFSLQ
FT                   DNSFGSAAVTECDEDTVSVHEDEDDCSGLRDEDNKENYPQVAARLDELALPSHEAQQHV
FT                   EQTLPVDGVLRTSMGNFKSRKPKSILRAESGRNHGESQETEHVVPSQSECQGRAGTPAH
FT                   ESPQSSIFRCQETVRLQPRIDQRATIWPKDAFGTQQDLHENSLLKLQALESGLCSAFLT
FT                   TQEEDGQVHGVKDPAPASTQSAPADSADPADPMPAHKDAPGDADGTSEDLQSAGTSRLL
FT                   YHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSSQQFMMPRSSSRCGSGDGKEPQT
FT                   ITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKELK
FT                   LKLSEEQGSTPKGPRRNLSCEQPPVPRENGKSEAVGPEPGSSGEETSDAVVPEKREQTP
FT                   PQDDGKGTKQDKNLIKPLYDRCRGIKQILPTPSLIPTIEEEDSDEDCPQGSQQPSLPDP
FT                   VSRLPVGDHLIYSETEPVRTLLPDEKKEGKQPALSMSNLHEATMPVLLDHLRETRADKK
FT                   RLRKALREFEEQFFKQTGRSPQKEDRMPMADEYCEYKHIKAKLRLLEVLISKQDVAKTI
FT                   "
FT   mRNA            join(11773164..11773325,11781008..11781064,
FT                   11783277..11783478,11809940..11810058,11832649..11832712,
FT                   11854472..11854619,11868381..11868591,11870064..11870202,
FT                   11876511..11876592,11878195..11878397,11885562..11885657,
FT                   11886896..11887092,11888355..11888456,11891107..11893074)
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, transcript variant
FT                   mCT8660"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT8660.1 created on
FT                   24-SEP-2002"
FT   mRNA            join(<11773164..11773325,11781008..11781064,
FT                   11783277..11783478,11809940..11810058,11832649..11832712,
FT                   11854472..11854619,11868381..11868591,11870064..11870202,
FT                   11876511..11878873)
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, transcript variant
FT                   mCT192961"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192961.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<11773165..11773325,11781008..11781064,
FT                   11783277..11783478,11809940..11810058,11832649..11832712,
FT                   11854472..11854619,11868381..11868591,11870064..11870202,
FT                   11876511..11876636)
FT                   /codon_start=1
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, isoform CRA_f"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT192961.0
FT                   protein_id=mCP113937.0 isoform=CRA_f"
FT                   /protein_id="EDL31975.1"
FT                   /translation="GRALRLAWQCHVCVGALTPGEQLGRRLPGRTWLMFSCFCFSLQDN
FT                   SFGSAAVTECDEDTVSVHEDEDDCSGLRDEDNKENYPQVAARLDELALPSHEAQQHVEQ
FT                   TLPVDGVLRTSMGNFKSRKPKSILRAESGRNHGESQETEHVVPSQSECQGRAGTPAHES
FT                   PQSSIFRCQETVRLQPRIDQRATIWPKDAFGTQQDLHENSLLKLQALESGLCSAFLTTQ
FT                   EEDGQVHGVKDPAPASTQSAPADSADPADPMPAHKDAPGDADGTSEDLQSAGTSRLLYH
FT                   ITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSSQQFMMPRSSSRCGSGDGKEPQTIT
FT                   QLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKGKCPF
FT                   PQRAPSVIA"
FT   CDS             join(11773264..11773325,11781008..11781064,
FT                   11783277..11783478,11809940..11810058,11832649..11832712,
FT                   11854472..11854619,11868381..11868591,11870064..11870202,
FT                   11876511..11876592,11878195..11878397,11885562..11885657,
FT                   11886896..11887092,11888355..11888456,11891107..11891230)
FT                   /codon_start=1
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, isoform CRA_g"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT8660.1
FT                   protein_id=mCP16961.1 isoform=CRA_g"
FT                   /db_xref="GOA:Q9DBR2"
FT                   /db_xref="MGI:MGI:1918971"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9DBR2"
FT                   /protein_id="EDL31976.1"
FT                   /translation="MFSCFCFSLQDNSFGSAAVTECDEDTVSVHEDEDDCSGLRDEDNK
FT                   ENYPQVAARLDELALPSHEAQQHVEQTLPVDGVLRTSMGNFKSRKPKSILRAESGRNHG
FT                   ESQETEHVVPSQSECQGRAGTPAHESPQSSIFRCQETVRLQPRIDQRATIWPKDAFGTQ
FT                   QDLHENSLLKLQALESGLCSAFLTTQEEDGQVHGVKDPAPASTQSAPADSADPADPMPA
FT                   HKDAPGDADGTSEDLQSAGTSRLLYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPP
FT                   SSQQFMMPRSSSRCGSGDGKEPQTITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDK
FT                   TSNPEVLKWMNDLAKGRKQLKELKLKLSEEQGSTPKGPRRNLSCEQPPVPRENGKSEAV
FT                   GPEPGSSGEETSDAVVPEKREQTPPQDDGKGTKQDKNLIKPLYDRCRGIKQILPTPSLI
FT                   PTIQEEEDSDEDCPQGSQQPSLPDPVSRLPVGDHLIYSETEPVRTLLPDEKKEGKQPAL
FT                   SMSNLHEATMPVLLDHLRETRADKKRLRKALREFEEQFFKQTGRSPQKEDRMPMADEYC
FT                   EYKHIKAKLRLLEVLISKQDVAKTI"
FT   CDS             join(11783404..11783478,11809940..11810058,
FT                   11832649..11832712,11854472..11854619,11868381..11868591,
FT                   11870064..11870202,11876511..11876592,11878195..11878397,
FT                   11885562..11885657,11886896..11887092,11888355..11888456,
FT                   11891107..11891230)
FT                   /codon_start=1
FT                   /gene="1200015N20Rik"
FT                   /locus_tag="mCG_1002"
FT                   /product="RIKEN cDNA 1200015N20, isoform CRA_a"
FT                   /note="gene_id=mCG1002.1 transcript_id=mCT173585.0
FT                   protein_id=mCP96504.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9S1"
FT                   /db_xref="MGI:MGI:1918971"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9S1"
FT                   /protein_id="EDL31970.1"
FT                   /translation="MGNFKSRKPKSILRAESGRNHGESQETEHVVPSQSECQGRAGTPA
FT                   HESPQSSIFRCQETVRLQPRIDQRATIWPKDAFGTQQDLHENSLLKLQALESGLCSAFL
FT                   TTQEEDGQVHGVKDPAPASTQSAPADSADPADPMPAHKDAPGDADGTSEDLQSAGTSRL
FT                   LYHITDGDNPLLSPRCSIFSQSQRFNLDPESAPSPPSSQQFMMPRSSSRCGSGDGKEPQ
FT                   TITQLTKHIQSLKRKIRKFEEKFEQEKKYRPSHGDKTSNPEVLKWMNDLAKGRKQLKEL
FT                   KLKLSEEQGSTPKGPRRNLSCEQPPVPRENGKSEAVGPEPGSSGEETSDAVVPEKREQT
FT                   PPQDDGKGTKQDKNLIKPLYDRCRGIKQILPTPSLIPTIQEEEDSDEDCPQGSQQPSLP
FT                   DPVSRLPVGDHLIYSETEPVRTLLPDEKKEGKQPALSMSNLHEATMPVLLDHLRETRAD
FT                   KKRLRKALREFEEQFFKQTGRSPQKEDRMPMADEYCEYKHIKAKLRLLEVLISKQDVAK
FT                   TI"
FT   gene            complement(11838602..11838989)
FT                   /pseudo
FT                   /locus_tag="mCG_48937"
FT                   /note="gene_id=mCG48937.1"
FT   mRNA            complement(11838602..11838989)
FT                   /pseudo
FT                   /locus_tag="mCG_48937"
FT                   /note="gene_id=mCG48937.1 transcript_id=mCT49120.1 created
FT                   on 31-OCT-2002"
FT   gene            complement(11891553..11990142)
FT                   /gene="Phyhipl"
FT                   /locus_tag="mCG_1007"
FT                   /note="gene_id=mCG1007.3"
FT   mRNA            complement(join(11891553..11893648,11899041..11899158,
FT                   11902769..11902943,11904690..11904886,11990069..11990142))
FT                   /gene="Phyhipl"
FT                   /locus_tag="mCG_1007"
FT                   /product="phytanoyl-CoA hydroxylase interacting
FT                   protein-like, transcript variant mCT175040"
FT                   /note="gene_id=mCG1007.3 transcript_id=mCT175040.1 created
FT                   on 26-NOV-2003"
FT   mRNA            complement(join(11891553..11893648,11899041..11899158,
FT                   11902769..11902943,11904690..11904886,11941327..11941440,
FT                   11943505..11943596,11959570..11959641,11959944..11960227,
FT                   11990069..11990142))
FT                   /gene="Phyhipl"
FT                   /locus_tag="mCG_1007"
FT                   /product="phytanoyl-CoA hydroxylase interacting
FT                   protein-like, transcript variant mCT8667"
FT                   /note="gene_id=mCG1007.3 transcript_id=mCT8667.3 created on
FT                   26-NOV-2003"
FT   mRNA            complement(join(11891553..11893648,11899041..11899158,
FT                   11902769..11902943,11904690..11904886,11932844..11933131))
FT                   /gene="Phyhipl"
FT                   /locus_tag="mCG_1007"
FT                   /product="phytanoyl-CoA hydroxylase interacting
FT                   protein-like, transcript variant mCT175039"
FT                   /note="gene_id=mCG1007.3 transcript_id=mCT175039.1 created
FT                   on 26-NOV-2003"
FT   CDS             complement(join(11893114..11893648,11899041..11899158,
FT                   11902769..11902943,11904690..11904886,11990069..11990141))
FT                   /codon_start=1
FT                   /gene="Phyhipl"
FT                   /locus_tag="mCG_1007"
FT                   /product="phytanoyl-CoA hydroxylase interacting
FT                   protein-like, isoform CRA_b"
FT                   /note="gene_id=mCG1007.3 transcript_id=mCT175040.1
FT                   protein_id=mCP97958.0 isoform=CRA_b"
FT                   /protein_id="EDL31966.1"
FT                   /translation="MLQCCYFEEKAVTKPSREGFMNVPRNKSQDSGIAEMEELPVPHNI
FT                   KINNITCDSFKISWDMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLP
FT                   MTVRGHWFLSPRTEYTVAVQTASKQVDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKAD
FT                   VIAGRMLKFSVFYRNQHKEYFDYVREHYGNAMQPSIKDNSGSHGSPISGKLEGIFFSCS
FT                   TEFNTGKPPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHYVILVIAPVGSPG
FT                   DEFCKQRLPQLNSKDNNFLTCTEEDGVLVYHHAQDVILEVIYTDPVALSLGTVAEITGH
FT                   QLMSLSTANAKKDPSCKTCNISVGR"
FT   CDS             complement(join(11893114..11893648,11899041..11899158,
FT                   11902769..11902943,11904690..11904886,11941327..11941339))
FT                   /codon_start=1
FT                   /gene="Phyhipl"
FT                   /locus_tag="mCG_1007"
FT                   /product="phytanoyl-CoA hydroxylase interacting
FT                   protein-like, isoform CRA_c"
FT                   /note="gene_id=mCG1007.3 transcript_id=mCT8667.3
FT                   protein_id=mCP16968.2 isoform=CRA_c"
FT                   /protein_id="EDL31967.1"
FT                   /translation="MAQAGNKSQDSGIAEMEELPVPHNIKINNITCDSFKISWDMDSKS
FT                   KDRITHYFIDLNKKENKNSNKFKHKDVPTKLVAKAVPLPMTVRGHWFLSPRTEYTVAVQ
FT                   TASKQVDGDYVVSEWSEIIEFCTADYSKVHLTQLLEKADVIAGRMLKFSVFYRNQHKEY
FT                   FDYVREHYGNAMQPSIKDNSGSHGSPISGKLEGIFFSCSTEFNTGKPPQDSPYGRYRFE
FT                   IAAEKLFNPNTNLYFGDFYCMYTAYHYVILVIAPVGSPGDEFCKQRLPQLNSKDNNFLT
FT                   CTEEDGVLVYHHAQDVILEVIYTDPVALSLGTVAEITGHQLMSLSTANAKKDPSCKTCN
FT                   ISVGR"
FT   CDS             complement(join(11893114..11893648,11899041..11899158,
FT                   11902769..11902943,11904690..11904886,11932844..11932946))
FT                   /codon_start=1
FT                   /gene="Phyhipl"
FT                   /locus_tag="mCG_1007"
FT                   /product="phytanoyl-CoA hydroxylase interacting
FT                   protein-like, isoform CRA_a"
FT                   /note="gene_id=mCG1007.3 transcript_id=mCT175039.1
FT                   protein_id=mCP97959.0 isoform=CRA_a"
FT                   /protein_id="EDL31965.1"
FT                   /translation="MEVPRLDHALSSPSSPCEEIKNLSLEAIQLCDRDGNKSQDSGIAE
FT                   MEELPVPHNIKINNITCDSFKISWDMDSKSKDRITHYFIDLNKKENKNSNKFKHKDVPT
FT                   KLVAKAVPLPMTVRGHWFLSPRTEYTVAVQTASKQVDGDYVVSEWSEIIEFCTADYSKV
FT                   HLTQLLEKADVIAGRMLKFSVFYRNQHKEYFDYVREHYGNAMQPSIKDNSGSHGSPISG
FT                   KLEGIFFSCSTEFNTGKPPQDSPYGRYRFEIAAEKLFNPNTNLYFGDFYCMYTAYHYVI
FT                   LVIAPVGSPGDEFCKQRLPQLNSKDNNFLTCTEEDGVLVYHHAQDVILEVIYTDPVALS
FT                   LGTVAEITGHQLMSLSTANAKKDPSCKTCNISVGR"
FT   gene            complement(11934889..11990142)
FT                   /locus_tag="mCG_145721"
FT                   /note="gene_id=mCG145721.0"
FT   mRNA            complement(join(11934889..11936380,11941327..11941440,
FT                   11959570..11959641,11990069..11990142))
FT                   /locus_tag="mCG_145721"
FT                   /product="mCG145721, transcript variant mCT185333"
FT                   /note="gene_id=mCG145721.0 transcript_id=mCT185333.0
FT                   created on 13-JUN-2003"
FT   mRNA            complement(join(11934889..11936380,11941327..11941440,
FT                   11947969..11948082,11959570..11959641,11960092..11960227,
FT                   11986019..11986103))
FT                   /locus_tag="mCG_145721"
FT                   /product="mCG145721, transcript variant mCT185334"
FT                   /note="gene_id=mCG145721.0 transcript_id=mCT185334.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(join(11941427..11941440,11959570..11959641,
FT                   11990069..11990141))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145721"
FT                   /product="mCG145721, isoform CRA_a"
FT                   /note="gene_id=mCG145721.0 transcript_id=mCT185333.0
FT                   protein_id=mCP106591.0 isoform=CRA_a"
FT                   /protein_id="EDL31968.1"
FT                   /translation="MLQCCYFEEKAVTKPSREGFMNVPHCNIKLEILNRTEKFQKEYLK
FT                   LTTGNYK"
FT   CDS             complement(join(11948000..11948082,11959570..11959641,
FT                   11960092..11960116))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145721"
FT                   /product="mCG145721, isoform CRA_b"
FT                   /note="gene_id=mCG145721.0 transcript_id=mCT185334.0
FT                   protein_id=mCP106592.0 isoform=CRA_b"
FT                   /protein_id="EDL31969.1"
FT                   /translation="MSTSLNVKDCNIKLEILNRTEKFQKEYLKLTTEHKTSRQLLCGIL
FT                   KLCLINYEQSHTDK"
FT   gene            12203291..12259070
FT                   /locus_tag="mCG_1009"
FT                   /note="gene_id=mCG1009.2"
FT   mRNA            join(12203291..12203463,12206741..12206901,
FT                   12209877..12210017,12248429..12248665,12250245..12250356,
FT                   12258602..12259070)
FT                   /locus_tag="mCG_1009"
FT                   /product="mCG1009"
FT                   /note="gene_id=mCG1009.2 transcript_id=mCT8670.2 created on
FT                   31-OCT-2002"
FT   CDS             join(12203450..12203463,12206741..12206901,
FT                   12209877..12210017,12248429..12248571)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1009"
FT                   /product="mCG1009"
FT                   /note="gene_id=mCG1009.2 transcript_id=mCT8670.2
FT                   protein_id=mCP16969.2"
FT                   /protein_id="EDL31964.1"
FT                   /translation="MTGLRTVTRERNNSQRWARRARRMLNADKHQPHLKPNLTWNSNKK
FT                   GSQQGGETPPPQHTSPTEIVRANAFHKSRGTAAPLHLPPSHRASIVRSVRDSGGHVGST
FT                   DANKCMAESTLSSQWSGVPSSPLRWSTGYVTSLGRSSEHMSTQCSHRK"
FT   gene            complement(12249870..12478724)
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /note="gene_id=mCG114405.1"
FT   mRNA            complement(join(12249870..12250511,12255724..12255823,
FT                   12257218..12257378,12260578..12260734,12265232..12265386,
FT                   12265746..12265785,12268116..12268281,12269971..12270127,
FT                   12271291..12271423,12271551..12271747,12272518..12272679,
FT                   12274685..12274871,12278141..12278272,12280870..12281121,
FT                   12281768..12281962,12282407..12282460,12283520..12283678,
FT                   12285881..12285960,12346828..12346897,12398116..12398162,
FT                   12478341..12478549,12478686..12478724))
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /product="bicaudal C homolog 1 (Drosophila), transcript
FT                   variant mCT115497"
FT                   /note="gene_id=mCG114405.1 transcript_id=mCT115497.1
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(12249870..12250511,12252848..12252927,
FT                   12255724..12255823,12257218..12257378,12260578..12260734,
FT                   12265232..12265386,12265746..12265785,12268116..12268281,
FT                   12269971..12270127,12271291..12271423,12271551..12271747,
FT                   12272518..12272679,12274685..12274871,12278141..12278272,
FT                   12280870..12281121,12281768..12281962,12282407..12282460,
FT                   12283520..12283678,12285881..12285960,12346828..12346897,
FT                   12398116..12398162,12478341..12478549,12478686..12478724))
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /product="bicaudal C homolog 1 (Drosophila), transcript
FT                   variant mCT173597"
FT                   /note="gene_id=mCG114405.1 transcript_id=mCT173597.0
FT                   created on 19-JUN-2003"
FT   mRNA            complement(join(12250235..12250511,12252848..12252927,
FT                   12255724..12255823,12257218..12257378,12260578..12260734,
FT                   12265232..12265386,12265746..12265785,12268116..12268281,
FT                   12269971..12270127,12271291..12271423,12271551..12271747,
FT                   12272518..12272679,12274685..12274871,12278141..12278272,
FT                   12280870..12281121,12281768..12281962,12282407..12282460,
FT                   12283520..12283678,12285881..12285960,12346828..12346897,
FT                   12398116..12398162,12478341..>12478611))
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /product="bicaudal C homolog 1 (Drosophila), transcript
FT                   variant mCT192938"
FT                   /note="gene_id=mCG114405.1 transcript_id=mCT192938.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(12250236..12250511,12252848..12252927,
FT                   12255724..12255823,12257218..12257378,12260578..12260734,
FT                   12265232..12265386,12265746..12265785,12268116..12268281,
FT                   12269971..12270127,12271291..12271423,12271551..12271747,
FT                   12272518..12272679,12274685..12274871,12278141..12278272,
FT                   12280870..12281121,12281768..12281962,12282407..12282460,
FT                   12283520..12283678,12285881..12285960,12346828..12346897,
FT                   12398116..12398162,12465737..>12465781))
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /product="bicaudal C homolog 1 (Drosophila), transcript
FT                   variant mCT192937"
FT                   /note="gene_id=mCG114405.1 transcript_id=mCT192937.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(12250378..12250511,12255724..12255823,
FT                   12257218..12257378,12260578..12260734,12265232..12265386,
FT                   12265746..12265785,12268116..12268281,12269971..12270127,
FT                   12271291..12271423,12271551..12271747,12272518..12272679,
FT                   12274685..12274871,12278141..12278272,12280870..12281121,
FT                   12281768..12281962,12282407..12282460,12283520..12283678,
FT                   12285881..12285960,12346828..12346897,12398116..12398162,
FT                   12478341..12478536))
FT                   /codon_start=1
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /product="bicaudal C homolog 1 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG114405.1 transcript_id=mCT115497.1
FT                   protein_id=mCP54894.1 isoform=CRA_c"
FT                   /protein_id="EDL31962.1"
FT                   /translation="MASQSEPGYLAAAQSDPGSNSERSTDSPVAGSEDDLVAAAPLLHS
FT                   PEWSEERFRVDRKKLEAMLQAAAEGKGRSGEDFFQKIMEETNTQIAWPSKLKIGAKSKK
FT                   DPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMED
FT                   TGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLPLVLMFELPIAGILQPV
FT                   PDPNTPSIQHISQTYSVSVSFKQRSRMYGATVTVRGSQNNTNAVKEGTAMLLEHLAGSL
FT                   ASAIPVSTQLDIAAQHHLFMMGRNGSNVKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTI
FT                   ESVCLARQYLMGCLPLVLMFDMKEDIEVDPQVIAQLMEQLDVFISIKPKPKQPSKSVIV
FT                   KSVERNALNMYEARKCLLGLESSGVSIATSLSPASCPAGLACPSLDILASAGLGLTGLG
FT                   LLGPTTLSLNTSATPNSLLNALNTSVSPLQSSSSGTPSPTLWAPPIANTASATGFSTIP
FT                   HLMLPSTAQATLTNILLSGVPTYGHTAPSPPPGLTPVDVHINSMQTEGKNISASINGHV
FT                   QPANMKYGPLSTSSLGEKVLSSNHGDPSMQTAGPEQASPKSNSVEGCNDAFVEVGMPRS
FT                   PSHSGNAGDLKQMLGASKVSCAKRQTVELLQGTKNSHLHGTDRLLSDPELSATESPLAD
FT                   KKAPGSERAAERAAAAQQKSERARLASQPTYVHMQAFDYEQKKLLATKAMLKKPVVTEV
FT                   RTPTNTWSGLGFSKSMPAETIKELRRANHVSYKPTMTTAYEGSSLSLSRSSSREHLASG
FT                   SESDNWRDRNGIGPMGHSEFSAPIGSPKRKQNKSREHYLSSSNYMDCISSLTGSNGCNL
FT                   NSCFKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLL
FT                   AISELSKNRRKLFEPPNASCTSFLEGGASGRLPRQYHSDIASVSGRW"
FT   CDS             complement(join(12252872..12252927,12255724..12255823,
FT                   12257218..12257378,12260578..12260734,12265232..12265386,
FT                   12265746..12265785,12268116..12268281,12269971..12270127,
FT                   12271291..12271423,12271551..12271747,12272518..12272679,
FT                   12274685..12274871,12278141..12278272,12280870..12281121,
FT                   12281768..12281962,12282407..12282460,12283520..12283678,
FT                   12285881..12285960,12346828..12346897,12398116..12398162,
FT                   12478341..>12478602))
FT                   /codon_start=1
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /product="bicaudal C homolog 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG114405.1 transcript_id=mCT192938.0
FT                   protein_id=mCP113894.0 isoform=CRA_b"
FT                   /protein_id="EDL31961.1"
FT                   /translation="RCGAPSHIGRGRGGGSPSAARTMASQSEPGYLAAAQSDPGSNSER
FT                   STDSPVAGSEDDLVAAAPLLHSPEWSEERFRVDRKKLEAMLQAAAEGKGRSGEDFFQKI
FT                   MEETNTQIAWPSKLKIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDV
FT                   SHTEHSHVIGKGGNNIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARAR
FT                   IRELLPLVLMFELPIAGILQPVPDPNTPSIQHISQTYSVSVSFKQRSRMYGATVTVRGS
FT                   QNNTNAVKEGTAMLLEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNVKHIMQRTGA
FT                   QIHFPDPSNPQKKSTVYLQGTIESVCLARQYLMGCLPLVLMFDMKEDIEVDPQVIAQLM
FT                   EQLDVFISIKPKPKQPSKSVIVKSVERNALNMYEARKCLLGLESSGVSIATSLSPASCP
FT                   AGLACPSLDILASAGLGLTGLGLLGPTTLSLNTSATPNSLLNALNTSVSPLQSSSSGTP
FT                   SPTLWAPPIANTASATGFSTIPHLMLPSTAQATLTNILLSGVPTYGHTAPSPPPGLTPV
FT                   DVHINSMQTEGKNISASINGHVQPANMKYGPLSTSSLGEKVLSSNHGDPSMQTAGPEQA
FT                   SPKSNSVEGCNDAFVEVGMPRSPSHSGNAGDLKQMLGASKVSCAKRQTVELLQGTKNSH
FT                   LHGTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQKSERARLASQPTYVHMQAF
FT                   DYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANHVSYKPTMT
FT                   TAYEGSSLSLSRSSSREHLASGSESDNWRDRNGIGPMGHSEFSAPIGSPKRKQNKSREH
FT                   YLSSSNYMDCISSLTGSNGCNLNSCFKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLT
FT                   LTDQDLKELGITTFGARRKMLLAISVCDSVQIRNKILRAARIL"
FT   CDS             complement(join(12252872..12252927,12255724..12255823,
FT                   12257218..12257378,12260578..12260734,12265232..12265386,
FT                   12265746..12265785,12268116..12268281,12269971..12270127,
FT                   12271291..12271423,12271551..12271747,12272518..12272679,
FT                   12274685..12274871,12278141..12278272,12280870..12281121,
FT                   12281768..12281962,12282407..12282460,12283520..12283678,
FT                   12285881..12285960,12346828..12346897,12398116..12398162,
FT                   12478341..12478536))
FT                   /codon_start=1
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /product="bicaudal C homolog 1 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG114405.1 transcript_id=mCT173597.0
FT                   protein_id=mCP96516.0 isoform=CRA_d"
FT                   /db_xref="GOA:G3X8S6"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR021129"
FT                   /db_xref="MGI:MGI:1933388"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8S6"
FT                   /protein_id="EDL31963.1"
FT                   /translation="MASQSEPGYLAAAQSDPGSNSERSTDSPVAGSEDDLVAAAPLLHS
FT                   PEWSEERFRVDRKKLEAMLQAAAEGKGRSGEDFFQKIMEETNTQIAWPSKLKIGAKSKK
FT                   DPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGNNIKKVMED
FT                   TGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLPLVLMFELPIAGILQPV
FT                   PDPNTPSIQHISQTYSVSVSFKQRSRMYGATVTVRGSQNNTNAVKEGTAMLLEHLAGSL
FT                   ASAIPVSTQLDIAAQHHLFMMGRNGSNVKHIMQRTGAQIHFPDPSNPQKKSTVYLQGTI
FT                   ESVCLARQYLMGCLPLVLMFDMKEDIEVDPQVIAQLMEQLDVFISIKPKPKQPSKSVIV
FT                   KSVERNALNMYEARKCLLGLESSGVSIATSLSPASCPAGLACPSLDILASAGLGLTGLG
FT                   LLGPTTLSLNTSATPNSLLNALNTSVSPLQSSSSGTPSPTLWAPPIANTASATGFSTIP
FT                   HLMLPSTAQATLTNILLSGVPTYGHTAPSPPPGLTPVDVHINSMQTEGKNISASINGHV
FT                   QPANMKYGPLSTSSLGEKVLSSNHGDPSMQTAGPEQASPKSNSVEGCNDAFVEVGMPRS
FT                   PSHSGNAGDLKQMLGASKVSCAKRQTVELLQGTKNSHLHGTDRLLSDPELSATESPLAD
FT                   KKAPGSERAAERAAAAQQKSERARLASQPTYVHMQAFDYEQKKLLATKAMLKKPVVTEV
FT                   RTPTNTWSGLGFSKSMPAETIKELRRANHVSYKPTMTTAYEGSSLSLSRSSSREHLASG
FT                   SESDNWRDRNGIGPMGHSEFSAPIGSPKRKQNKSREHYLSSSNYMDCISSLTGSNGCNL
FT                   NSCFKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTFGARRKMLL
FT                   AISVCDSVQIRNKILRAARIL"
FT   CDS             complement(join(12252872..12252927,12255724..12255823,
FT                   12257218..12257378,12260578..12260734,12265232..12265386,
FT                   12265746..12265785,12268116..12268281,12269971..12270127,
FT                   12271291..12271423,12271551..12271747,12272518..12272679,
FT                   12274685..12274871,12278141..12278272,12280870..12281121,
FT                   12281768..12281962,12282407..12282460,12283520..12283678,
FT                   12285881..12285960,12346828..12346897,12398116..12398162,
FT                   12465737..>12465779))
FT                   /codon_start=1
FT                   /gene="Bicc1"
FT                   /locus_tag="mCG_114405"
FT                   /product="bicaudal C homolog 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG114405.1 transcript_id=mCT192937.0
FT                   protein_id=mCP113893.0 isoform=CRA_a"
FT                   /protein_id="EDL31960.1"
FT                   /translation="QGGLPCSAEGARRGSAAEGKGRSGEDFFQKIMEETNTQIAWPSKL
FT                   KIGAKSKKDPHIKVSGKKEDVKEAKEMIMSVLDTKSNRVTLKMDVSHTEHSHVIGKGGN
FT                   NIKKVMEDTGCHIHFPDSNRNNQAEKSNQVSIAGQPAGVESARARIRELLPLVLMFELP
FT                   IAGILQPVPDPNTPSIQHISQTYSVSVSFKQRSRMYGATVTVRGSQNNTNAVKEGTAML
FT                   LEHLAGSLASAIPVSTQLDIAAQHHLFMMGRNGSNVKHIMQRTGAQIHFPDPSNPQKKS
FT                   TVYLQGTIESVCLARQYLMGCLPLVLMFDMKEDIEVDPQVIAQLMEQLDVFISIKPKPK
FT                   QPSKSVIVKSVERNALNMYEARKCLLGLESSGVSIATSLSPASCPAGLACPSLDILASA
FT                   GLGLTGLGLLGPTTLSLNTSATPNSLLNALNTSVSPLQSSSSGTPSPTLWAPPIANTAS
FT                   ATGFSTIPHLMLPSTAQATLTNILLSGVPTYGHTAPSPPPGLTPVDVHINSMQTEGKNI
FT                   SASINGHVQPANMKYGPLSTSSLGEKVLSSNHGDPSMQTAGPEQASPKSNSVEGCNDAF
FT                   VEVGMPRSPSHSGNAGDLKQMLGASKVSCAKRQTVELLQGTKNSHLHGTDRLLSDPELS
FT                   ATESPLADKKAPGSERAAERAAAAQQKSERARLASQPTYVHMQAFDYEQKKLLATKAML
FT                   KKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRANHVSYKPTMTTAYEGSSLSLSRSS
FT                   SREHLASGSESDNWRDRNGIGPMGHSEFSAPIGSPKRKQNKSREHYLSSSNYMDCISSL
FT                   TGSNGCNLNSCFKGSDLPELFSKLGLGKYTDVFQQQEIDLQTFLTLTDQDLKELGITTF
FT                   GARRKMLLAISVCDSVQIRNKILRAARIL"
FT   gene            12481728..12482300
FT                   /pseudo
FT                   /locus_tag="mCG_1044176"
FT                   /note="gene_id=mCG1044176.1"
FT   mRNA            12481728..12482300
FT                   /pseudo
FT                   /locus_tag="mCG_1044176"
FT                   /note="gene_id=mCG1044176.1 transcript_id=mCT161880.1
FT                   created on 31-OCT-2002"
FT   gene            complement(12489739..12500953)
FT                   /locus_tag="mCG_1044286"
FT                   /note="gene_id=mCG1044286.1"
FT   mRNA            complement(join(12489739..12490368,12490764..12490862,
FT                   12496759..12496885,12500903..12500953))
FT                   /locus_tag="mCG_1044286"
FT                   /product="mCG1044286, transcript variant mCT175042"
FT                   /note="gene_id=mCG1044286.1 transcript_id=mCT175042.0
FT                   created on 18-DEC-2002"
FT   mRNA            complement(join(12489739..12490368,12490764..12490862,
FT                   12496759..12496885,12497710..12497787,12500903..12500953))
FT                   /locus_tag="mCG_1044286"
FT                   /product="mCG1044286, transcript variant mCT161990"
FT                   /note="gene_id=mCG1044286.1 transcript_id=mCT161990.1
FT                   created on 18-DEC-2002"
FT   CDS             complement(join(12490800..12490862,12496759..12496839))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044286"
FT                   /product="mCG1044286, isoform CRA_a"
FT                   /note="gene_id=mCG1044286.1 transcript_id=mCT175042.0
FT                   protein_id=mCP97961.0 isoform=CRA_a"
FT                   /protein_id="EDL31958.1"
FT                   /translation="MLMIPMLRRTAAGLRLSWAIEAITGYGQATGSPGDLLTCGDCKPS
FT                   LT"
FT   CDS             complement(join(12490800..12490862,12496759..12496839))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044286"
FT                   /product="mCG1044286, isoform CRA_a"
FT                   /note="gene_id=mCG1044286.1 transcript_id=mCT161990.1
FT                   protein_id=mCP55063.1 isoform=CRA_a"
FT                   /protein_id="EDL31959.1"
FT                   /translation="MLMIPMLRRTAAGLRLSWAIEAITGYGQATGSPGDLLTCGDCKPS
FT                   LT"
FT   gene            12520644..12523387
FT                   /locus_tag="mCG_1044285"
FT                   /note="gene_id=mCG1044285.0"
FT   mRNA            join(12520644..12520711,12523025..12523387)
FT                   /locus_tag="mCG_1044285"
FT                   /product="mCG1044285"
FT                   /note="gene_id=mCG1044285.0 transcript_id=mCT161989.0
FT                   created on 31-OCT-2002"
FT   CDS             12523047..12523202
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044285"
FT                   /product="mCG1044285"
FT                   /note="gene_id=mCG1044285.0 transcript_id=mCT161989.0
FT                   protein_id=mCP55061.1"
FT                   /protein_id="EDL31957.1"
FT                   /translation="MECQNTVQAWSCVVRFLNACKKMGQDSCNLSFFKNKKQNCSWNVL
FT                   ACPFQV"
FT   gene            complement(12546495..12557186)
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /note="gene_id=mCG17822.2"
FT   mRNA            complement(join(12546495..12547603,12547991..12548047,
FT                   12552261..12552356,12553769..12553918,12554447..12554517,
FT                   12555820..12555935,12556744..12557186))
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /product="transcription factor A, mitochondrial, transcript
FT                   variant mCT16156"
FT                   /note="gene_id=mCG17822.2 transcript_id=mCT16156.1 created
FT                   on 24-SEP-2002"
FT   mRNA            complement(join(12546495..12547603,12547991..12548047,
FT                   12552261..12552356,12553769..12553918,12554447..12554517,
FT                   12555820..12555935,12557139..12557177))
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /product="transcription factor A, mitochondrial, transcript
FT                   variant mCT173617"
FT                   /note="gene_id=mCG17822.2 transcript_id=mCT173617.0 created
FT                   on 24-SEP-2002"
FT   mRNA            complement(join(12546495..12547603,12547991..12548047,
FT                   12552261..12552356,12553769..12553918,12554447..12554517,
FT                   12555820..12555935,12556362..12556565))
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /product="transcription factor A, mitochondrial, transcript
FT                   variant mCT173619"
FT                   /note="gene_id=mCG17822.2 transcript_id=mCT173619.0 created
FT                   on 24-SEP-2002"
FT   mRNA            complement(join(12546495..12547603,12547991..12548047,
FT                   12552261..12552356,12553769..12553918,12554187..12554206))
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /product="transcription factor A, mitochondrial, transcript
FT                   variant mCT173618"
FT                   /note="gene_id=mCG17822.2 transcript_id=mCT173618.0 created
FT                   on 24-SEP-2002"
FT   CDS             complement(join(12547463..12547603,12547991..12548047,
FT                   12552261..12552356,12553769..12553918,12554447..12554517,
FT                   12555820..12555935,12557139..12557155))
FT                   /codon_start=1
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /product="transcription factor A, mitochondrial, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17822.2 transcript_id=mCT173617.0
FT                   protein_id=mCP96537.0 isoform=CRA_a"
FT                   /protein_id="EDL31953.1"
FT                   /translation="MAGAWGLVCIPKCFSSMGSYPKKPMSSYLRFSTEQLPKFKAKHPD
FT                   AKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEA
FT                   RQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNL
FT                   SPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH"
FT   CDS             complement(join(12547463..12547603,12547991..12548047,
FT                   12552261..12552356,12553769..12553918,12554447..12554517,
FT                   12555820..12555935,12556744..12556844))
FT                   /codon_start=1
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /product="transcription factor A, mitochondrial, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG17822.2 transcript_id=mCT16156.1
FT                   protein_id=mCP16957.1 isoform=CRA_d"
FT                   /protein_id="EDL31956.1"
FT                   /translation="MALFRGMWSVLKALGRTGVEMCAGCGGRIPSSISLVCIPKCFSSM
FT                   GSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKA
FT                   EWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNI
FT                   YVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMA
FT                   EVGRSDLIRRSVKRSGDISEH"
FT   CDS             complement(join(12547463..12547603,12547991..12548047,
FT                   12552261..12552356,12553769..12553918,12554447..12554517,
FT                   12555820..12555904))
FT                   /codon_start=1
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /product="transcription factor A, mitochondrial, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG17822.2 transcript_id=mCT173619.0
FT                   protein_id=mCP96536.0 isoform=CRA_c"
FT                   /protein_id="EDL31955.1"
FT                   /translation="MGSYPKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRE
FT                   LPEAEKKVYEADFKAEWKAYKEAVSKYKEQLTPSQLMGMEKEARQRRLKKKALVKRREL
FT                   ILLGKPKRPRSAYNIYVSESFQEAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDR
FT                   IRYDNEMKSWEEQMAEVGRSDLIRRSVKRSGDISEH"
FT   CDS             complement(join(12547463..12547603,12547991..12548047,
FT                   12552261..12552356,12553769..12553831))
FT                   /codon_start=1
FT                   /gene="Tfam"
FT                   /locus_tag="mCG_17822"
FT                   /product="transcription factor A, mitochondrial, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17822.2 transcript_id=mCT173618.0
FT                   protein_id=mCP96538.0 isoform=CRA_b"
FT                   /protein_id="EDL31954.1"
FT                   /translation="MGMEKEARQRRLKKKALVKRRELILLGKPKRPRSAYNIYVSESFQ
FT                   EAKDDSAQGKLKLVNEAWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDL
FT                   IRRSVKRSGDISEH"
FT   gene            complement(12573886..12603964)
FT                   /gene="Ube2d1"
FT                   /locus_tag="mCG_17825"
FT                   /note="gene_id=mCG17825.2"
FT   mRNA            complement(join(12573886..12574780,12575521..12575614,
FT                   12577107..12577212,12578648..12578725,12580990..12581021,
FT                   12581105..12581168,12603844..12603964))
FT                   /gene="Ube2d1"
FT                   /locus_tag="mCG_17825"
FT                   /product="ubiquitin-conjugating enzyme E2D 1, UBC4/5
FT                   homolog (yeast), transcript variant mCT16159"
FT                   /note="gene_id=mCG17825.2 transcript_id=mCT16159.2 created
FT                   on 31-OCT-2002"
FT   CDS             complement(join(12574735..12574780,12575521..12575614,
FT                   12577107..12577212,12578648..12578725,12580990..12581021,
FT                   12581105..12581168,12603844..12603867))
FT                   /codon_start=1
FT                   /gene="Ube2d1"
FT                   /locus_tag="mCG_17825"
FT                   /product="ubiquitin-conjugating enzyme E2D 1, UBC4/5
FT                   homolog (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG17825.2 transcript_id=mCT16159.2
FT                   protein_id=mCP16971.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UFQ4"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:2384911"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UFQ4"
FT                   /protein_id="EDL31952.1"
FT                   /translation="MALKRIQKELSDLQRDPPAHCSAGPVGDDLFHWQATIMGPPDSAY
FT                   QGGVFFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLL
FT                   SICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM"
FT   mRNA            complement(join(12576611..12577212,12578648..12581021,
FT                   12581105..12581168,12603844..>12603961))
FT                   /gene="Ube2d1"
FT                   /locus_tag="mCG_17825"
FT                   /product="ubiquitin-conjugating enzyme E2D 1, UBC4/5
FT                   homolog (yeast), transcript variant mCT192932"
FT                   /note="gene_id=mCG17825.2 transcript_id=mCT192932.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(12580372..>12580716)
FT                   /codon_start=1
FT                   /gene="Ube2d1"
FT                   /locus_tag="mCG_17825"
FT                   /product="ubiquitin-conjugating enzyme E2D 1, UBC4/5
FT                   homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG17825.2 transcript_id=mCT192932.0
FT                   protein_id=mCP113913.0 isoform=CRA_a"
FT                   /protein_id="EDL31951.1"
FT                   /translation="FLIQHQLFLKEVESSSHIHSSQRFEISLTQEWNCSIRPASVCSRS
FT                   WLSTWSGGALLWGDLCHLLSLLLYLKPTALSLALPCYLYFFPTQGAVMTVRRPLPFHEQ
FT                   NANSERAGAR"
FT   gene            12637450..12638069
FT                   /pseudo
FT                   /locus_tag="mCG_50528"
FT                   /note="gene_id=mCG50528.1"
FT   mRNA            12637450..12638069
FT                   /pseudo
FT                   /locus_tag="mCG_50528"
FT                   /note="gene_id=mCG50528.1 transcript_id=mCT50711.2 created
FT                   on 31-OCT-2002"
FT   gene            complement(12649176..12663573)
FT                   /gene="Zcd1"
FT                   /locus_tag="mCG_17826"
FT                   /note="gene_id=mCG17826.2"
FT   mRNA            complement(join(12649176..12649811,12654899..12655104,
FT                   12663408..12663573))
FT                   /gene="Zcd1"
FT                   /locus_tag="mCG_17826"
FT                   /product="zinc finger, CDGSH-type domain 1"
FT                   /note="gene_id=mCG17826.2 transcript_id=mCT16160.2 created
FT                   on 24-SEP-2002"
FT   CDS             complement(join(12649722..12649811,12654899..12655104,
FT                   12663408..12663438))
FT                   /codon_start=1
FT                   /gene="Zcd1"
FT                   /locus_tag="mCG_17826"
FT                   /product="zinc finger, CDGSH-type domain 1"
FT                   /note="gene_id=mCG17826.2 transcript_id=mCT16160.2
FT                   protein_id=mCP16972.2"
FT                   /protein_id="EDL31950.1"
FT                   /translation="MGLSSNSAVRVEWIAAVTFAAGTAALGYLAYKKFYAKENRTKAMV
FT                   NLQIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIK
FT                   KKET"
FT   gene            12666518..12704884
FT                   /gene="Ipmk"
FT                   /locus_tag="mCG_17824"
FT                   /note="gene_id=mCG17824.2"
FT   mRNA            join(12666518..12666774,12682130..12682215,
FT                   12684689..12684785,12691385..12691560,12695381..12695462,
FT                   12699896..12704884)
FT                   /gene="Ipmk"
FT                   /locus_tag="mCG_17824"
FT                   /product="inositol polyphosphate multikinase, transcript
FT                   variant mCT175050"
FT                   /note="gene_id=mCG17824.2 transcript_id=mCT175050.0 created
FT                   on 31-OCT-2002"
FT   mRNA            join(12666518..12666774,12682130..12682215,
FT                   12684689..12684785,12691388..12691560,12695381..12695462,
FT                   12699896..12704884)
FT                   /gene="Ipmk"
FT                   /locus_tag="mCG_17824"
FT                   /product="inositol polyphosphate multikinase, transcript
FT                   variant mCT16158"
FT                   /note="gene_id=mCG17824.2 transcript_id=mCT16158.2 created
FT                   on 31-OCT-2002"
FT   mRNA            join(12666518..12666774,12682130..12682215,
FT                   12684689..12684785,12691388..12691560,12695381..12696090)
FT                   /gene="Ipmk"
FT                   /locus_tag="mCG_17824"
FT                   /product="inositol polyphosphate multikinase, transcript
FT                   variant mCT175049"
FT                   /note="gene_id=mCG17824.2 transcript_id=mCT175049.0 created
FT                   on 31-OCT-2002"
FT   CDS             join(12666753..12666774,12682130..12682215,
FT                   12684689..12684785,12691385..12691560,12695381..12695462,
FT                   12699896..12700509)
FT                   /codon_start=1
FT                   /gene="Ipmk"
FT                   /locus_tag="mCG_17824"
FT                   /product="inositol polyphosphate multikinase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG17824.2 transcript_id=mCT175050.0
FT                   protein_id=mCP97968.0 isoform=CRA_c"
FT                   /protein_id="EDL31949.1"
FT                   /translation="MYGKDKVGILQHPDGTVLKQLQPPPRGPRELEFYTMVYAADCADA
FT                   VLLELRKHLPKYYGVWSPPTAPNADVYLKLEDVTHKFNKPCIMDVKIGRKSYDPFASSE
FT                   KIQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQHYGRGLTKETLKEGVSKFFHNG
FT                   FCLRKDAIAASIQKVEKILQWFENQKQLNFYASSLLFVYEGSSQPATTKANDRTLAGRF
FT                   LSKGPLTDADGLECNNNFHLFGAPPNGMSVGKSLSKAYSRHRKLYAKKHQSQTSLKVET
FT                   LEQDNGWRSMSQEHLNGNVLAQLEKVFYHLPAGRPEIPEAEVRMIDFAHVFPSNTVDEG
FT                   YVYGLKHLIAVLRSILDS"
FT   CDS             join(12666753..12666774,12682130..12682215,
FT                   12684689..12684785,12691388..12691560,12695381..12695462,
FT                   12699896..12700509)
FT                   /codon_start=1
FT                   /gene="Ipmk"
FT                   /locus_tag="mCG_17824"
FT                   /product="inositol polyphosphate multikinase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG17824.2 transcript_id=mCT16158.2
FT                   protein_id=mCP16964.2 isoform=CRA_a"
FT                   /protein_id="EDL31947.1"
FT                   /translation="MYGKDKVGILQHPDGTVLKQLQPPPRGPRELEFYTMVYAADCADA
FT                   VLLELRKHLPKYYGVWSPPTAPNDVYLKLEDVTHKFNKPCIMDVKIGRKSYDPFASSEK
FT                   IQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQHYGRGLTKETLKEGVSKFFHNGF
FT                   CLRKDAIAASIQKVEKILQWFENQKQLNFYASSLLFVYEGSSQPATTKANDRTLAGRFL
FT                   SKGPLTDADGLECNNNFHLFGAPPNGMSVGKSLSKAYSRHRKLYAKKHQSQTSLKVETL
FT                   EQDNGWRSMSQEHLNGNVLAQLEKVFYHLPAGRPEIPEAEVRMIDFAHVFPSNTVDEGY
FT                   VYGLKHLIAVLRSILDS"
FT   CDS             join(12666753..12666774,12682130..12682215,
FT                   12684689..12684785,12691388..12691560,12695381..12695536)
FT                   /codon_start=1
FT                   /gene="Ipmk"
FT                   /locus_tag="mCG_17824"
FT                   /product="inositol polyphosphate multikinase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG17824.2 transcript_id=mCT175049.0
FT                   protein_id=mCP97969.0 isoform=CRA_b"
FT                   /protein_id="EDL31948.1"
FT                   /translation="MYGKDKVGILQHPDGTVLKQLQPPPRGPRELEFYTMVYAADCADA
FT                   VLLELRKHLPKYYGVWSPPTAPNDVYLKLEDVTHKFNKPCIMDVKIGRKSYDPFASSEK
FT                   IQQQVSKYPLMEEIGFLVLGMRVYHLHSDSYETQNQHYGRGLTKETLKEGEPWSGAAAA
FT                   VSKMALTRFSSPLE"
FT   gene            12801811..12802402
FT                   /pseudo
FT                   /locus_tag="mCG_55920"
FT                   /note="gene_id=mCG55920.2"
FT   mRNA            12801811..12802402
FT                   /pseudo
FT                   /locus_tag="mCG_55920"
FT                   /note="gene_id=mCG55920.2 transcript_id=mCT56103.2 created
FT                   on 31-OCT-2002"
FT   gene            complement(12914885..12916164)
FT                   /pseudo
FT                   /locus_tag="mCG_51444"
FT                   /note="gene_id=mCG51444.1"
FT   mRNA            complement(12914885..12916164)
FT                   /pseudo
FT                   /locus_tag="mCG_51444"
FT                   /note="gene_id=mCG51444.1 transcript_id=mCT51627.1 created
FT                   on 31-OCT-2002"
FT   gene            13020051..13020437
FT                   /pseudo
FT                   /locus_tag="mCG_141455"
FT                   /note="gene_id=mCG141455.0"
FT   mRNA            13020051..13020437
FT                   /pseudo
FT                   /locus_tag="mCG_141455"
FT                   /note="gene_id=mCG141455.0 transcript_id=mCT175469.0
FT                   created on 05-NOV-2002"
FT   gene            13020627..13024194
FT                   /pseudo
FT                   /locus_tag="mCG_8445"
FT                   /note="gene_id=mCG8445.1"
FT   mRNA            join(13020627..13022387,13022818..13024194)
FT                   /pseudo
FT                   /locus_tag="mCG_8445"
FT                   /note="gene_id=mCG8445.1 transcript_id=mCT7591.1 created on
FT                   31-OCT-2002"
FT   gene            complement(13115408..13116122)
FT                   /pseudo
FT                   /locus_tag="mCG_49653"
FT                   /note="gene_id=mCG49653.2"
FT   mRNA            complement(13115408..13116122)
FT                   /pseudo
FT                   /locus_tag="mCG_49653"
FT                   /note="gene_id=mCG49653.2 transcript_id=mCT49836.2 created
FT                   on 31-OCT-2002"
FT   gene            complement(13294145..13294957)
FT                   /gene="1700049L16Rik"
FT                   /locus_tag="mCG_55119"
FT                   /note="gene_id=mCG55119.1"
FT   mRNA            complement(13294145..13294957)
FT                   /gene="1700049L16Rik"
FT                   /locus_tag="mCG_55119"
FT                   /product="RIKEN cDNA 1700049L16"
FT                   /note="gene_id=mCG55119.1 transcript_id=mCT55302.1 created
FT                   on 31-OCT-2002"
FT   CDS             complement(13294351..13294893)
FT                   /codon_start=1
FT                   /gene="1700049L16Rik"
FT                   /locus_tag="mCG_55119"
FT                   /product="RIKEN cDNA 1700049L16"
FT                   /note="gene_id=mCG55119.1 transcript_id=mCT55302.1
FT                   protein_id=mCP33468.0"
FT                   /db_xref="MGI:MGI:1920633"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BW07"
FT                   /protein_id="EDL31946.1"
FT                   /translation="MFQGMDSHSGGLGSRSMKPPGGESSDLFGSLEERLPSTRKPNRMA
FT                   SNIFGPPEEPKNIPKRTNPPGGKGSGIFDESTPVKTRQRLNPPGGKTSDIFGSPITATA
FT                   PLAHPNKPKDHVLLCEGEDSKSDLNAATNATPRGEHAKKPELTPTVDNHEPRLGPRPRS
FT                   HNKVLNPPGGKSSISFY"
FT   gene            13620779..13622747
FT                   /locus_tag="mCG_3607"
FT                   /note="gene_id=mCG3607.2"
FT   mRNA            join(13620779..13621310,13621953..13622747)
FT                   /locus_tag="mCG_3607"
FT                   /product="mCG3607"
FT                   /note="gene_id=mCG3607.2 transcript_id=mCT3167.2 created on
FT                   31-OCT-2002"
FT   CDS             join(13620891..13621310,13621953..13622729)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3607"
FT                   /product="mCG3607"
FT                   /note="gene_id=mCG3607.2 transcript_id=mCT3167.2
FT                   protein_id=mCP11682.2"
FT                   /protein_id="EDL31945.1"
FT                   /translation="MARHRNVRGYNYDEDFEDDDLYGQSVEDDYCISPSTAAQFIYSRR
FT                   DNPEEEYGYEDLRESSNSLLNHQLSEIDQARLYSCLDHMREVLGDAVPDDILTEAILKH
FT                   KFDVQKALSVVLEQDGVQPWKEKSERAVCAGQPSKGRESPSLAELFEEHRGSSSGQCFT
FT                   LSDLCNQSPASLGSLPLSQLANRSQSANGVSELTGSLSSLAFCKAAPTRDLENLSLSDL
FT                   IAKTIELDNSQINRDSFEFSLSETMRSPEVDSNIDLSVLIKTPEFVPKPVVDPSVAVTP
FT                   DTKVLSSKLGKPSNSTKDSMKPKRASLARKAPLSLPWTKALAARPSAFASTLCLRYPLK
FT                   SCKRRTLELYKTFLYSRQVQDVSDKEISPLAAITPFDFKSASPDDVVKANQKKAFTRE"
FT   gene            13965296..13985386
FT                   /gene="Zwint"
FT                   /locus_tag="mCG_3608"
FT                   /note="gene_id=mCG3608.2"
FT   mRNA            join(13965296..13965393,13966399..13966489,
FT                   13966654..13966777,13966946..13967112,13967233..13967289,
FT                   13967462..13967601,13967682..13967804,13984384..13985386)
FT                   /gene="Zwint"
FT                   /locus_tag="mCG_3608"
FT                   /product="ZW10 interactor, transcript variant mCT3161"
FT                   /note="gene_id=mCG3608.2 transcript_id=mCT3161.2 created on
FT                   31-OCT-2002"
FT   mRNA            join(13965296..13965393,13966399..13966489,
FT                   13966654..13966777,13966946..13967112,13967233..13967289,
FT                   13967462..13967601,13967682..13967804,13978315..13979581)
FT                   /gene="Zwint"
FT                   /locus_tag="mCG_3608"
FT                   /product="ZW10 interactor, transcript variant mCT175056"
FT                   /note="gene_id=mCG3608.2 transcript_id=mCT175056.0 created
FT                   on 31-OCT-2002"
FT   mRNA            join(13965296..13965393,13966399..13966489,
FT                   13966654..13966777,13966946..13967112,13967233..13967289,
FT                   13967462..13967601,13967682..13967804,13979228..13979581)
FT                   /gene="Zwint"
FT                   /locus_tag="mCG_3608"
FT                   /product="ZW10 interactor, transcript variant mCT175055"
FT                   /note="gene_id=mCG3608.2 transcript_id=mCT175055.0 created
FT                   on 31-OCT-2002"
FT   CDS             join(13965335..13965393,13966399..13966489,
FT                   13966654..13966777,13966946..13967112,13967233..13967289,
FT                   13967462..13967601,13967682..13967802)
FT                   /codon_start=1
FT                   /gene="Zwint"
FT                   /locus_tag="mCG_3608"
FT                   /product="ZW10 interactor, isoform CRA_a"
FT                   /note="gene_id=mCG3608.2 transcript_id=mCT175055.0
FT                   protein_id=mCP97975.0 isoform=CRA_a"
FT                   /protein_id="EDL31942.1"
FT                   /translation="MADAEKNAVAEKNNAVATKEVLAEAAAILEPVGLQEEAELPAKIM
FT                   EEFMRNSRKKDKLLCSQLQVVNFLQTFLAQEDTEQSPDALASEDASRQKATETKEQWKD
FT                   MKATYMDHVDVIKCALSEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWV
FT                   LQQKRLQNLTKISAEVKRRRKRALEKLDGSHQELETLKQQAGQEQEKLQRNQSYLQLLC
FT                   SLQNKLVISEGKAEDKDVKGRALTAKSKSP"
FT   CDS             join(13965335..13965393,13966399..13966489,
FT                   13966654..13966777,13966946..13967112,13967233..13967289,
FT                   13967462..13967601,13967682..13967802)
FT                   /codon_start=1
FT                   /gene="Zwint"
FT                   /locus_tag="mCG_3608"
FT                   /product="ZW10 interactor, isoform CRA_a"
FT                   /note="gene_id=mCG3608.2 transcript_id=mCT175056.0
FT                   protein_id=mCP97974.0 isoform=CRA_a"
FT                   /protein_id="EDL31943.1"
FT                   /translation="MADAEKNAVAEKNNAVATKEVLAEAAAILEPVGLQEEAELPAKIM
FT                   EEFMRNSRKKDKLLCSQLQVVNFLQTFLAQEDTEQSPDALASEDASRQKATETKEQWKD
FT                   MKATYMDHVDVIKCALSEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWV
FT                   LQQKRLQNLTKISAEVKRRRKRALEKLDGSHQELETLKQQAGQEQEKLQRNQSYLQLLC
FT                   SLQNKLVISEGKAEDKDVKGRALTAKSKSP"
FT   CDS             join(13965335..13965393,13966399..13966489,
FT                   13966654..13966777,13966946..13967112,13967233..13967289,
FT                   13967462..13967601,13967682..13967802)
FT                   /codon_start=1
FT                   /gene="Zwint"
FT                   /locus_tag="mCG_3608"
FT                   /product="ZW10 interactor, isoform CRA_a"
FT                   /note="gene_id=mCG3608.2 transcript_id=mCT3161.2
FT                   protein_id=mCP11684.2 isoform=CRA_a"
FT                   /protein_id="EDL31944.1"
FT                   /translation="MADAEKNAVAEKNNAVATKEVLAEAAAILEPVGLQEEAELPAKIM
FT                   EEFMRNSRKKDKLLCSQLQVVNFLQTFLAQEDTEQSPDALASEDASRQKATETKEQWKD
FT                   MKATYMDHVDVIKCALSEALPQVKEAHRKYTELQKAFEQLEAKKRVLEEKLQLAQKQWV
FT                   LQQKRLQNLTKISAEVKRRRKRALEKLDGSHQELETLKQQAGQEQEKLQRNQSYLQLLC
FT                   SLQNKLVISEGKAEDKDVKGRALTAKSKSP"
FT   gene            complement(14283901..>14396943)
FT                   /locus_tag="mCG_144846"
FT                   /note="gene_id=mCG144846.0"
FT   mRNA            complement(join(14283901..14285293,14288239..14288474,
FT                   14292591..14292706,14328772..14328987,14396915..>14396943))
FT                   /locus_tag="mCG_144846"
FT                   /product="mCG144846"
FT                   /note="gene_id=mCG144846.0 transcript_id=mCT184270.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(14284254..>14284724)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144846"
FT                   /product="mCG144846"
FT                   /note="gene_id=mCG144846.0 transcript_id=mCT184270.0
FT                   protein_id=mCP105586.0"
FT                   /protein_id="EDL31941.1"
FT                   /translation="CFATIAFFTMGWRDSSSQESMQLQLKGLLCFQMIQNISQMSDCVQ
FT                   LYLLKLMLPGFEGCCLPGYPRVMALYVPNLDGPPLFYRSVPDSLPPWEVKNYFSFSPYI
FT                   GTVHNSSFSGYNWTYQNPAQVGASNPFNVWLLCGVNGSCTDLSLLSMVAGGA"
FT   gene            14511995..14513686
FT                   /pseudo
FT                   /locus_tag="mCG_3609"
FT                   /note="gene_id=mCG3609.2"
FT   mRNA            14511995..14513686
FT                   /pseudo
FT                   /locus_tag="mCG_3609"
FT                   /note="gene_id=mCG3609.2 transcript_id=mCT3156.2 created on
FT                   31-OCT-2002"
FT   gene            complement(14999640..15000529)
FT                   /pseudo
FT                   /locus_tag="mCG_49003"
FT                   /note="gene_id=mCG49003.2"
FT   mRNA            complement(14999640..15000529)
FT                   /pseudo
FT                   /locus_tag="mCG_49003"
FT                   /note="gene_id=mCG49003.2 transcript_id=mCT49186.2 created
FT                   on 31-OCT-2002"
FT   gene            15131149..15938782
FT                   /gene="Pcdh15"
FT                   /locus_tag="mCG_114141"
FT                   /note="gene_id=mCG114141.1"
FT   mRNA            join(15131149..15131525,15256191..15256309,
FT                   15360485..15360499,15361071..15361136,15479996..15480156,
FT                   15494828..15494983,15520053..15520172,15595637..15595745,
FT                   15607762..15607874,15621647..15621853,15629057..15629191,
FT                   15630754..15630903,15647202..15647395,15660634..15660766,
FT                   15684155..15684234,15690650..15690743,15701128..15701256,
FT                   15755177..15755482,15758898..15759122,15771610..15771726,
FT                   15787369..15787509,15791556..15791668,15808034..15808143,
FT                   15810016..15810156,15856650..15856777,15890204..15890419,
FT                   15900353..15900441,15927314..15927490,15930320..15930538,
FT                   15932263..15932271,15932803..15932958,15935044..15935049,
FT                   15936627..15938782)
FT                   /gene="Pcdh15"
FT                   /locus_tag="mCG_114141"
FT                   /product="protocadherin 15"
FT                   /note="gene_id=mCG114141.1 transcript_id=mCT115230.1
FT                   created on 24-SEP-2002"
FT   CDS             join(15256219..15256309,15360485..15360499,
FT                   15361071..15361136,15479996..15480156,15494828..15494983,
FT                   15520053..15520172,15595637..15595745,15607762..15607874,
FT                   15621647..15621853,15629057..15629191,15630754..15630903,
FT                   15647202..15647395,15660634..15660766,15684155..15684234,
FT                   15690650..15690743,15701128..15701256,15755177..15755482,
FT                   15758898..15759122,15771610..15771726,15787369..15787509,
FT                   15791556..15791668,15808034..15808143,15810016..15810156,
FT                   15856650..15856777,15890204..15890419,15900353..15900441,
FT                   15927314..15927490,15930320..15930538,15932263..15932271,
FT                   15932803..15932958,15935044..15935049,15936627..15938070)
FT                   /codon_start=1
FT                   /gene="Pcdh15"
FT                   /locus_tag="mCG_114141"
FT                   /product="protocadherin 15"
FT                   /note="gene_id=mCG114141.1 transcript_id=mCT115230.1
FT                   protein_id=mCP55081.1"
FT                   /protein_id="EDL31940.1"
FT                   /translation="MFLQFAVWKCLPHGILIASLLVVSWGQYDDDWQYEDCKLARGGPP
FT                   ATIVAIDEESRNGTILVDNMLIKGTAGGPDPTIELSLKDNVDYWVLLDPVKQMLFLNST
FT                   GRVLDRDPPMNIHSIVVQVQCVNKKVGTVIYHEVRIVVRDRNDNSPTFKHESYYATVNE
FT                   LTPVGTTIFTGFSGDNGATDIDDGPNGQIEYVIQYNPEDPEELNPILVTPPIQAIDQDR
FT                   NIQPPSDRPGILYSILVGTPEDYPRFFHMHPRTAELTLLEPVNRDFHQKFDLVIKAEQD
FT                   NGHPLPAFASLHIEILDENNQSPYFTMPSYQGYILESAPVGATISESLNLTTPLRIVAL
FT                   DKDIEDTKDPELHLFLNDYTSVFTVTPTGITRYLTLLQPVDREEQQTYTFLITAFDGVQ
FT                   ESEPVVVNIRVMDANDNTPTFPEISYDVYVYTDMSPGDSVIQLTAVDADEGSNGEISYE
FT                   ILVGGKGDFVINKTTGLVSIAPGVELIVGQTYALTVQASDNAPPAERRHSICTVYIEVL
FT                   PPNNQSPPRFPQLMYSLEVSEAMRIGAILLNLQATDREGDPITYAIENGDPQRVFNLSE
FT                   TTGILSLGKALDRESTDRYILIVTASDGRPDGTSTATVNIVVTDVNDNAPVFDPYLPRN
FT                   LSVVEEEANAFVGQVRATDPDAGINGQVHYSLGNFNNLFRITSNGSIYTAVKLNREARD
FT                   HYELVVVATDGAVHPRHSTLTLYIKVLDIDDNSPVFTNSTYTVVVEENLPAGTSFLQIE
FT                   AKDVDLGANVSYRIRSPEVKHLFALHPFTGELSLLRSLDYEAFPDQEASITFLVEAFDI
FT                   YGTMPPGIATVTVIVKDMNDYPPVFSKRIYKGMVAPDAVKGTPITTVYAEDADPPGMPA
FT                   SRVRYRVDDVQFPYPASIFDVEEDSGRVVTRVNLNEEPTTIFKLVVVAFDDGEPVMSSS
FT                   ATVRILVLHPGEIPRFTQEEYRPPPVSELAARGTVVGVISAAAINQSIVYSIVAGNEED
FT                   KFGINNVTGVIYVNSPLDYETRTSYVLRVQADSLEVVLANLRVPSKSNTAKVYIEIQDE
FT                   NDHPPVFQKKFYIGGVSEDARMFASVLRVKATDRDTGNYSAMAYRLIIPPIKEGKEGFV
FT                   VETYTGLIKTAMLFHNMRRSYFKFQVIATDDYGKGLSGKADVLVSVVNQLDMQVIVSNV
FT                   PPTLVEKKIEDLTEILDRYVQEQIPGAKVVVESIGARRHGDAYSLEDYSKCDLTVYAID
FT                   PQTNRAIDRNELFKFLDGKLLDINKDFQPYYGEGGRILEIRTPEAVTSIKKRGESLGYT
FT                   EGALLALAFIIILCCIPAILVVLVSYRQFKVRQAECTKTARIQSAMPAAKPAAPVPAAP
FT                   APPPPPPPPPPGAHLYEELGESAMHNLFLLYHFEQSRGNNSVPEDRSSHRDGMAFSSST
FT                   TESHEPAHVEGPLKESQPNPARTFSFVPDEDNLSTHNPLYMESIGQRSTNSDLQPRTDF
FT                   EELLAPRTQVKSQSLRGPREKIQRVWNQSVSFPRRLMWKAPNRPETIDLVEWQITNQRA
FT                   ECESARCHPSQRGSSNVLLATEDAHESEKEGGHRDTLIVQQTEQLKSLSSGSSFSSSWS
FT                   HFSFSTLPTISRAVELGSEPNVVTSPADCTLELSPPLRPRILNSLSSKRETPTCASDTE
FT                   PKRNSFEIAPHPPSISAPLPHPPLPRPPIAFTTFPLPLSPPNPPPPQLVTFSLPISTPP
FT                   TSSLPLPPPLSLPPPPRPPAPRLFPQPPSTSIPSTDSISAPAAKCTASATHARETTSTT
FT                   QPPASNPQWGAEPHRHPKGILRHVKNLAELEKSVSNMYSHIEKNCPPADPSKLHTFCPA
FT                   EKTGMKITHDQSQETLVRVVEGIDVQPHSQSTSL"
FT   gene            16118895..16119530
FT                   /pseudo
FT                   /locus_tag="mCG_5987"
FT                   /note="gene_id=mCG5987.2"
FT   mRNA            16118895..16119530
FT                   /pseudo
FT                   /locus_tag="mCG_5987"
FT                   /note="gene_id=mCG5987.2 transcript_id=mCT4656.2 created on
FT                   31-OCT-2002"
FT   gene            complement(16156676..16157339)
FT                   /locus_tag="mCG_5991"
FT                   /note="gene_id=mCG5991.2"
FT   mRNA            complement(16156676..16157339)
FT                   /locus_tag="mCG_5991"
FT                   /product="mCG5991"
FT                   /note="gene_id=mCG5991.2 transcript_id=mCT4649.2 created on
FT                   31-OCT-2002"
FT   CDS             complement(16156809..16157237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5991"
FT                   /product="mCG5991"
FT                   /note="gene_id=mCG5991.2 transcript_id=mCT4649.2
FT                   protein_id=mCP9228.1"
FT                   /protein_id="EDL31939.1"
FT                   /translation="MAGAVKWAISNRTIWKHLFPIQNGALSSACHKSTYSSLPDDYNCQ
FT                   VDLALTADGRTIVCYHPSVDIPYEHSKPTPQPDLLHNNEETHEQIPKAKLEVRKRKPLE
FT                   QGPMLEQLSKVFYTTKHRWYPHGQYHSRRKKQNPPKNR"
FT   gene            complement(16248744..16323851)
FT                   /locus_tag="mCG_5994"
FT                   /note="gene_id=mCG5994.2"
FT   mRNA            complement(join(16248744..16249050,16250835..16250971,
FT                   16252773..16252998,16316309..16316427,16320966..16321068,
FT                   16322377..16322621,16323787..16323851))
FT                   /locus_tag="mCG_5994"
FT                   /product="mCG5994, transcript variant mCT175059"
FT                   /note="gene_id=mCG5994.2 transcript_id=mCT175059.0 created
FT                   on 30-OCT-2002"
FT   mRNA            complement(join(16248744..16249050,16250835..16250971,
FT                   16252773..16252998,16316309..16316427,16320966..16321068,
FT                   16322377..16322621,16323783..16323830))
FT                   /locus_tag="mCG_5994"
FT                   /product="mCG5994, transcript variant mCT4641"
FT                   /note="gene_id=mCG5994.2 transcript_id=mCT4641.2 created on
FT                   30-OCT-2002"
FT   CDS             complement(join(16248809..16249050,16250835..16250971,
FT                   16252773..16252998,16316309..16316427,16320966..16321068,
FT                   16322377..16322621,16323787..16323836))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5994"
FT                   /product="mCG5994, isoform CRA_a"
FT                   /note="gene_id=mCG5994.2 transcript_id=mCT175059.0
FT                   protein_id=mCP97978.0 isoform=CRA_a"
FT                   /protein_id="EDL31935.1"
FT                   /translation="MGQALWLADTRRLHALSFYRGSFSKPFGRCEKMAHARISMYMPPD
FT                   IDPTKAAIAYGCRALSKLNEELQSRDLLTRQKALVALCDLMHDPEYVYEAINIGCLESL
FT                   KTLLQDDDNLVRIKTTEVLYIMATHYVGRVGFLKHDIIQALSLLLSDHQTLCRENLHQA
FT                   YKHLAQLPKGAQGIVQSGLIPSLVRKLQKEEDHIQEIILDTLALCLQEDATEALESQAV
FT                   PCLKEKLLSQNSEIRSKAARALIAISIPLDGKNQVWKNKVIPILVTLLSDTDEEVKANA
FT                   AGALMHATVTTEGKYAALDANAIEPLLELLSTNPKTKLCLNATKALTMLAEAPEGRKLL
FT                   LSHVPIFRYLLAHKNEAIQRAAEVAIKVIEWKP"
FT   CDS             complement(join(16248809..16249050,16250835..16250971,
FT                   16252773..16252998,16316309..16316427,16320966..16321068,
FT                   16322377..16322575))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5994"
FT                   /product="mCG5994, isoform CRA_b"
FT                   /note="gene_id=mCG5994.2 transcript_id=mCT4641.2
FT                   protein_id=mCP9243.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D3W1"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1918486"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D3W1"
FT                   /protein_id="EDL31936.1"
FT                   /translation="MAHARISMYMPPDIDPTKAAIAYGCRALSKLNEELQSRDLLTRQK
FT                   ALVALCDLMHDPEYVYEAINIGCLESLKTLLQDDDNLVRIKTTEVLYIMATHYVGRVGF
FT                   LKHDIIQALSLLLSDHQTLCRENLHQAYKHLAQLPKGAQGIVQSGLIPSLVRKLQKEED
FT                   HIQEIILDTLALCLQEDATEALESQAVPCLKEKLLSQNSEIRSKAARALIAISIPLDGK
FT                   NQVWKNKVIPILVTLLSDTDEEVKANAAGALMHATVTTEGKYAALDANAIEPLLELLST
FT                   NPKTKLCLNATKALTMLAEAPEGRKLLLSHVPIFRYLLAHKNEAIQRAAEVAIKVIEWK
FT                   P"
FT   gene            16258474..16308168
FT                   /gene="Gnaz"
FT                   /locus_tag="mCG_5989"
FT                   /note="gene_id=mCG5989.2"
FT   mRNA            join(16258474..16258647,16270054..16270119,
FT                   16282196..16283402,16306131..16308168)
FT                   /gene="Gnaz"
FT                   /locus_tag="mCG_5989"
FT                   /product="guanine nucleotide binding protein, alpha z
FT                   subunit, transcript variant mCT4648"
FT                   /note="gene_id=mCG5989.2 transcript_id=mCT4648.2 created on
FT                   31-OCT-2002"
FT   mRNA            join(16258474..16258647,16282196..16283402,
FT                   16306131..16308168)
FT                   /gene="Gnaz"
FT                   /locus_tag="mCG_5989"
FT                   /product="guanine nucleotide binding protein, alpha z
FT                   subunit, transcript variant mCT175058"
FT                   /note="gene_id=mCG5989.2 transcript_id=mCT175058.0 created
FT                   on 31-OCT-2002"
FT   CDS             join(16282680..16283402,16306131..16306475)
FT                   /codon_start=1
FT                   /gene="Gnaz"
FT                   /locus_tag="mCG_5989"
FT                   /product="guanine nucleotide binding protein, alpha z
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG5989.2 transcript_id=mCT175058.0
FT                   protein_id=mCP97977.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542R8"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR001408"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:95780"
FT                   /db_xref="UniProtKB/TrEMBL:Q542R8"
FT                   /protein_id="EDL31937.1"
FT                   /translation="MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSG
FT                   KSTIVKQMKIIHSGGFNLDACKEYKPLIIYNAIDSLTRIIRALAALKIDFHNPDRAYDA
FT                   VQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFGRSSEYHLEDNAAYYLNDLERI
FT                   AAPDYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAI
FT                   IFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRR
FT                   IPLSVCFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAV
FT                   TDVIIQNNLKYIGLC"
FT   CDS             join(16282680..16283402,16306131..16306475)
FT                   /codon_start=1
FT                   /gene="Gnaz"
FT                   /locus_tag="mCG_5989"
FT                   /product="guanine nucleotide binding protein, alpha z
FT                   subunit, isoform CRA_a"
FT                   /note="gene_id=mCG5989.2 transcript_id=mCT4648.2
FT                   protein_id=mCP9277.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q542R8"
FT                   /db_xref="InterPro:IPR001019"
FT                   /db_xref="InterPro:IPR001408"
FT                   /db_xref="InterPro:IPR011025"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:95780"
FT                   /db_xref="UniProtKB/TrEMBL:Q542R8"
FT                   /protein_id="EDL31938.1"
FT                   /translation="MGCRQSSEEKEAARRSRRIDRHLRSESQRQRREIKLLLLGTSNSG
FT                   KSTIVKQMKIIHSGGFNLDACKEYKPLIIYNAIDSLTRIIRALAALKIDFHNPDRAYDA
FT                   VQLFALTGPAESKGEITPELLGVMRRLWADPGAQACFGRSSEYHLEDNAAYYLNDLERI
FT                   AAPDYIPTVEDILRSRDMTTGIVENKFTFKELTFKMVDVGGQRSERKKWIHCFEGVTAI
FT                   IFCVELSGYDLKLYEDNQTSRMAESLRLFDSICNNNWFINTSLILFLNKKDLLAEKIRR
FT                   IPLSVCFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAV
FT                   TDVIIQNNLKYIGLC"
FT   gene            16328375..16346022
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /note="gene_id=mCG6003.2"
FT   mRNA            join(16328375..16328631,16329668..16329830,
FT                   16333150..16333241,16335781..16335846,16337307..16337408,
FT                   16339724..16339788,16341171..16341226,16341917..16341994,
FT                   16342265..16342355,16343193..16343318,16343746..16346022)
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /product="RAB36, member RAS oncogene family, transcript
FT                   variant mCT175061"
FT                   /note="gene_id=mCG6003.2 transcript_id=mCT175061.0 created
FT                   on 18-DEC-2002"
FT   mRNA            join(16328375..16328631,16329737..16329830,
FT                   16333150..16333241,16335781..16335846,16337307..16337408,
FT                   16339724..16339788,16341171..16341226,16341917..16341994,
FT                   16342265..16342355,16343193..16343318,16343746..16346022)
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /product="RAB36, member RAS oncogene family, transcript
FT                   variant mCT177523"
FT                   /note="gene_id=mCG6003.2 transcript_id=mCT177523.0 created
FT                   on 18-DEC-2002"
FT   mRNA            join(16328375..16328631,16329750..16329830,
FT                   16333150..16333241,16335781..16335846,16337307..16337408,
FT                   16339724..16339788,16341171..16341226,16341917..16341994,
FT                   16342265..16342355,16343193..16343318,16343746..16346022)
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /product="RAB36, member RAS oncogene family, transcript
FT                   variant mCT4639"
FT                   /note="gene_id=mCG6003.2 transcript_id=mCT4639.2 created on
FT                   18-DEC-2002"
FT   mRNA            join(<16328393..16328635,16329743..16329830,
FT                   16333150..16333241,16335781..16335846,16337307..16337408,
FT                   16339724..16339788,16341171..16341226,16341917..16341994,
FT                   16342265..16342355,16343193..16343318,16343746..16344200)
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /product="RAB36, member RAS oncogene family, transcript
FT                   variant mCT192989"
FT                   /note="gene_id=mCG6003.2 transcript_id=mCT192989.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<16328418..16328635,16329743..16329830,
FT                   16333150..16333241,16335781..16335846,16337307..16337408,
FT                   16339724..16339788,16341171..16341226,16341917..16341994,
FT                   16342265..16342355,16343193..16343318,16343746..16343804)
FT                   /codon_start=1
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /product="RAB36, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG6003.2 transcript_id=mCT192989.0
FT                   protein_id=mCP113962.0 isoform=CRA_b"
FT                   /protein_id="EDL31933.1"
FT                   /translation="ASSAKLEVPGGSRCYGDDSARASCQRYRRTGGGSRPRPRRRDSGA
FT                   TSQSREATVAVVICSGLRAGTWSLQLGDLQNTGRMRSSWTPLGPPVSQDRIITSFPKWY
FT                   TPDACLQLKEHFHSRVSTACQHRNTGTAGLRLSKVVVVGDLYVGKTSLIHRLCKNVFDH
FT                   DYKATIGVDFEIERFEIAGIPYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDVQ
FT                   TLEHTRQWLEDVLRENEAGSCFIFLVGTKKDLLSGAACEQAEAEAVHLANEMQAEYWSV
FT                   SAKTGENVKAFFSRVAALAFEQSVLQDLEKRPSTQSQVGDGDGDLIRIEVPKTQENKRP
FT                   PGLGCC"
FT   CDS             join(16329762..16329830,16333150..16333241,
FT                   16335781..16335846,16337307..16337408,16339724..16339788,
FT                   16341171..16341226,16341917..16341994,16342265..16342355,
FT                   16343193..16343318,16343746..16343804)
FT                   /codon_start=1
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /product="RAB36, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG6003.2 transcript_id=mCT175061.0
FT                   protein_id=mCP97980.0 isoform=CRA_a"
FT                   /protein_id="EDL31931.1"
FT                   /translation="MRSSWTPLGPPVSQDRIITSFPKWYTPDACLQLKEHFHSRVSTAC
FT                   QHRNTGTAGLRLSKVVVVGDLYVGKTSLIHRLCKNVFDHDYKATIGVDFEIERFEIAGI
FT                   PYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDVQTLEHTRQWLEDVLRENEAGS
FT                   CFIFLVGTKKDLLSGAACEQAEAEAVHLANEMQAEYWSVSAKTGENVKAFFSRVAALAF
FT                   EQSVLQDLEKRPSTQSQVGDGDGDLIRIEVPKTQENKRPPGLGCC"
FT   CDS             join(16329762..16329830,16333150..16333241,
FT                   16335781..16335846,16337307..16337408,16339724..16339788,
FT                   16341171..16341226,16341917..16341994,16342265..16342355,
FT                   16343193..16343318,16343746..16343804)
FT                   /codon_start=1
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /product="RAB36, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG6003.2 transcript_id=mCT177523.0
FT                   protein_id=mCP100445.0 isoform=CRA_a"
FT                   /protein_id="EDL31932.1"
FT                   /translation="MRSSWTPLGPPVSQDRIITSFPKWYTPDACLQLKEHFHSRVSTAC
FT                   QHRNTGTAGLRLSKVVVVGDLYVGKTSLIHRLCKNVFDHDYKATIGVDFEIERFEIAGI
FT                   PYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDVQTLEHTRQWLEDVLRENEAGS
FT                   CFIFLVGTKKDLLSGAACEQAEAEAVHLANEMQAEYWSVSAKTGENVKAFFSRVAALAF
FT                   EQSVLQDLEKRPSTQSQVGDGDGDLIRIEVPKTQENKRPPGLGCC"
FT   CDS             join(16329762..16329830,16333150..16333241,
FT                   16335781..16335846,16337307..16337408,16339724..16339788,
FT                   16341171..16341226,16341917..16341994,16342265..16342355,
FT                   16343193..16343318,16343746..16343804)
FT                   /codon_start=1
FT                   /gene="Rab36"
FT                   /locus_tag="mCG_6003"
FT                   /product="RAB36, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG6003.2 transcript_id=mCT4639.2
FT                   protein_id=mCP9287.2 isoform=CRA_a"
FT                   /protein_id="EDL31934.1"
FT                   /translation="MRSSWTPLGPPVSQDRIITSFPKWYTPDACLQLKEHFHSRVSTAC
FT                   QHRNTGTAGLRLSKVVVVGDLYVGKTSLIHRLCKNVFDHDYKATIGVDFEIERFEIAGI
FT                   PYSLQIWDTAGQEKFKCIASAYYRGAQVIITAFDLTDVQTLEHTRQWLEDVLRENEAGS
FT                   CFIFLVGTKKDLLSGAACEQAEAEAVHLANEMQAEYWSVSAKTGENVKAFFSRVAALAF
FT                   EQSVLQDLEKRPSTQSQVGDGDGDLIRIEVPKTQENKRPPGLGCC"
FT   gene            <16352317..16476862
FT                   /locus_tag="mCG_117508"
FT                   /note="gene_id=mCG117508.1"
FT   mRNA            join(<16352317..16353663,16416754..16416926,
FT                   16422763..16422867,16423241..16423426,16427636..16427743,
FT                   16432732..16432792,16434824..16434876,16437064..16437204,
FT                   16445626..16445747,16446638..16446806,16448818..16448937,
FT                   16449750..16449825,16451526..16451630,16452070..16452144,
FT                   16457785..16457882,16459847..16459978,16467017..16467076,
FT                   16468083..16468192,16469624..16469763,16471864..16471998,
FT                   16472948..16473053,16473382..16473544,16474053..16476862)
FT                   /locus_tag="mCG_117508"
FT                   /product="mCG117508"
FT                   /note="gene_id=mCG117508.1 transcript_id=mCT118649.1
FT                   created on 30-OCT-2002"
FT   CDS             join(<16352523..16353663,16416754..16416926,
FT                   16422763..16422867,16423241..16423426,16427636..16427743,
FT                   16432732..16432792,16434824..16434876,16437064..16437204,
FT                   16445626..16445747,16446638..16446806,16448818..16448937,
FT                   16449750..16449825,16451526..16451630,16452070..16452144,
FT                   16457785..16457882,16459847..16459978,16467017..16467076,
FT                   16468083..16468192,16469624..16469763,16471864..16471998,
FT                   16472948..16473053,16473382..16473544,16474053..16474142)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117508"
FT                   /product="mCG117508"
FT                   /note="gene_id=mCG117508.1 transcript_id=mCT118649.1
FT                   protein_id=mCP55306.1 partial"
FT                   /protein_id="EDL31930.1"
FT                   /translation="ALGAGGEPGALPHDLPADAAGQGEEELRSAALGLPXXXXXXXXAS
FT                   APRPPPAPADGADPAPVEESEARPDGEGSPSKGRSASARRPAAAASADRDDRGPPTSVA
FT                   ALRSNFEKIRKGPAQPGSADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQM
FT                   ERKKSQQSAGQGLGEAPRPHYRGRSSESSCGLDGDYEDAELNPRFLKDNLINANGGNRP
FT                   PWPPLEYQPYQSIYVGGMMVEGEGKSPLLRSQSTSEQEKRLTWPRRSYSPRSFEDSGGG
FT                   YTPDCSSNENLTSSEEDFSSGQSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTP
FT                   QCQKRHRQCQVVVSEATIVGVRKTGQIWPSDGDSTFQGEADSSFGTPPGYGCAADQAEE
FT                   QRRHQDGLPYIDDSPSSSPHLSSKGRGSLASGALDPTKVSELDLEKGLEMRKWVLSGIL
FT                   ASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFYDGLFP
FT                   RVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMETAEKCCQANAQFAEISENLRAR
FT                   SNKDVKDSTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDHSLLQDALRISQNF
FT                   LSSINEEITPRRQSMTVKKGEHRQLLKDSFMVELVEGARKLRHIFLFTDLLLCTKLKKQ
FT                   SGGKTQQYDCKWYIPLTDLSFQMVDELEALPNIPLVPDEELDALKIKISQIKSDIQREK
FT                   RANKGSKVMERLRKKLSEQESLLLLMSPSMAFRVHSRNGKSYTFLISSDYERAEWRESI
FT                   REQQKKCFKSFSLTSVELQMLTNSCVKLQTVHHIPLTINKEDDESPGLYGFLHVIVHSA
FT                   TGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRILCYEK
FT                   CYNKMKMTKEDGESADKLMGKGQVQLDPQTLQDRDWQRTVIDMNGIEVKLSVKFTSREF
FT                   SLKRMPSRKQTGVFGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATD
FT                   IQALKAAFDVNNKDVSVMMSEMDVNAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSD
FT                   PVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAEKETVNKMSLHNLATVFGPTLLRPS
FT                   EKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSKRQSILFSTEV"
FT   gene            16502395..16603308
FT                   /gene="4932439K10Rik"
FT                   /locus_tag="mCG_6000"
FT                   /note="gene_id=mCG6000.2"
FT   mRNA            join(16502395..16502541,16521063..16521252,
FT                   16531550..16531703,16535564..16537197,16538922..16539129,
FT                   16548353..16548426,16549453..16549628,16552279..16552442,
FT                   16553764..16553855,16557984..16558074,16564499..16564582,
FT                   16567253..16567409,16570349..16570451,16597811..16597927,
FT                   16598609..16598668,16600365..16603308)
FT                   /gene="4932439K10Rik"
FT                   /locus_tag="mCG_6000"
FT                   /product="RIKEN cDNA 4932439K10, transcript variant
FT                   mCT4635"
FT                   /note="gene_id=mCG6000.2 transcript_id=mCT4635.2 created on
FT                   30-OCT-2002"
FT   mRNA            join(16502712..16502813,16512354..16512503,
FT                   16519287..16519312,16520152..16520249,16521063..16521252,
FT                   16531550..16531703,16535564..16537197,16538922..16539129,
FT                   16548353..16548426,16549453..16549628,16552279..16552442,
FT                   16553764..16553855,16557984..16558074,16564499..16564582,
FT                   16567253..16567409,16570349..16570451,16597811..16597927,
FT                   16598609..16598668,16600365..16602948)
FT                   /gene="4932439K10Rik"
FT                   /locus_tag="mCG_6000"
FT                   /product="RIKEN cDNA 4932439K10, transcript variant
FT                   mCT192986"
FT                   /note="gene_id=mCG6000.2 transcript_id=mCT192986.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(16520236..16520249,16521063..16521252,
FT                   16531550..16531703,16535564..16537197,16538922..16539129,
FT                   16548353..16548426,16549453..16549628,16552279..16552442,
FT                   16553764..16553855,16557984..16558074,16564499..16564582,
FT                   16567253..16567409,16570349..16570451,16597811..16597927,
FT                   16598609..16598668,16600365..16600454)
FT                   /codon_start=1
FT                   /gene="4932439K10Rik"
FT                   /locus_tag="mCG_6000"
FT                   /product="RIKEN cDNA 4932439K10, isoform CRA_a"
FT                   /note="gene_id=mCG6000.2 transcript_id=mCT192986.0
FT                   protein_id=mCP113961.0 isoform=CRA_a"
FT                   /protein_id="EDL31928.1"
FT                   /translation="MLELRFGCKCITKRQPRMKKANRSAGSVPKVSGISKPQTVEKSKP
FT                   ENSSSAPTGVKPVRPGAAAALSKTKSNDDLLAGMAGGVNVTNGIKAKKSTCSSAAPSAP
FT                   APAMTISENKSKISTGTSSSAKRSTSAGNKESSSTRERLRERTRLNQSKKLPSVSQGAN
FT                   DVALAKRSRSRTAAEGDIRMSKSKSDNQISDKAALEAKVKDLLTLAKTKDVEILHLRNE
FT                   LRDMRAQLGISEDHCEGEDRSEVKETIIAHQPTDVESTLLQLQEQNTAIREELNQLKNE
FT                   NRMLKDRLNALGFSLEQRLDNSEKLFGYQSLSPEITPGNQSDGGGTLTSSVEGSAPGSV
FT                   EDLLSQDENTLMDHQHSNSMDNLDSECSEVYQPLTSSDDALDAPSSSESEGVPSIERSR
FT                   KGSSGNASEVSVACLTERIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGE
FT                   EKVILMESLCQQSDKLEHFGRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLA
FT                   ENARFEREQLLGVQQHLSNTLKMAEQDNKEAQEMIGALKERSHHMERIIESEQKGKAAL
FT                   AATLEEYKATVASDQIEMNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKE
FT                   KAETLASSLQEDLAHTRNDANRLQDTIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSEL
FT                   EEKDTERSDMKETIFELEDEVEQHRAVKLHDNLIISDLENTVKKLQDQKHDMEREIKTL
FT                   HRRLREESAEWRQFQADLQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEE
FT                   IKSRKQEEERGRVYNYMNAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQ
FT                   VPNAAAAAIPRTPLSPSPMKTPPAAAVSPMQRHSISGPISTSKPLTALSDKRSNYGELP
FT                   VQEHLLRTSSTSRPASLPRVPAMESAKTISVSRRSSEEMKRDISASEGASPASLMAMGT
FT                   TSPQLSLSSSPTASVTPSTRSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQN
FT                   IDITNFSSSWNDGLAFCALLHTYLPAHIPYQELNSQDKKRNFTLAFQAAESVGIKSTLD
FT                   INEMARTERPDWQNVMLYVTAIYKYFET"
FT   CDS             join(16521100..16521252,16531550..16531703,
FT                   16535564..16537197,16538922..16539129,16548353..16548426,
FT                   16549453..16549628,16552279..16552442,16553764..16553855,
FT                   16557984..16558074,16564499..16564582,16567253..16567409,
FT                   16570349..16570451,16597811..16597927,16598609..16598668,
FT                   16600365..16600454)
FT                   /codon_start=1
FT                   /gene="4932439K10Rik"
FT                   /locus_tag="mCG_6000"
FT                   /product="RIKEN cDNA 4932439K10, isoform CRA_b"
FT                   /note="gene_id=mCG6000.2 transcript_id=mCT4635.2
FT                   protein_id=mCP9274.2 isoform=CRA_b"
FT                   /protein_id="EDL31929.1"
FT                   /translation="MKKANRSAGSVPKVSGISKPQTVEKSKPENSSSAPTGVKPVRPGA
FT                   AAALSKTKSNDDLLAGMAGGVNVTNGIKAKKSTCSSAAPSAPAPAMTISENKSKISTGT
FT                   SSSAKRSTSAGNKESSSTRERLRERTRLNQSKKLPSVSQGANDVALAKRSRSRTAAEGD
FT                   IRMSKSKSDNQISDKAALEAKVKDLLTLAKTKDVEILHLRNELRDMRAQLGISEDHCEG
FT                   EDRSEVKETIIAHQPTDVESTLLQLQEQNTAIREELNQLKNENRMLKDRLNALGFSLEQ
FT                   RLDNSEKLFGYQSLSPEITPGNQSDGGGTLTSSVEGSAPGSVEDLLSQDENTLMDHQHS
FT                   NSMDNLDSECSEVYQPLTSSDDALDAPSSSESEGVPSIERSRKGSSGNASEVSVACLTE
FT                   RIHQMEENQHSTSEELQATLQELADLQQITQELNSENERLGEEKVILMESLCQQSDKLE
FT                   HFGRQIEYFRSLLDEHHISYVIDEDVKSGRYMELEQRYMDLAENARFEREQLLGVQQHL
FT                   SNTLKMAEQDNKEAQEMIGALKERSHHMERIIESEQKGKAALAATLEEYKATVASDQIE
FT                   MNRLKAQLENEKQKVAELYSIHNSGDKSDIQDLLESVRLDKEKAETLASSLQEDLAHTR
FT                   NDANRLQDTIAKVEDEYRAFQEEAKKQIEDLNMTLEKLRSELEEKDTERSDMKETIFEL
FT                   EDEVEQHRAVKLHDNLIISDLENTVKKLQDQKHDMEREIKTLHRRLREESAEWRQFQAD
FT                   LQTAVVIANDIKSEAQEEIGDLKRRLHEAQEKNEKLTKELEEIKSRKQEEERGRVYNYM
FT                   NAVERDLAALRQGMGLSRRSSTSSEPTPTVKTLIKSFDSASQVPNAAAAAIPRTPLSPS
FT                   PMKTPPAAAVSPMQRHSISGPISTSKPLTALSDKRSNYGELPVQEHLLRTSSTSRPASL
FT                   PRVPAMESAKTISVSRRSSEEMKRDISASEGASPASLMAMGTTSPQLSLSSSPTASVTP
FT                   STRSRIREERKDPLSALAREYGGSKRNALLKWCQKKTEGYQNIDITNFSSSWNDGLAFC
FT                   ALLHTYLPAHIPYQELNSQDKKRNFTLAFQAAESVGIKSTLDINEMARTERPDWQNVML
FT                   YVTAIYKYFET"
FT   gene            16607682..16625600
FT                   /gene="Adora2a"
FT                   /locus_tag="mCG_6009"
FT                   /note="gene_id=mCG6009.2"
FT   mRNA            join(16607682..16607722,16616597..16617163,
FT                   16623839..16625600)
FT                   /gene="Adora2a"
FT                   /locus_tag="mCG_6009"
FT                   /product="adenosine A2a receptor, transcript variant
FT                   mCT175067"
FT                   /note="gene_id=mCG6009.2 transcript_id=mCT175067.0 created
FT                   on 30-OCT-2002"
FT   mRNA            join(16615733..16615848,16616597..16617163,
FT                   16623839..16625600)
FT                   /gene="Adora2a"
FT                   /locus_tag="mCG_6009"
FT                   /product="adenosine A2a receptor, transcript variant
FT                   mCT4628"
FT                   /note="gene_id=mCG6009.2 transcript_id=mCT4628.2 created on
FT                   30-OCT-2002"
FT   CDS             join(16616841..16617163,16623839..16624748)
FT                   /codon_start=1
FT                   /gene="Adora2a"
FT                   /locus_tag="mCG_6009"
FT                   /product="adenosine A2a receptor, isoform CRA_a"
FT                   /note="gene_id=mCG6009.2 transcript_id=mCT4628.2
FT                   protein_id=mCP9238.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q60613"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001513"
FT                   /db_xref="InterPro:IPR001634"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60613"
FT                   /protein_id="EDL31926.1"
FT                   /translation="MGSSVYIMVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSL
FT                   AAADIAVGVLAIPFAITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIR
FT                   IPLRYNGLVTGMRAKGIIAICWVLSFAIGLTPMLGWNNCSQKDENSTKTCGEGRVTCLF
FT                   EDVVPMNYMVYYNFFAFVLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQK
FT                   EVHAAKSLAIIVGLFALCWLPLHIINCFTFFCSTCQHAPPWLMYLAIILSHSNSVVNPF
FT                   IYAYRIREFRQTFRKIIRTHVLRRQEPFRAGGSSAWALAAHSTEGEQVSLRLNGHPLGV
FT                   WANGSAPHSGRRPNGYTLGPGGGGSTQGSPGDVELLTQEHQEGQEHPGLGDHLAQGRVG
FT                   TASWSSEFAPS"
FT   CDS             join(16616841..16617163,16623839..16624748)
FT                   /codon_start=1
FT                   /gene="Adora2a"
FT                   /locus_tag="mCG_6009"
FT                   /product="adenosine A2a receptor, isoform CRA_a"
FT                   /note="gene_id=mCG6009.2 transcript_id=mCT175067.0
FT                   protein_id=mCP97986.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q60613"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR001513"
FT                   /db_xref="InterPro:IPR001634"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:99402"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60613"
FT                   /protein_id="EDL31927.1"
FT                   /translation="MGSSVYIMVELAIAVLAILGNVLVCWAVWINSNLQNVTNFFVVSL
FT                   AAADIAVGVLAIPFAITISTGFCAACHGCLFFACFVLVLTQSSIFSLLAIAIDRYIAIR
FT                   IPLRYNGLVTGMRAKGIIAICWVLSFAIGLTPMLGWNNCSQKDENSTKTCGEGRVTCLF
FT                   EDVVPMNYMVYYNFFAFVLLPLLLMLAIYLRIFLAARRQLKQMESQPLPGERTRSTLQK
FT                   EVHAAKSLAIIVGLFALCWLPLHIINCFTFFCSTCQHAPPWLMYLAIILSHSNSVVNPF
FT                   IYAYRIREFRQTFRKIIRTHVLRRQEPFRAGGSSAWALAAHSTEGEQVSLRLNGHPLGV
FT                   WANGSAPHSGRRPNGYTLGPGGGGSTQGSPGDVELLTQEHQEGQEHPGLGDHLAQGRVG
FT                   TASWSSEFAPS"
FT   gene            complement(16641892..16806127)
FT                   /locus_tag="mCG_6004"
FT                   /note="gene_id=mCG6004.3"
FT   mRNA            complement(join(16641892..16643686,16655782..16655874,
FT                   16711983..16712114,16797836..16798077,16798276..16798367,
FT                   16799365..16799530,16800316..16800400,16805400..16805627))
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, transcript variant mCT185598"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT185598.0 created
FT                   on 12-JUN-2003"
FT   gene            <16642535..16643813
FT                   /locus_tag="mCG_5996"
FT                   /note="gene_id=mCG5996.2"
FT   mRNA            <16642535..16643813
FT                   /locus_tag="mCG_5996"
FT                   /product="mCG5996"
FT                   /note="gene_id=mCG5996.2 transcript_id=mCT4643.2 created on
FT                   30-OCT-2002"
FT   CDS             <16643339..16643782
FT                   /codon_start=1
FT                   /locus_tag="mCG_5996"
FT                   /product="mCG5996"
FT                   /note="gene_id=mCG5996.2 transcript_id=mCT4643.2
FT                   protein_id=mCP9308.2"
FT                   /protein_id="EDL31925.1"
FT                   /translation="GHTAEHAEYLPPSPSSSSSSRGLTTAASITQQYWTSQSRPRTLAS
FT                   SRVSAARPACVCRSGTRLLPWCPTSSMGTSASWLCLWRLSTLSQLLKSSRPSWLIHLHL
FT                   QLLPLWLPLPRLKQRKSQWNQMRIWDSVSSTNPLKATKSASLI"
FT   gene            16697370..16731507
FT                   /gene="Upb1"
FT                   /locus_tag="mCG_6006"
FT                   /note="gene_id=mCG6006.2"
FT   mRNA            join(16697370..16697598,16703206..16703377,
FT                   16705367..16705454,16715811..16715905,16719499..16719660,
FT                   16721280..16721449,16727456..16727537,16728186..16728228,
FT                   16729367..16729521,16731164..16731507)
FT                   /gene="Upb1"
FT                   /locus_tag="mCG_6006"
FT                   /product="ureidopropionase, beta, transcript variant
FT                   mCT4632"
FT                   /note="gene_id=mCG6006.2 transcript_id=mCT4632.2 created on
FT                   24-SEP-2002"
FT   CDS             join(16697495..16697598,16703206..16703377,
FT                   16705367..16705454,16715811..16715905,16719499..16719660,
FT                   16721280..16721449,16727456..16727537,16728186..16728228,
FT                   16729367..16729521,16731164..16731274)
FT                   /codon_start=1
FT                   /gene="Upb1"
FT                   /locus_tag="mCG_6006"
FT                   /product="ureidopropionase, beta, isoform CRA_a"
FT                   /note="gene_id=mCG6006.2 transcript_id=mCT4632.2
FT                   protein_id=mCP9226.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UEK4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="MGI:MGI:2143535"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UEK4"
FT                   /protein_id="EDL31923.1"
FT                   /translation="MAGPEWQSLEQCLEKHLPPDDLAQVKRILYGKQTRNLDLPREALK
FT                   AASERNFELKGYAFGAAKEQQRCPQIVRVGLVQNRIPLPTSAPVAEQVSALHKSIEEIA
FT                   EVAAMCGVNIICFQEAWNMPFAFCTREKLPWTEFAESAEDGLTTRFCQKLAKKHNMVVV
FT                   SPILERDREHGGVLWNTAVVISNSGLVMGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQ
FT                   TQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGELSESLWPIEARNAAIANHC
FT                   FTCALNRVGQEHFPNEFTSGDGKKAHHDLGYFYGSSYVAAPDGSRTPGLSRNQDGLLVT
FT                   ELNLNLCQQINDFWTFKMTGRLEMYARELAEAVKPNYSPNIVKEDLVLAPSSG"
FT   mRNA            join(16700483..16700660,16703206..16703377,
FT                   16705367..16705454,16715811..16715905,16719499..16719660,
FT                   16721280..16721449,16727456..16727537,16728186..16728228,
FT                   16729367..16729521,16731164..16731507)
FT                   /gene="Upb1"
FT                   /locus_tag="mCG_6006"
FT                   /product="ureidopropionase, beta, transcript variant
FT                   mCT173636"
FT                   /note="gene_id=mCG6006.2 transcript_id=mCT173636.0 created
FT                   on 24-SEP-2002"
FT   CDS             join(16705415..16705454,16715811..16715905,
FT                   16719499..16719660,16721280..16721449,16727456..16727537,
FT                   16728186..16728228,16729367..16729521,16731164..16731274)
FT                   /codon_start=1
FT                   /gene="Upb1"
FT                   /locus_tag="mCG_6006"
FT                   /product="ureidopropionase, beta, isoform CRA_b"
FT                   /note="gene_id=mCG6006.2 transcript_id=mCT173636.0
FT                   protein_id=mCP96555.0 isoform=CRA_b"
FT                   /protein_id="EDL31924.1"
FT                   /translation="MCGVNIICFQEAWNMPFAFCTREKLPWTEFAESAEDGLTTRFCQK
FT                   LAKKHNMVVVSPILERDREHGGVLWNTAVVISNSGLVMGKTRKNHIPRVGDFNESTYYM
FT                   EGNLGHPVFQTQFGRIAVNICYGRHHPLNWLMYSINGAEIIFNPSATIGELSESLWPIE
FT                   ARNAAIANHCFTCALNRVGQEHFPNEFTSGDGKKAHHDLGYFYGSSYVAAPDGSRTPGL
FT                   SRNQDGLLVTELNLNLCQQINDFWTFKMTGRLEMYARELAEAVKPNYSPNIVKEDLVLA
FT                   PSSG"
FT   mRNA            complement(join(16706869..16708839,16711983..16712114,
FT                   16798276..16798367,16799365..16799530,16800316..16800400,
FT                   16805400..16805627))
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, transcript variant mCT185599"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT185599.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(16712021..16712114,16798276..16798367,
FT                   16799365..16799530,16800316..16800400,16805400..16805442))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, isoform CRA_e"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT185599.0
FT                   protein_id=mCP106857.0 isoform=CRA_e"
FT                   /protein_id="EDL31918.1"
FT                   /translation="MRTEAEAAGQPLEPGDFVQLPVPIIQQLYHWDCGLACSRMVLRYL
FT                   GQLDDGEFENALQELQLTRSIWTIDLAYLMRHFGVRHRFCTQTLGVDKGYKNQSFYRKH
FT                   FDTEETRVNQLFAQAKACKVQVEKWRVDSFSREPDRSDGNNWEIRKTGITYARAS"
FT   CDS             complement(join(16712107..16712114,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16800316..16800400,
FT                   16805400..16805442))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, isoform CRA_g"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT185598.0
FT                   protein_id=mCP106856.0 isoform=CRA_g"
FT                   /protein_id="EDL31921.1"
FT                   /translation="MRTEAEAAGQPLEPGDFVQLPVPIIQQLYHWDCGLACSRMVLRYL
FT                   GQLDDGEFENALQELQLTRSIWTIDLAYLMRHFGVRHRFCTQTLGVDKGYKNQSFYRKH
FT                   FDTEETRVNQLFAQAKACKVQVEKCTVSVQDIQVHLAQGHVAIVLVNSGVLHCDLCSSP
FT                   VKYCCFTPSGHRCFCRTPDYQGHFIVLRGYNRATGCIFYNNPAYADRG"
FT   gene            <16740820..16754450
FT                   /locus_tag="mCG_146288"
FT                   /note="gene_id=mCG146288.0"
FT   mRNA            join(<16740820..16741764,16750111..16750218,
FT                   16754239..16754450)
FT                   /locus_tag="mCG_146288"
FT                   /product="mCG146288"
FT                   /note="gene_id=mCG146288.0 transcript_id=mCT186391.0
FT                   created on 14-JUL-2003"
FT   CDS             <16740990..16741265
FT                   /codon_start=1
FT                   /locus_tag="mCG_146288"
FT                   /product="mCG146288"
FT                   /note="gene_id=mCG146288.0 transcript_id=mCT186391.0
FT                   protein_id=mCP107470.0"
FT                   /protein_id="EDL31922.1"
FT                   /translation="TFRGMGNELSALKCHICLLVYVSQVPEAQQTPRVHKEIPSVGIHR
FT                   CMTKSQFPASFYAGCLKNCYLFKRGRVINFTSVFSQMPFPHMLCNC"
FT   mRNA            complement(join(16795059..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16800316..16800400,
FT                   16805987..16806127))
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, transcript variant mCT175066"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175066.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(16795059..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16800147..16800400,
FT                   16805987..16806127))
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, transcript variant mCT175063"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175063.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(16795059..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16805400..16805594))
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, transcript variant mCT175064"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175064.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(16795059..16797213,16797836..16797910,
FT                   16798308..16798367,16799365..16799530,16800316..16800400,
FT                   16805400..16805594))
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, transcript variant mCT175065"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175065.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(16795059..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16800316..16800400,
FT                   16805400..16805594))
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, transcript variant mCT4640"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT4640.2 created on
FT                   12-JUN-2003"
FT   mRNA            complement(join(16795059..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16800165..16800400,
FT                   16805400..16805594))
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, transcript variant mCT175062"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175062.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(16797013..16797213,16797836..16797910,
FT                   16798308..16798367,16799365..16799530,16800316..16800400,
FT                   16805400..16805442))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, isoform CRA_c"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175065.0
FT                   protein_id=mCP97983.0 isoform=CRA_c"
FT                   /protein_id="EDL31916.1"
FT                   /translation="MRTEAEAAGQPLEPGDFVQLPVPIIQQLYHWDCGLACSRMVLRYL
FT                   GQLDDGEFENALQELQLTRSIWTIDLAYLMRHFGVRHRFCTQTLGVDKGYKNQSFYRKH
FT                   FDTEETRVNQLFAQATSSSCVAITGLPAASSITTQPMLTGCAAPASVTLRRPELATAQM
FT                   RTSSLSTWTADSRSLACQVLRPYVLSQPGPLRMPMPRAAGFWGSEL"
FT   CDS             complement(join(16797122..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16805400..16805467))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, isoform CRA_b"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175064.0
FT                   protein_id=mCP97985.0 isoform=CRA_b"
FT                   /protein_id="EDL31915.1"
FT                   /translation="MGALRHPGHEDGGRGSGAAARARYLGQLDDGEFENALQELQLTRS
FT                   IWTIDLAYLMRHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKV
FT                   QVEKCTVSVQDIQVHLAQGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHRCFCRTPDY
FT                   QGHFIVLRGYNRATGCIFYNNPAYADRMCSTSISNFEEARTSYGTDEDILFVYLDS"
FT   CDS             complement(join(16797122..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16800316..16800400,
FT                   16805400..16805442))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, isoform CRA_f"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT4640.2
FT                   protein_id=mCP9227.2 isoform=CRA_f"
FT                   /protein_id="EDL31919.1"
FT                   /translation="MRTEAEAAGQPLEPGDFVQLPVPIIQQLYHWDCGLACSRMVLRYL
FT                   GQLDDGEFENALQELQLTRSIWTIDLAYLMRHFGVRHRFCTQTLGVDKGYKNQSFYRKH
FT                   FDTEETRVNQLFAQAKACKVQVEKCTVSVQDIQVHLAQGHVAIVLVNSGVLHCDLCSSP
FT                   VKYCCFTPSGHRCFCRTPDYQGHFIVLRGYNRATGCIFYNNPAYADRMCSTSISNFEEA
FT                   RTSYGTDEDILFVYLDS"
FT   CDS             complement(join(16797122..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799530,16800316..16800326))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, isoform CRA_d"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175066.0
FT                   protein_id=mCP97984.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q05CJ4"
FT                   /db_xref="InterPro:IPR018616"
FT                   /db_xref="MGI:MGI:1916028"
FT                   /db_xref="UniProtKB/TrEMBL:Q05CJ4"
FT                   /protein_id="EDL31917.1"
FT                   /translation="MVLRYLGQLDDGEFENALQELQLTRSIWTIDLAYLMRHFGVRHRF
FT                   CTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQAKACKVQVEKCTVSVQDIQVHLAQG
FT                   HVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHRCFCRTPDYQGHFIVLRGYNRATGCIFY
FT                   NNPAYADRMCSTSISNFEEARTSYGTDEDILFVYLDS"
FT   CDS             complement(join(16797122..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799436))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, isoform CRA_a"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175062.0
FT                   protein_id=mCP97981.0 isoform=CRA_a"
FT                   /protein_id="EDL31914.1"
FT                   /translation="MRHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQA
FT                   KACKVQVEKCTVSVQDIQVHLAQGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHRCFC
FT                   RTPDYQGHFIVLRGYNRATGCIFYNNPAYADRMCSTSISNFEEARTSYGTDEDILFVYL
FT                   DS"
FT   CDS             complement(join(16797122..16797213,16797836..16798077,
FT                   16798276..16798367,16799365..16799436))
FT                   /codon_start=1
FT                   /locus_tag="mCG_6004"
FT                   /product="mCG6004, isoform CRA_a"
FT                   /note="gene_id=mCG6004.3 transcript_id=mCT175063.0
FT                   protein_id=mCP97982.0 isoform=CRA_a"
FT                   /protein_id="EDL31920.1"
FT                   /translation="MRHFGVRHRFCTQTLGVDKGYKNQSFYRKHFDTEETRVNQLFAQA
FT                   KACKVQVEKCTVSVQDIQVHLAQGHVAIVLVNSGVLHCDLCSSPVKYCCFTPSGHRCFC
FT                   RTPDYQGHFIVLRGYNRATGCIFYNNPAYADRMCSTSISNFEEARTSYGTDEDILFVYL
FT                   DS"
FT   gene            16805799..16825633
FT                   /gene="Snrpd3"
FT                   /locus_tag="mCG_5988"
FT                   /note="gene_id=mCG5988.2"
FT   mRNA            join(16805799..16806371,16807560..16807706,
FT                   16820423..16820615,16823521..16825633)
FT                   /gene="Snrpd3"
FT                   /locus_tag="mCG_5988"
FT                   /product="small nuclear ribonucleoprotein D3, transcript
FT                   variant mCT4647"
FT                   /note="gene_id=mCG5988.2 transcript_id=mCT4647.2 created on
FT                   17-DEC-2002"
FT   mRNA            join(16805799..16806371,16807560..16807706,
FT                   16820423..16820476,16823521..16825633)
FT                   /gene="Snrpd3"
FT                   /locus_tag="mCG_5988"
FT                   /product="small nuclear ribonucleoprotein D3, transcript
FT                   variant mCT177522"
FT                   /note="gene_id=mCG5988.2 transcript_id=mCT177522.0 created
FT                   on 17-DEC-2002"
FT   CDS             join(16807581..16807706,16820423..16820476,
FT                   16823521..16823595)
FT                   /codon_start=1
FT                   /gene="Snrpd3"
FT                   /locus_tag="mCG_5988"
FT                   /product="small nuclear ribonucleoprotein D3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5988.2 transcript_id=mCT177522.0
FT                   protein_id=mCP100444.0 isoform=CRA_a"
FT                   /protein_id="EDL31912.1"
FT                   /translation="MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSN
FT                   ITVTYRDGRVAQLEQWPHEGEDVGWDVGTSSRSEDNILH"
FT   CDS             join(16807581..16807706,16820423..16820615,
FT                   16823521..16823582)
FT                   /codon_start=1
FT                   /gene="Snrpd3"
FT                   /locus_tag="mCG_5988"
FT                   /product="small nuclear ribonucleoprotein D3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5988.2 transcript_id=mCT4647.2
FT                   protein_id=mCP9214.1 isoform=CRA_b"
FT                   /protein_id="EDL31913.1"
FT                   /translation="MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSN
FT                   ITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILK
FT                   AQVAARGRGRGMGRGNIFQKRR"
FT   gene            complement(16838307..>16848513)
FT                   /gene="AI646023"
FT                   /locus_tag="mCG_5995"
FT                   /note="gene_id=mCG5995.2"
FT   mRNA            complement(join(16838307..16838647,16841782..16842303,
FT                   16844133..16844233,16845403..16845531,16848067..16848513))
FT                   /gene="AI646023"
FT                   /locus_tag="mCG_5995"
FT                   /product="expressed sequence AI646023, transcript variant
FT                   mCT4642"
FT                   /note="gene_id=mCG5995.2 transcript_id=mCT4642.2 created on
FT                   30-OCT-2002"
FT   mRNA            complement(join(16838315..16842303,16844133..16844233,
FT                   16845403..16845531,16848139..>16848513))
FT                   /gene="AI646023"
FT                   /locus_tag="mCG_5995"
FT                   /product="expressed sequence AI646023, transcript variant
FT                   mCT192962"
FT                   /note="gene_id=mCG5995.2 transcript_id=mCT192962.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(16838452..16838647,16841782..16842303,
FT                   16844133..16844233,16845403..16845531,16848067..16848303))
FT                   /codon_start=1
FT                   /gene="AI646023"
FT                   /locus_tag="mCG_5995"
FT                   /product="expressed sequence AI646023, isoform CRA_b"
FT                   /note="gene_id=mCG5995.2 transcript_id=mCT4642.2
FT                   protein_id=mCP9280.2 isoform=CRA_b"
FT                   /protein_id="EDL31911.1"
FT                   /translation="MGARLGRRARADAPAAPSAGPAPYERRVRWLREIQSTLRERRPER
FT                   ARQLLRLLRQARERAGRPGIEGVREGPGLRAQGWDLGLEGNLLTDILHRNVTFLNLVDP
FT                   ISHDLLVNLARDLQCPKKDHELWKSSDKICRQLIYHLTPHSKRKHHRKTQSSLKSSLQK
FT                   TLLVGETVDLSGIPLSARDVQHISRYLDTRGVELVVLDLSFTELSDELLHLLLPSLWAL
FT                   PRLTQLLLNGNRLTRAAARELTEAIKDTAKFPVLAWVDLGNNVDVSSLPQPLLVGLRRR
FT                   LSQHTSLPTIYEGLDLEPGGGMAETTAAVSTWGSAATEAGPEPQGCCASAISLRTQNRG
FT                   QLVPDAPRFSLGEKESSLVLGEGLGSPPPLLSSPLKKPSVLSSQLHILYCIVLF"
FT   CDS             complement(join(16841778..16842303,16844133..16844233,
FT                   16845403..16845531,16848139..>16848345))
FT                   /codon_start=1
FT                   /gene="AI646023"
FT                   /locus_tag="mCG_5995"
FT                   /product="expressed sequence AI646023, isoform CRA_a"
FT                   /note="gene_id=mCG5995.2 transcript_id=mCT192962.0
FT                   protein_id=mCP113930.0 isoform=CRA_a"
FT                   /protein_id="EDL31910.1"
FT                   /translation="PASLPSSRRPPAAAMGARLGRRARADAPAAPSAGPAPYERRVRWL
FT                   REIQSTLRERRPERARQLLRLLRQDLGLEGNLLTDILHRNVTFLNLVDPISHDLLVNLA
FT                   RDLQCPKKDHELWKSSDKICRQLIYHLTPHSKRKHHRKTQSSLKSSLQKTLLVGETVDL
FT                   SGIPLSARDVQHISRYLDTRGVELVVLDLSFTELSDELLHLLLPSLWALPRLTQLLLNG
FT                   NRLTRAAARELTEAIKDTAKFPVLAWVDLGNNVDVSSLPQPLLVGLRRRLSQHTSLPTI
FT                   YEGLDLEPGGGMAETTAAVSTWGSAATEAGPEPQGCCAR"
FT   gene            16849787..16874362
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /note="gene_id=mCG6008.2"
FT   mRNA            join(16849787..16849830,16849917..16849989,
FT                   16853004..16853088,16861792..16861929,16862413..16862577,
FT                   16864130..16864260,16864396..16864482,16866909..16867101,
FT                   16867406..16867563,16868684..16868833,16869477..16869613,
FT                   16873000..16873187,16873338..16873465,16873567..16873679,
FT                   16873771..16873884,16874061..16874362)
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, transcript variant
FT                   mCT173641"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173641.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(16849838..16849989,16853004..16853088,
FT                   16861792..16861929,16862413..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874362)
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, transcript variant
FT                   mCT173640"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173640.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(16852341..16852441,16853004..16853088,
FT                   16861792..16861929,16862413..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874362)
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, transcript variant
FT                   mCT173639"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173639.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(16856839..16856953,16861792..16861929,
FT                   16862413..16862577,16864130..16864260,16864396..16864482,
FT                   16866909..16867101,16867406..16867563,16868684..16868833,
FT                   16869477..16869613,16873000..16873187,16873338..16873465,
FT                   16873567..16873679,16873771..16873884,16874061..16874362)
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, transcript variant
FT                   mCT173642"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173642.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(16856848..16857152,16861792..16861929,
FT                   16862413..16862577,16864130..16864260,16864396..16864482,
FT                   16866909..16867101,16867406..16867563,16868684..16868833,
FT                   16869477..16869613,16873000..16873187,16873338..16873465,
FT                   16873567..16873679,16873771..16873884,16874061..16874362)
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, transcript variant
FT                   mCT173643"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173643.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(16856848..16856949,16861792..16861929,
FT                   16862413..16862577,16864130..16864260,16864396..16864482,
FT                   16866909..16867101,16867406..16867563,16868684..16868833,
FT                   16869477..16869613,16873000..16873187,16873338..16873465,
FT                   16873567..16873679,16873771..16873884,16874061..16874362)
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, transcript variant
FT                   mCT173638"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173638.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(16859706..16859824,16861792..16861929,
FT                   16862413..16862577,16864130..16864260,16864396..16864482,
FT                   16866909..16867101,16867406..16867563,16868684..16868833,
FT                   16869477..16869613,16873000..16873187,16873338..16873465,
FT                   16873567..16873679,16873771..16873884,16874061..16874362)
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, transcript variant
FT                   mCT173637"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173637.0 created
FT                   on 24-SEP-2002"
FT   mRNA            join(16861676..16861929,16862413..16862577,
FT                   16864130..16864260,16864396..16864482,16866909..16867101,
FT                   16867406..16867563,16868684..16868833,16869477..16869613,
FT                   16873000..16873187,16873338..16873465,16873567..16873679,
FT                   16873771..16873884,16874061..16874362)
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, transcript variant
FT                   mCT4630"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT4630.1 created on
FT                   23-SEP-2002"
FT   CDS             join(16862417..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874207)
FT                   /codon_start=1
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173637.0
FT                   protein_id=mCP96559.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK56"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:95706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK56"
FT                   /protein_id="EDL31902.1"
FT                   /translation="MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATD
FT                   AKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVIN
FT                   AREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLA
FT                   RHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQE
FT                   GAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLS
FT                   GPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQV
FT                   IRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTI
FT                   NLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIIL
FT                   DKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKD
FT                   IDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY"
FT   CDS             join(16862417..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874207)
FT                   /codon_start=1
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173638.0
FT                   protein_id=mCP96557.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK56"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:95706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK56"
FT                   /protein_id="EDL31903.1"
FT                   /translation="MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATD
FT                   AKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVIN
FT                   AREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLA
FT                   RHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQE
FT                   GAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLS
FT                   GPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQV
FT                   IRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTI
FT                   NLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIIL
FT                   DKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKD
FT                   IDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY"
FT   CDS             join(16862417..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874207)
FT                   /codon_start=1
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173639.0
FT                   protein_id=mCP96562.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK56"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:95706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK56"
FT                   /protein_id="EDL31904.1"
FT                   /translation="MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATD
FT                   AKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVIN
FT                   AREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLA
FT                   RHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQE
FT                   GAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLS
FT                   GPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQV
FT                   IRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTI
FT                   NLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIIL
FT                   DKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKD
FT                   IDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY"
FT   CDS             join(16862417..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874207)
FT                   /codon_start=1
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173640.0
FT                   protein_id=mCP96558.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK56"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:95706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK56"
FT                   /protein_id="EDL31905.1"
FT                   /translation="MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATD
FT                   AKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVIN
FT                   AREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLA
FT                   RHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQE
FT                   GAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLS
FT                   GPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQV
FT                   IRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTI
FT                   NLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIIL
FT                   DKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKD
FT                   IDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY"
FT   CDS             join(16862417..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874207)
FT                   /codon_start=1
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173641.0
FT                   protein_id=mCP96560.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK56"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:95706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK56"
FT                   /protein_id="EDL31906.1"
FT                   /translation="MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATD
FT                   AKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVIN
FT                   AREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLA
FT                   RHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQE
FT                   GAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLS
FT                   GPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQV
FT                   IRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTI
FT                   NLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIIL
FT                   DKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKD
FT                   IDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY"
FT   CDS             join(16862417..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874207)
FT                   /codon_start=1
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173642.0
FT                   protein_id=mCP96556.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK56"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:95706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK56"
FT                   /protein_id="EDL31907.1"
FT                   /translation="MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATD
FT                   AKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVIN
FT                   AREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLA
FT                   RHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQE
FT                   GAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLS
FT                   GPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQV
FT                   IRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTI
FT                   NLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIIL
FT                   DKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKD
FT                   IDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY"
FT   CDS             join(16862417..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874207)
FT                   /codon_start=1
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT4630.1
FT                   protein_id=mCP9299.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK56"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:95706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK56"
FT                   /protein_id="EDL31908.1"
FT                   /translation="MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATD
FT                   AKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVIN
FT                   AREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLA
FT                   RHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQE
FT                   GAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLS
FT                   GPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQV
FT                   IRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTI
FT                   NLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIIL
FT                   DKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKD
FT                   IDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY"
FT   CDS             join(16862417..16862577,16864130..16864260,
FT                   16864396..16864482,16866909..16867101,16867406..16867563,
FT                   16868684..16868833,16869477..16869613,16873000..16873187,
FT                   16873338..16873465,16873567..16873679,16873771..16873884,
FT                   16874061..16874207)
FT                   /codon_start=1
FT                   /gene="Ggt1"
FT                   /locus_tag="mCG_6008"
FT                   /product="gamma-glutamyltransferase 1, isoform CRA_a"
FT                   /note="gene_id=mCG6008.2 transcript_id=mCT173643.0
FT                   protein_id=mCP96561.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK56"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:95706"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK56"
FT                   /protein_id="EDL31909.1"
FT                   /translation="MKNRFLVLGLVAVVLVFVIIGLCIWLPYTSGKPDHVYSRAAVATD
FT                   AKRCSEIGRDILQEGGSVVDAAIASLLCMGLMNAHSMGIGGGLFFTIYNSTTGKVEVIN
FT                   AREVAPRLANTTMFNNSKDSEEGGLSVAVPGEIRGYELAHQRHGRLPWARLFQPSIQLA
FT                   RHGFPVGKGLAIALDKKRDVIEKTPALCEVFCRQGKVLQEGETVTMPKLADTLQILAQE
FT                   GAKAFYNGSLTAQIVKDIQEAGGIMTVEDLNNYRAELIEHPMSIGLGDATLYVPSAPLS
FT                   GPVLILILNILKGYNFSPKSVATPEQKALTYHRIVEAFRFAYAKRTMLGDPKFVDVSQV
FT                   IRNMSSEFYATQLRARITDETTHPAAYYEPEFYLQDDGGTAHLSAVSEDGSAVAATSTI
FT                   NLYFGSKVLSRVSGILFNDEMDDFSSPNFINQFRVAPSPANFIKPGKQPLSSMCPSIIL
FT                   DKDGQVRMVVGASGGTQITTSVALAIINSLWFGYDVKRAVEEPRLHNQLLPNTTTVEKD
FT                   IDQVVTAGLKIRHHHTEVTPTFIAVVQAVVRASGGWAAASDSRKGGEPAGY"
FT   gene            16877560..16903367
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /note="gene_id=mCG6005.2"
FT   mRNA            join(16877560..16878062,16890800..16890930,
FT                   16891154..16891249,16892147..16892342,16892705..16892764,
FT                   16893436..16893582,16896931..16897067,16897379..16897572,
FT                   16898025..16898131,16898293..16898411,16898608..16898718,
FT                   16902910..16903367)
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /product="gamma-glutamyltransferase-like activity 1,
FT                   transcript variant mCT173635"
FT                   /note="gene_id=mCG6005.2 transcript_id=mCT173635.0 created
FT                   on 23-SEP-2002"
FT   mRNA            join(16877560..16878062,16890800..16890930,
FT                   16891154..16891249,16892147..16892342,16892823..16892980,
FT                   16893436..16893582,16896931..16897067,16897379..16897572,
FT                   16898025..16898131,16898293..16898411,16898608..16898718,
FT                   16902910..16903367)
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /product="gamma-glutamyltransferase-like activity 1,
FT                   transcript variant mCT4634"
FT                   /note="gene_id=mCG6005.2 transcript_id=mCT4634.2 created on
FT                   23-SEP-2002"
FT   mRNA            join(16877560..16878062,16890800..16890930,
FT                   16891154..16891249,16892147..16892342,16892823..16892980,
FT                   16893436..16893582,16896931..16897067,16898025..16898131,
FT                   16898293..16898411,16898608..16898718,16902910..16903367)
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /product="gamma-glutamyltransferase-like activity 1,
FT                   transcript variant mCT173634"
FT                   /note="gene_id=mCG6005.2 transcript_id=mCT173634.0 created
FT                   on 23-SEP-2002"
FT   mRNA            join(<16877781..16878062,16890800..16890930,
FT                   16891154..16891249,16892147..16892342,16892492..16892764,
FT                   16893436..16893582,16896931..16897067,16898025..16898131,
FT                   16898299..16898411,16898608..16898718,16902910..16903365)
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /product="gamma-glutamyltransferase-like activity 1,
FT                   transcript variant mCT192991"
FT                   /note="gene_id=mCG6005.2 transcript_id=mCT192991.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<16877887..16878062,16890800..16890930,
FT                   16891154..16891249,16892147..16892342,16892492..16892588)
FT                   /codon_start=1
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /product="gamma-glutamyltransferase-like activity 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG6005.2 transcript_id=mCT192991.0
FT                   protein_id=mCP113963.0 isoform=CRA_c"
FT                   /protein_id="EDL31900.1"
FT                   /translation="AMAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRA
FT                   AVAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGK
FT                   VEIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQL
FT                   FQPTIALLREGFRVPFILSQFLNNSILRPHLSASTLSQNLIWTKDSLLPRHWLPSACLW
FT                   EWHIAFFAQ"
FT   CDS             join(16877890..16878062,16890800..16890930,
FT                   16891154..16891249,16892147..16892342,16892823..16892980,
FT                   16893436..16893582,16896931..16897067,16897379..16897572,
FT                   16898025..16898131,16898293..16898411,16898608..16898718,
FT                   16902910..16903062)
FT                   /codon_start=1
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /product="gamma-glutamyltransferase-like activity 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG6005.2 transcript_id=mCT4634.2
FT                   protein_id=mCP9286.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q9Z2A9"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="MGI:MGI:1346063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z2A9"
FT                   /protein_id="EDL31901.1"
FT                   /translation="MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAA
FT                   VAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKV
FT                   EIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLF
FT                   QPTIALLREGFRVPFILSQFLNNSILRPHLSASTLRQLFFNGTETLRSQDPFPWPALAN
FT                   TLETVAKEGAEVLYTGRLGRMLVEDIAKQGSLLTVQDLAAFQPEVVEPLEMPLGNYTLY
FT                   SPPPPAGGAILSFILNVLKGFNFSAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPS
FT                   SHPGIQNISRDLLREDLAQRIRQQIDGRGDHHQLSHYNLTGVRGNRMGTSHVSVLGEDG
FT                   SAVAATSTINTPFGAMVYSPRTGILLNNELLDLCWRHMPTSPITPPPVPGERPPSSMVP
FT                   SILVNKGQGSKLVIGGAGGELIISAVAQTIMNKLWLGFDLTEAIASPILHVNSKGHVEY
FT                   EPKFNQEVQKGLQDRGQIQSQSQRPVFLNAVQAVFQEGPCVYAASDLRKAGKASGY"
FT   CDS             join(16877890..16878062,16890800..16890930,
FT                   16891154..16891249,16892147..16892342,16892823..16892980,
FT                   16893436..16893582,16896931..16897067,16898025..16898131,
FT                   16898293..16898302)
FT                   /codon_start=1
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /product="gamma-glutamyltransferase-like activity 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG6005.2 transcript_id=mCT173634.0
FT                   protein_id=mCP96553.0 isoform=CRA_a"
FT                   /protein_id="EDL31898.1"
FT                   /translation="MAWGHRATVCLVLLGVGLGLVIVVLAAVLSPRQASCGPGAFTRAA
FT                   VAADSKICSDIGRAILQQRGSPVDAAIAALVCTGVVNPQSMGLGGGVVFTIYNASTGKV
FT                   EIINARETVPASYDQGLLNQCKNVLPLGTGAQWIGVPGELRGYAEAHRRHGRLPWAQLF
FT                   QPTIALLREGFRVPFILSQFLNNSILRPHLSASTLRQLFFNGTETLRSQDPFPWPALAN
FT                   TLETVAKEGAEVLYTGRLGRMLVEDIAKQGSLLTVQDLAAFQPEVVEPLEMPLGNYTLY
FT                   SPPPPAGGAILSFILNVLKGFNFSAETVARPGGEVNMYHHLVETLKFAVGQRWRLWDPS
FT                   SHPGIQLWGDGVLPTDRHPPEQRASRLMLETHANIPDHPSTCSR"
FT   CDS             join(16893498..16893582,16896931..16897067,
FT                   16897379..16897572,16898025..16898131,16898293..16898411,
FT                   16898608..16898718,16902910..16903062)
FT                   /codon_start=1
FT                   /gene="Ggtla1"
FT                   /locus_tag="mCG_6005"
FT                   /product="gamma-glutamyltransferase-like activity 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG6005.2 transcript_id=mCT173635.0
FT                   protein_id=mCP96554.0 isoform=CRA_b"
FT                   /protein_id="EDL31899.1"
FT                   /translation="MPLGNYTLYSPPPPAGGAILSFILNVLKGFNFSAETVARPGGEVN
FT                   MYHHLVETLKFAVGQRWRLWDPSSHPGIQNISRDLLREDLAQRIRQQIDGRGDHHQLSH
FT                   YNLTGVRGNRMGTSHVSVLGEDGSAVAATSTINTPFGAMVYSPRTGILLNNELLDLCWR
FT                   HMPTSPITPPPVPGERPPSSMVPSILVNKGQGSKLVIGGAGGELIISAVAQTIMNKLWL
FT                   GFDLTEAIASPILHVNSKGHVEYEPKFNQEVQKGLQDRGQIQSQSQRPVFLNAVQAVFQ
FT                   EGPCVYAASDLRKAGKASGY"
FT   gene            complement(16924807..>16932190)
FT                   /gene="Susd2"
FT                   /locus_tag="mCG_5998"
FT                   /note="gene_id=mCG5998.2"
FT   mRNA            complement(join(16924807..16925549,16925680..16925785,
FT                   16925861..16926037,16926144..16926416,16926526..16926774,
FT                   16927521..16927679,16927774..16927917,16928013..16928281,
FT                   16928368..16928453,16928635..16928836,16928954..16929128,
FT                   16929612..16929779,16932054..16932190))
FT                   /gene="Susd2"
FT                   /locus_tag="mCG_5998"
FT                   /product="sushi domain containing 2, transcript variant
FT                   mCT175060"
FT                   /note="gene_id=mCG5998.2 transcript_id=mCT175060.0 created
FT                   on 30-OCT-2002"
FT   mRNA            complement(join(16924807..16925549,16925680..16925785,
FT                   16925861..16926037,16926144..16926416,16926526..16926774,
FT                   16927521..16927679,16927774..16927917,16928013..16928281,
FT                   16928368..16928453,16928635..16928836,16928954..16929128,
FT                   16929612..16929779,16930304..16930455,16930642..16930849,
FT                   16932054..16932190))
FT                   /gene="Susd2"
FT                   /locus_tag="mCG_5998"
FT                   /product="sushi domain containing 2, transcript variant
FT                   mCT4638"
FT                   /note="gene_id=mCG5998.2 transcript_id=mCT4638.2 created on
FT                   30-OCT-2002"
FT   mRNA            complement(join(16924887..16925549,16925680..16925785,
FT                   16925861..16926037,16926144..16926416,16926526..16926774,
FT                   16927521..16927679,16927774..16927917,16928013..16928836,
FT                   16928954..16929128,16929612..16929779,16930304..16930455,
FT                   16930642..16930849,16932054..>16932190))
FT                   /gene="Susd2"
FT                   /locus_tag="mCG_5998"
FT                   /product="sushi domain containing 2, transcript variant
FT                   mCT192968"
FT                   /note="gene_id=mCG5998.2 transcript_id=mCT192968.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(16925525..16925549,16925680..16925785,
FT                   16925861..16926037,16926144..16926416,16926526..16926774,
FT                   16927521..16927679,16927774..16927917,16928013..16928281,
FT                   16928368..16928453,16928635..16928836,16928954..16929128,
FT                   16929612..16929779,16932054..16932123))
FT                   /codon_start=1
FT                   /gene="Susd2"
FT                   /locus_tag="mCG_5998"
FT                   /product="sushi domain containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG5998.2 transcript_id=mCT175060.0
FT                   protein_id=mCP97979.0 isoform=CRA_a"
FT                   /protein_id="EDL31895.1"
FT                   /translation="MKLALLPWILMLLSTIPGPGFTAAHPYKVSESEKSQLVNETHWQY
FT                   YGTSDTRGNLNLTWDTSALPTPAVTIELWGYEETGKPYSGNWTSKWSYLYPLATNIPNT
FT                   GFFTFTPKPASPQYQRWKVGALRISSSRNYPGEKDVRALWTNDHALAWHLGDDFRADSV
FT                   AWARAQCLAWEALEDQLPNFLTELPDCPCTLAQARADSGRFFTDYGCDIEHGSVCTYHP
FT                   GAVHCVRSVQASPRYGSGQQCCYTAAGTQLLTSDSTSGSTPDRGHDWGAPPYRTPPRVP
FT                   GMSHWLYDVISFYYCCLWAPECPRYMKRRPSSDCRNYRPPRLASAFGDPHFVTFDGTSF
FT                   SFSGNGEYVLLETTLSDLRVQGRAQPGRMPNGTQARGTGLTAVAVQEDNSDVIEVRLAG
FT                   GSRVLEVLLNQKVLSFTEQNWMDLKGMFLSVAAQDKVSIMLSSGAGLEVGVQGPFLSVS
FT                   ILLPEKFLTHTRGLLGTLNNNPRDDFTLRNGQVLPLNASAQQVFQFGADWAVSNTSSLF
FT                   TYDSWLLVYQFVYGPKHNPNFKPLFPDETTLSPSQTEDVARLCEGDRFCILDVMSTGSS
FT                   SVGNATRIAHQLHQHRLKSLQPVVSCGWLPPPANGHKEGLRYLEGSVVRFSCNNGYSLV
FT                   GPESSTCQADGKWSMPTPECQPGRSYTVLLSIIFGGLAIVALISIIYMMLHRRRKSNMT
FT                   MWSSQP"
FT   CDS             complement(join(16925525..16925549,16925680..16925785,
FT                   16925861..16926037,16926144..16926416,16926526..16926774,
FT                   16927521..16927679,16927774..16927917,16928013..16928281,
FT                   16928368..16928453,16928635..16928836,16928954..16929128,
FT                   16929612..16929779,16930304..16930455,16930642..16930849,
FT                   16932054..16932123))
FT                   /codon_start=1
FT                   /gene="Susd2"
FT                   /locus_tag="mCG_5998"
FT                   /product="sushi domain containing 2, isoform CRA_c"
FT                   /note="gene_id=mCG5998.2 transcript_id=mCT4638.2
FT                   protein_id=mCP9256.2 isoform=CRA_c"
FT                   /protein_id="EDL31897.1"
FT                   /translation="MKLALLPWILMLLSTIPGPGFTAGAQGSCSLRCGAQDGLCSCHPT
FT                   CSGLGTCCEDFLDYCLEILPSSGSMMGGKDFVVQHLKWTDPTDGVICRFKESIQTLGYV
FT                   DDFYQVHCISPLLYESGYIPFTISMDNGRSFPHAGTWLAAHPYKVSESEKSQLVNETHW
FT                   QYYGTSDTRGNLNLTWDTSALPTPAVTIELWGYEETGKPYSGNWTSKWSYLYPLATNIP
FT                   NTGFFTFTPKPASPQYQRWKVGALRISSSRNYPGEKDVRALWTNDHALAWHLGDDFRAD
FT                   SVAWARAQCLAWEALEDQLPNFLTELPDCPCTLAQARADSGRFFTDYGCDIEHGSVCTY
FT                   HPGAVHCVRSVQASPRYGSGQQCCYTAAGTQLLTSDSTSGSTPDRGHDWGAPPYRTPPR
FT                   VPGMSHWLYDVISFYYCCLWAPECPRYMKRRPSSDCRNYRPPRLASAFGDPHFVTFDGT
FT                   SFSFSGNGEYVLLETTLSDLRVQGRAQPGRMPNGTQARGTGLTAVAVQEDNSDVIEVRL
FT                   AGGSRVLEVLLNQKVLSFTEQNWMDLKGMFLSVAAQDKVSIMLSSGAGLEVGVQGPFLS
FT                   VSILLPEKFLTHTRGLLGTLNNNPRDDFTLRNGQVLPLNASAQQVFQFGADWAVSNTSS
FT                   LFTYDSWLLVYQFVYGPKHNPNFKPLFPDETTLSPSQTEDVARLCEGDRFCILDVMSTG
FT                   SSSVGNATRIAHQLHQHRLKSLQPVVSCGWLPPPANGHKEGLRYLEGSVVRFSCNNGYS
FT                   LVGPESSTCQADGKWSMPTPECQPGRSYTVLLSIIFGGLAIVALISIIYMMLHRRRKSN
FT                   MTMWSSQP"
FT   CDS             complement(join(16925525..16925549,16925680..16925785,
FT                   16925861..16926037,16926144..16926416,16926526..16926774,
FT                   16927521..16927679,16927774..16927917,16928013..>16928301))
FT                   /codon_start=1
FT                   /gene="Susd2"
FT                   /locus_tag="mCG_5998"
FT                   /product="sushi domain containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG5998.2 transcript_id=mCT192968.0
FT                   protein_id=mCP113931.0 isoform=CRA_b"
FT                   /protein_id="EDL31896.1"
FT                   /translation="PPPTLPSPRYGSGQQCCYTAAGTQLLTSDSTSGSTPDRGHDWGAP
FT                   PYRTPPRVPGMSHWLYDVISFYYCCLWAPECPRYMKRRPSSDCRNYRPPRLASAFGDPH
FT                   FVTFDGTSFSFSGNGEYVLLETTLSDLRVQGRAQPGRMPNGTQARGTGLTAVAVQEDNS
FT                   DVIEVRLAGGSRVLEVLLNQKVLSFTEQNWMDLKGMFLSVAAQDKVSIMLSSGAGLEVG
FT                   VQGPFLSVSILLPEKFLTHTRGLLGTLNNNPRDDFTLRNGQVLPLNASAQQVFQFGADW
FT                   AVSNTSSLFTYDSWLLVYQFVYGPKHNPNFKPLFPDETTLSPSQTEDVARLCEGDRFCI
FT                   LDVMSTGSSSVGNATRIAHQLHQHRLKSLQPVVSCGWLPPPANGHKEGLRYLEGSVVRF
FT                   SCNNGYSLVGPESSTCQADGKWSMPTPECQPGRSYTVLLSIIFGGLAIVALISIIYMML
FT                   HRRRKSNMTMWSSQP"
FT   gene            complement(16934289..17052564)
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /note="gene_id=mCG117500.1"
FT   mRNA            complement(join(16934289..16934866,16935054..16935280,
FT                   16936234..16936398,16941052..16941319,16943543..16943617,
FT                   16944952..16945629,16945973..16946069,16946811..16946974,
FT                   16972568..16972681,16982991..16983322,16988189..16988371,
FT                   17001729..17001907,17003875..17004026,17005714..17005974,
FT                   17009554..17009815,17013535..17013680,17013825..17014031,
FT                   17015118..17015279,17020660..17020775,17021880..17022036,
FT                   17023226..17023468,17025581..17025775,17026471..17026623,
FT                   17027586..17027773,17028280..17028358,17030505..17030722,
FT                   17031462..17031598,17033489..17033657,17034748..17035034,
FT                   17036086..17036235,17038304..17038433,17039696..17039876,
FT                   17041637..17041771,17042511..17042624,17043072..17043164,
FT                   17043629..17043760,17052274..17052564))
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /product="calcineurin binding protein 1, transcript variant
FT                   mCT118645"
FT                   /note="gene_id=mCG117500.1 transcript_id=mCT118645.1
FT                   created on 30-OCT-2002"
FT   mRNA            complement(join(16934289..16934866,16935054..16935280,
FT                   16936234..16936398,16941052..16941319,16943543..16943617,
FT                   16944952..16945629,16945973..16946069,16946811..16946974,
FT                   16956192..16956243))
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /product="calcineurin binding protein 1, transcript variant
FT                   mCT175047"
FT                   /note="gene_id=mCG117500.1 transcript_id=mCT175047.0
FT                   created on 30-OCT-2002"
FT   mRNA            complement(join(16934289..16934866,16935054..16935280,
FT                   16936234..16936398,16941052..16941319,16943543..16943617,
FT                   16944952..16945629,16945973..16946069,16946811..16946974,
FT                   16955719..16955739))
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /product="calcineurin binding protein 1, transcript variant
FT                   mCT175048"
FT                   /note="gene_id=mCG117500.1 transcript_id=mCT175048.0
FT                   created on 30-OCT-2002"
FT   mRNA            complement(join(<16934298..16934350,17013876..17014031,
FT                   17015118..17015279,17020660..17020775,17021880..17022036,
FT                   17023226..17023468,17025581..17025775,17026471..17026623,
FT                   17027586..17027773,17028280..17028358,17030505..17030722,
FT                   17031462..17031598,17033489..17033657,17034748..17035034,
FT                   17036086..17036235,17038304..17038433,17039696..17039876,
FT                   17041637..17041771,17042511..17042624,17043072..17043164,
FT                   17043629..17043760,17052285..>17052545))
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /product="calcineurin binding protein 1, transcript variant
FT                   mCT192985"
FT                   /note="gene_id=mCG117500.1 transcript_id=mCT192985.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(<16934298..16934350,17013876..17014031,
FT                   17015118..17015279,17020660..17020775,17021880..17022036,
FT                   17023226..17023468,17025581..17025775,17026471..17026623,
FT                   17027586..17027773,17028280..17028358,17030505..17030722,
FT                   17031462..17031598,17033489..17033657,17034748..17035034,
FT                   17036086..17036235,17038304..17038433,17039696..17039876,
FT                   17041637..17041771,17042511..17042624,17043072..17043164,
FT                   17043629..17043760,17052285..>17052347))
FT                   /codon_start=1
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /product="calcineurin binding protein 1, isoform CRA_d"
FT                   /note="gene_id=mCG117500.1 transcript_id=mCT192985.0
FT                   protein_id=mCP113965.0 isoform=CRA_d"
FT                   /protein_id="EDL31894.1"
FT                   /translation="PQLEAIPFGASFRSPSPQPSEVGLSTVPFRSWLLLNPSVLFALQG
FT                   TVVSQGWEVILRGGAESLNMIRIAALNASSTIEDDHEGSFKSHKIQTKEAQEAEAFALY
FT                   HKALDLQKHDRFEESAKAYHELLEARLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQL
FT                   AAQREDLETAMEFYLEAVMLDSTDVNLWYKIGHVALRLIRLPLARHAFEEGLRCNPDHW
FT                   PCLDNLITVLYTLSDYTTCLYFICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFL
FT                   KCDMSIHDVSVSAAETQAIVDEALGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGES
FT                   LLAMYSHLTTCEPPRPSLGKRIDLSDYQDPSQLLASSVVVTPVSVVQPSPICTNPTVAV
FT                   AEPVLSYTSVTAASFPLHSPSLLDTGTPMGDVSGGDKSKKGVKRKKTVEESGETAKRRS
FT                   ARVRNTKCKKEEKVDFQGLLVKFLPSRLRKLDPEEEDDPFNNYEVQAEAKLESFSNVGP
FT                   HRLSFDSATFMESEKQDVHAFLMENLTNGGLLELMMRYLKSMGHKFLLKWPPGLADVVL
FT                   SVYHSWRRHSTSLPNPLLRDCSNKHIKDMMLMSLSCMELQLDQWLLTKGRSSAVSPRNC
FT                   PAGVVTGRFGPDFPGTHCLGDLLQLSFASSQRDLFEDGWLEFVVRVYWLKARFLALQGD
FT                   MEQALENYDICTEILQSSSAIQAQAGAEQGDIVIRLPNLHNDSVVSLEEIDKNLKSLER
FT                   CQSLEEIQRLFEAGDYKAVVHLLRPTLCTSGFDRAKHLEFMTSIPERPAQLLLLQDSLL
FT                   RLKDHRQCFECSDVALNEAVQQMLNSSESAAKEEWVATVTQLLLGIEQALSSDSSGSIL
FT                   KESSSTTGLVRLTNNLIQVIDCSMAVQEEPKEPYVSSVLPWIILHRIIWQEEDTFRSLC
FT                   HQQQLQNPTEEGIPEMPMLPSSLMLLNTAHEYLGRRSWCCNSDGALLRFYVQVLQKELA
FT                   ASASEDTHPYKEELETALEQCFYCLYSFPSKKSKARYLEEHSAQQVDLIWEDALFMFEY
FT                   FKPKTLPEFDSYKTSTVSADLANLLKRIATIVPRTEKPLTPHPFFVIVASFSNKGG"
FT   CDS             complement(join(16934723..16934866,16935054..16935280,
FT                   16936234..16936398,16941052..16941319,16943543..16943617,
FT                   16944952..16945629,16945973..16946069,16946811..16946974,
FT                   16972568..16972681,16982991..16983322,16988189..16988371,
FT                   17001729..17001907,17003875..17004026,17005714..17005974,
FT                   17009554..17009815,17013535..17013680,17013825..17014031,
FT                   17015118..17015279,17020660..17020775,17021880..17022036,
FT                   17023226..17023468,17025581..17025775,17026471..17026623,
FT                   17027586..17027773,17028280..17028358,17030505..17030722,
FT                   17031462..17031598,17033489..17033657,17034748..17035034,
FT                   17036086..17036235,17038304..17038433,17039696..17039876,
FT                   17041637..17041771,17042511..17042624,17043072..17043164,
FT                   17043629..17043631))
FT                   /codon_start=1
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /product="calcineurin binding protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG117500.1 transcript_id=mCT118645.1
FT                   protein_id=mCP55064.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8Q1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015134"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="MGI:MGI:1298375"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Q1"
FT                   /protein_id="EDL31891.1"
FT                   /translation="MIRIAALNASSTIEDDHEGSFKSHKIQTKEAQEAEAFALYHKALD
FT                   LQKHDRFEESAKAYHELLEARLLREAVSSGDEKEGLKHPGLILKYSTYKNLAQLAAQRE
FT                   DLETAMEFYLEAVMLDSTDVNLWYKIGHVALRLIRLPLARHAFEEGLRCNPDHWPCLDN
FT                   LITVLYTLSDYTTCLYFICKALEKDCRYSKGLVLKEKIFEEQPCLRKDSLRMFLKCDMS
FT                   IHDVSVSAAETQAIVDEALGLRKKRQALIVREKEPDLKLVQPIPFFTWKCLGESLLAMY
FT                   SHLTTCEPPRPSLGKRIDLSDYQDPSQLLASSVVVTPVSVVQPSPICTNPTVAVAEPVL
FT                   SYTSVTAASFPLHSPSLLDTGTPMGDVSGGDKSKKGVKRKKTVEESGETAKRRSARVRN
FT                   TKCKKEEKVDFQGLLVKFLPSRLRKLDPEEEDDPFNNYEVQAEAKLESFSNVGPHRLSF
FT                   DSATFMESEKQDVHAFLMENLTNGGLLELMMRYLKSMGHKFLLKWPPGLADVVLSVYHS
FT                   WRRHSTSLPNPLLRDCSNKHIKDMMLMSLSCMELQLDQWLLTKGRSSAVSPRNCPAGVV
FT                   TGRFGPDFPGTHCLGDLLQLSFASSQRDLFEDGWLEFVVRVYWLKARFLALQGDMEQAL
FT                   ENYDICTEILQSSSAIQAQAGAEQGDIVIRLPNLHNDSVVSLEEIDKNLKSLERCQSLE
FT                   EIQRLFEAGDYKAVVHLLRPTLCTSGFDRAKHLEFMTSIPERPAQLLLLQDSLLRLKDH
FT                   RQCFECSDVALNEAVQQMLNSSESAAKEEWVATVTQLLLGIEQALSSDSSGSILKESSS
FT                   TTGLVRLTNNLIQVIDCSMAVQEEPKEPYVSSVLPWIILHRIIWQEEDTFRSLCHQQQL
FT                   QNPTEEGIPEMPMLPSSLMLLNTAHEYLGRRSWCCNSDGALLRFYVQVLQKELAASASE
FT                   DTHPYKEELETALEQCFYCLYSFPSKKSKARYLEEHSAQQVDLIWEDALFMFEYFKPKT
FT                   LPEFDSYKTSTVSADLANLLKRIATIVPRTEKPALSMDKVSAYIEGTSAEAPCLPEGAD
FT                   PTPPVLNELYYLLADYHFKNKEQSKAIKFYMHDICICPNRFDSWAGMALARASRIQDKL
FT                   NSNELKSDGPIWKHATPVLNCFRRALEIDSSNLSLWIEYGTMSYALHSFASRQLKQWRS
FT                   ELPPELVQQMEDRRDSMLETARHCFTSAARCEGDGDEEEWLIHYMLGKVAEKQQQPPTV
FT                   YLLHYRQAGHYLHEEAARYPKKIHYHNPPELAMEALEVYFRLHASILKLLGKPDSGVGA
FT                   EVLVSFMKEAAEGPFARGEEKNTPKASEKEKACLVDEDSHSSAGTLPGPGASLPSSSGP
FT                   GLTSPPYTATPIDHDYVKCKKPHQQAAPDDRSQDSTAVALSDSSSTQDFFNEPTSLLEG
FT                   SRKLFPEKRLSGLSAQAGPSGKDLPGPTEERGKTEESLESTEAFRVVEQSVQKPVADSS
FT                   ASAYIPSKPPASTPPLWDGKKRGDSLGEPVAFPQGLPAGAEEQRQFLTEQCISSFCLCL
FT                   SRFPQHYKSLYRLAFLYTYSKTHRNLQWARDVLLGSSIPWQQLQHMPAQGLFCERNKTN
FT                   FFNGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHSTLLKVSSMLQRTPDQGKK
FT                   YLRDADRQVLAQRAFILTVKVLEDTLSELAEGSEHPGSKACGLSGARMTTDVSHKASPE
FT                   DGQESPQHPKKLPLADGSGPGPEPGGRMGPLNQLPVVTDIRDNTDQGGEQKDKESPQVG
FT                   PTEPMDTSEAAGRHSDLEQTSRLLPGRPPRDRGPESRSAELSLEELSISTRQQPAPLAP
FT                   SPAAPTTTAAPTTMAARGAGHSEEAPPRPNRKRKLLEDTESGKTLLLDAYRVWQQGQKG
FT                   MAYDLSRIEKIMSETYMLIKQVDEETALEQAVKFCQVHLGAATQRQASGDTPTTPKHPK
FT                   DSRENFFPATVVPTVPDPTAPDALQRPSDSHLKPVLATVITCPPSASASIPDLSTDPGI
FT                   PRPHRPETTPSRAPLSPEGEEASGVTEGTSILPQEPRYSHQIKMAATGHLAEQHCWPVE
FT                   VACQTGAEPTCSQASSTKVPSSGSTQTAESHQGKTESSRAKSRLLPNMPKLVIPSATTK
FT                   SPPEITVTPPTPTLLSPKGSISEETKQKLKSAILSAQSAANVRKESLCQPALEVLETSS
FT                   QESSLESETDEDDDFMDV"
FT   CDS             complement(join(16934723..16934866,16935054..16935280,
FT                   16936234..16936398,16941052..16941319,16943543..16943617,
FT                   16944952..16945629,16945973..16946069,16946811..16946974,
FT                   16956192..16956212))
FT                   /codon_start=1
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /product="calcineurin binding protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG117500.1 transcript_id=mCT175047.0
FT                   protein_id=mCP97967.0 isoform=CRA_b"
FT                   /protein_id="EDL31892.1"
FT                   /translation="MPPGRQRGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHS
FT                   TLLKVSSMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSEHPGSKAC
FT                   GLSGARMTTDVSHKASPEDGQESPQHPKKLPLADGSGPGPEPGGRMGPLNQLPVVTDIR
FT                   DNTDQGGEQKDKESPQVGPTEPMDTSEAAGRHSDLEQTSRLLPGRPPRDRGPESRSAEL
FT                   SLEELSISTRQQPAPLAPSPAAPTTTAAPTTMAARGAGHSEEAPPRPNRKRKLLEDTES
FT                   GKTLLLDAYRVWQQGQKGMAYDLSRIEKIMSETYMLIKQVDEETALEQAVKFCQVHLGA
FT                   ATQRQASGDTPTTPKHPKDSRENFFPATVVPTVPDPTAPDALQRPSDSHLKPVLATVIT
FT                   CPPSASASIPDLSTDPGIPRPHRPETTPSRAPLSPEGEEASGVTEGTSILPQEPRYSHQ
FT                   IKMAATGHLAEQHCWPVEVACQTGAEPTCSQASSTKVPSSGSTQTAESHQGKTESSRAK
FT                   SRLLPNMPKLVIPSATTKSPPEITVTPPTPTLLSPKGSISEETKQKLKSAILSAQSAAN
FT                   VRKESLCQPALEVLETSSQESSLESETDEDDDFMDV"
FT   CDS             complement(join(16934723..16934866,16935054..16935280,
FT                   16936234..16936398,16941052..16941319,16943543..16943617,
FT                   16944952..16945629,16945973..16946069,16946811..16946974,
FT                   16955719..16955721))
FT                   /codon_start=1
FT                   /gene="Cabin1"
FT                   /locus_tag="mCG_117500"
FT                   /product="calcineurin binding protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG117500.1 transcript_id=mCT175048.0
FT                   protein_id=mCP97966.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TDW4"
FT                   /db_xref="InterPro:IPR015134"
FT                   /db_xref="MGI:MGI:1298375"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDW4"
FT                   /protein_id="EDL31893.1"
FT                   /translation="MGIWRIPVDEIDRPGSFAWHMNRSIVLLLKVLAQLRDHSTLLKVS
FT                   SMLQRTPDQGKKYLRDADRQVLAQRAFILTVKVLEDTLSELAEGSEHPGSKACGLSGAR
FT                   MTTDVSHKASPEDGQESPQHPKKLPLADGSGPGPEPGGRMGPLNQLPVVTDIRDNTDQG
FT                   GEQKDKESPQVGPTEPMDTSEAAGRHSDLEQTSRLLPGRPPRDRGPESRSAELSLEELS
FT                   ISTRQQPAPLAPSPAAPTTTAAPTTMAARGAGHSEEAPPRPNRKRKLLEDTESGKTLLL
FT                   DAYRVWQQGQKGMAYDLSRIEKIMSETYMLIKQVDEETALEQAVKFCQVHLGAATQRQA
FT                   SGDTPTTPKHPKDSRENFFPATVVPTVPDPTAPDALQRPSDSHLKPVLATVITCPPSAS
FT                   ASIPDLSTDPGIPRPHRPETTPSRAPLSPEGEEASGVTEGTSILPQEPRYSHQIKMAAT
FT                   GHLAEQHCWPVEVACQTGAEPTCSQASSTKVPSSGSTQTAESHQGKTESSRAKSRLLPN
FT                   MPKLVIPSATTKSPPEITVTPPTPTLLSPKGSISEETKQKLKSAILSAQSAANVRKESL
FT                   CQPALEVLETSSQESSLESETDEDDDFMDV"
FT   gene            complement(17059493..17061659)
FT                   /gene="Ddt"
FT                   /locus_tag="mCG_6002"
FT                   /note="gene_id=mCG6002.2"
FT   mRNA            complement(join(17059493..17059773,17061005..17061180,
FT                   17061483..17061659))
FT                   /gene="Ddt"
FT                   /locus_tag="mCG_6002"
FT                   /product="D-dopachrome tautomerase"
FT                   /note="gene_id=mCG6002.2 transcript_id=mCT4637.1 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(17059701..17059773,17061005..17061180,
FT                   17061483..17061590))
FT                   /codon_start=1
FT                   /gene="Ddt"
FT                   /locus_tag="mCG_6002"
FT                   /product="D-dopachrome tautomerase"
FT                   /note="gene_id=mCG6002.2 transcript_id=mCT4637.1
FT                   protein_id=mCP9275.1"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR019829"
FT                   /db_xref="MGI:MGI:1298381"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UNI8"
FT                   /protein_id="EDL31890.1"
FT                   /translation="MPFVELETNLPASRIPAGLENRLCAATATILDKPEDRVSVTIRPG
FT                   MTLLMNKSTEPCAHLLVSSIGVVGTAEQNRTHSASFFKFLTEELSLDQDRIVIRFFPLE
FT                   AWQIGKKGTVMTFL"
FT   gene            complement(17062390..17069681)
FT                   /gene="Gstt3"
FT                   /locus_tag="mCG_5986"
FT                   /note="gene_id=mCG5986.2"
FT   mRNA            complement(join(17062390..17063277,17064138..17064314,
FT                   17065011..17065161,17066368..17066455,17069110..17069681))
FT                   /gene="Gstt3"
FT                   /locus_tag="mCG_5986"
FT                   /product="glutathione S-transferase, theta 3"
FT                   /note="gene_id=mCG5986.2 transcript_id=mCT4651.2 created on
FT                   30-OCT-2002"
FT   CDS             complement(join(17063080..17063277,17064138..17064314,
FT                   17065011..17065161,17066368..17066455,17069110..17069221))
FT                   /codon_start=1
FT                   /gene="Gstt3"
FT                   /locus_tag="mCG_5986"
FT                   /product="glutathione S-transferase, theta 3"
FT                   /note="gene_id=mCG5986.2 transcript_id=mCT4651.2
FT                   protein_id=mCP9264.1"
FT                   /db_xref="GOA:Q99L20"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:2143526"
FT                   /db_xref="UniProtKB/TrEMBL:Q99L20"
FT                   /protein_id="EDL31889.1"
FT                   /translation="MGLELYLDLMSQPCRAVYIFAKKNGIPFQLRTIELLKGQQYTDSF
FT                   AQVNPLRKVPALKDGDFVLAESVAILLYLSRKYKAPDHWYPQDLQTRARVDEYLAWQHT
FT                   ALRSCCTRAMWQKMMFPVFLGQPVPPEMLASTLAELDGCLQVLEDKFLRNQAFLTGSHI
FT                   SVADLVAITELMHPVSAGCKIFESRPKLAAWRQRVEAEVGESLFQEAHEVVLKAKDMPP
FT                   LMDPALKEKLKLSVQCLLH"
FT   gene            complement(17072065..17086850)
FT                   /gene="Gstt1"
FT                   /locus_tag="mCG_141183"
FT                   /note="gene_id=mCG141183.0"
FT   mRNA            complement(join(17072065..17072486,17075048..17075224,
FT                   17082342..17082492,17085308..17085395,17086651..17086850))
FT                   /gene="Gstt1"
FT                   /locus_tag="mCG_141183"
FT                   /product="glutathione S-transferase, theta 1, transcript
FT                   variant mCT173607"
FT                   /note="gene_id=mCG141183.0 transcript_id=mCT173607.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(17072065..17072486,17075048..17075224,
FT                   17082342..17082492,17085308..17085395,17085946..17085997))
FT                   /gene="Gstt1"
FT                   /locus_tag="mCG_141183"
FT                   /product="glutathione S-transferase, theta 1, transcript
FT                   variant mCT173609"
FT                   /note="gene_id=mCG141183.0 transcript_id=mCT173609.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(17072065..17072486,17075048..17075224,
FT                   17082342..17082492,17085308..17085598))
FT                   /gene="Gstt1"
FT                   /locus_tag="mCG_141183"
FT                   /product="glutathione S-transferase, theta 1, transcript
FT                   variant mCT173608"
FT                   /note="gene_id=mCG141183.0 transcript_id=mCT173608.0
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(17072292..17072486,17075048..17075224,
FT                   17082342..17082492,17085308..17085395,17086651..17086762))
FT                   /codon_start=1
FT                   /gene="Gstt1"
FT                   /locus_tag="mCG_141183"
FT                   /product="glutathione S-transferase, theta 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG141183.0 transcript_id=mCT173607.0
FT                   protein_id=mCP96526.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q64471"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:107379"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64471"
FT                   /protein_id="EDL31888.1"
FT                   /translation="MVLELYLDLLSQPCRAIYIFAKKNNIPFQMHTVELRKGEHLSDAF
FT                   ARVNPMKRVPAMMDGGFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHT
FT                   GLRRSCLRALWHKVMFPVFLGEQIPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHI
FT                   SLADLVAITELMHPVGGGCPVFEGHPRLAAWYQRVEAAVGKDLFREAHEVILKVKDCPP
FT                   ADLIIKQKLMPRVLAMIQ"
FT   CDS             complement(join(17072292..17072486,17075048..17075224,
FT                   17082342..17082492,17085308..17085483))
FT                   /codon_start=1
FT                   /gene="Gstt1"
FT                   /locus_tag="mCG_141183"
FT                   /product="glutathione S-transferase, theta 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG141183.0 transcript_id=mCT173608.0
FT                   protein_id=mCP96527.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3Z3X5"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:107379"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z3X5"
FT                   /protein_id="EDL31886.1"
FT                   /translation="MNLVFSLLGPWPRLSETPSVLLPHAGLSAGEHLSDAFARVNPMKR
FT                   VPAMMDGGFTLCESVAILLYLAHKYKVPDHWYPQDLQARARVDEYLAWQHTGLRRSCLR
FT                   ALWHKVMFPVFLGEQIPPETLAATLAELDVNLQVLEDKFLQDKDFLVGPHISLADLVAI
FT                   TELMHPVGGGCPVFEGHPRLAAWYQRVEAAVGKDLFREAHEVILKVKDCPPADLIIKQK
FT                   LMPRVLAMIQ"
FT   CDS             complement(join(17072292..17072486,17075048..17075224,
FT                   17082342..17082492,17085308..17085357))
FT                   /codon_start=1
FT                   /gene="Gstt1"
FT                   /locus_tag="mCG_141183"
FT                   /product="glutathione S-transferase, theta 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG141183.0 transcript_id=mCT173609.0
FT                   protein_id=mCP96528.0 isoform=CRA_b"
FT                   /protein_id="EDL31887.1"
FT                   /translation="MKRVPAMMDGGFTLCESVAILLYLAHKYKVPDHWYPQDLQARARV
FT                   DEYLAWQHTGLRRSCLRALWHKVMFPVFLGEQIPPETLAATLAELDVNLQVLEDKFLQD
FT                   KDFLVGPHISLADLVAITELMHPVGGGCPVFEGHPRLAAWYQRVEAAVGKDLFREAHEV
FT                   ILKVKDCPPADLIIKQKLMPRVLAMIQ"
FT   gene            complement(17103123..>17110689)
FT                   /gene="4930583C14Rik"
FT                   /locus_tag="mCG_3120"
FT                   /note="gene_id=mCG3120.3"
FT   mRNA            complement(join(17103123..17103419,17105361..17105537,
FT                   17106662..17106812,17109393..17109480,17110474..17110688))
FT                   /gene="4930583C14Rik"
FT                   /locus_tag="mCG_3120"
FT                   /product="RIKEN cDNA 4930583C14, transcript variant
FT                   mCT1734"
FT                   /note="gene_id=mCG3120.3 transcript_id=mCT1734.2 created on
FT                   30-OCT-2002"
FT   mRNA            complement(join(17103123..17103419,17105361..17105537,
FT                   17106662..17106812,17109393..17109505,17110474..17110688))
FT                   /gene="4930583C14Rik"
FT                   /locus_tag="mCG_3120"
FT                   /product="RIKEN cDNA 4930583C14, transcript variant
FT                   mCT175053"
FT                   /note="gene_id=mCG3120.3 transcript_id=mCT175053.0 created
FT                   on 30-OCT-2002"
FT   mRNA            complement(join(17103129..17103387,17105361..17105537,
FT                   17106662..17106812,17109393..17109505,17110474..>17110689))
FT                   /gene="4930583C14Rik"
FT                   /locus_tag="mCG_3120"
FT                   /product="RIKEN cDNA 4930583C14, transcript variant
FT                   mCT192942"
FT                   /note="gene_id=mCG3120.3 transcript_id=mCT192942.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(17103225..17103419,17105361..17105537,
FT                   17106662..17106812,17109393..17109480,17110474..17110585))
FT                   /codon_start=1
FT                   /gene="4930583C14Rik"
FT                   /locus_tag="mCG_3120"
FT                   /product="RIKEN cDNA 4930583C14, isoform CRA_b"
FT                   /note="gene_id=mCG3120.3 transcript_id=mCT1734.2
FT                   protein_id=mCP9259.2 isoform=CRA_b"
FT                   /protein_id="EDL31884.1"
FT                   /translation="MGLELYMDLLSAPCRAVYIFARKNGIPFDFQFVDLLKGHHHSKEY
FT                   IEINPLRKLPSLKDGKFILSESVAILFYLCRKYSAPSHWYPPDLHMRARVDEFMAWQHT
FT                   AIQVPMSKILWIKLIIPMITGEEVPTERLEKTLDEVKRNLQQFEEKFLQDKMFITGDHI
FT                   SLADLVALVEMMQPMGSNHNVFVSSKLAEWRMRVELAIGSGLFWEAHERLVKLPNWDCS
FT                   TLDPTIKMRICDFLQKFK"
FT   CDS             complement(join(17103225..17103419,17105361..17105537,
FT                   17106662..17106742))
FT                   /codon_start=1
FT                   /gene="4930583C14Rik"
FT                   /locus_tag="mCG_3120"
FT                   /product="RIKEN cDNA 4930583C14, isoform CRA_c"
FT                   /note="gene_id=mCG3120.3 transcript_id=mCT175053.0
FT                   protein_id=mCP97972.0 isoform=CRA_c"
FT                   /protein_id="EDL31885.1"
FT                   /translation="MRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTERLEK
FT                   TLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVALVEMMQPMGSNHNVFVSSKLAEWR
FT                   MRVELAIGSGLFWEAHERLVKLPNWDCSTLDPTIKMRICDFLQKFK"
FT   CDS             complement(join(17103382..17103387,17105361..17105537,
FT                   17106662..17106812,17109393..17109505,17110474..>17110476))
FT                   /codon_start=1
FT                   /gene="4930583C14Rik"
FT                   /locus_tag="mCG_3120"
FT                   /product="RIKEN cDNA 4930583C14, isoform CRA_a"
FT                   /note="gene_id=mCG3120.3 transcript_id=mCT192942.0
FT                   protein_id=mCP113921.0 isoform=CRA_a"
FT                   /protein_id="EDL31883.1"
FT                   /translation="KPQTLPAHSGHHHSKEYIEINPLRKLPSLKDGKFILSESVAILFY
FT                   LCRKYSAPSHWYPPDLHMRARVDEFMAWQHTAIQVPMSKILWIKLIIPMITGEEVPTER
FT                   LEKTLDEVKRNLQQFEEKFLQDKMFITGDHISLADLVALVEMMQL"
FT   gene            complement(17120008..17122749)
FT                   /gene="Gstt2"
FT                   /locus_tag="mCG_3100"
FT                   /note="gene_id=mCG3100.1"
FT   mRNA            complement(join(17120008..17120257,17120558..17120731,
FT                   17122338..17122749))
FT                   /gene="Gstt2"
FT                   /locus_tag="mCG_3100"
FT                   /product="glutathione S-transferase, theta 2, transcript
FT                   variant mCT173621"
FT                   /note="gene_id=mCG3100.1 transcript_id=mCT173621.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(17120008..17120257,17120558..17120731,
FT                   17120824..17120974,17121815..17121902,17122338..17122749))
FT                   /gene="Gstt2"
FT                   /locus_tag="mCG_3100"
FT                   /product="glutathione S-transferase, theta 2, transcript
FT                   variant mCT1756"
FT                   /note="gene_id=mCG3100.1 transcript_id=mCT1756.1 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(17120048..17120257,17120558..17120731,
FT                   17120824..17120974,17121815..17121902,17122338..17122449))
FT                   /codon_start=1
FT                   /gene="Gstt2"
FT                   /locus_tag="mCG_3100"
FT                   /product="glutathione S-transferase, theta 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3100.1 transcript_id=mCT1756.1
FT                   protein_id=mCP9285.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q61133"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="MGI:MGI:106188"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61133"
FT                   /protein_id="EDL31881.1"
FT                   /translation="MGLELYLDLLSQPSRAVYIFAKKNGIPFQTRTVDILKGQHMSEQF
FT                   SQVNCLNKVPVLKDGSFVLTESTAILIYLSSKYQVADHWYPADLQARAQVHEYLGWHAD
FT                   NIRGTFGVLLWTKVLGPLIGVQVPQEKVERNRDRMVLVLQQLEDKFLRDRAFLVGQQVT
FT                   LADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQEAHSTILSILGQAAK
FT                   KMLPVPPPEVHASMQLRIARIP"
FT   CDS             complement(join(17120048..17120257,17120558..17120731,
FT                   17122338..17122379))
FT                   /codon_start=1
FT                   /gene="Gstt2"
FT                   /locus_tag="mCG_3100"
FT                   /product="glutathione S-transferase, theta 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3100.1 transcript_id=mCT173621.0
FT                   protein_id=mCP96540.0 isoform=CRA_b"
FT                   /protein_id="EDL31882.1"
FT                   /translation="MASPSRRVPWIYSKVLGPLIGVQVPQEKVERNRDRMVLVLQQLED
FT                   KFLRDRAFLVGQQVTLADLMSLEELMQPVALGYNLFEGRPQLTAWRERVEAFLGAELCQ
FT                   EAHSTILSILGQAAKKMLPVPPPEVHASMQLRIARIP"
FT   gene            complement(17147530..17148462)
FT                   /locus_tag="mCG_3124"
FT                   /note="gene_id=mCG3124.2"
FT   mRNA            complement(join(17147530..17147719,17147863..17147952,
FT                   17148237..17148257,17148351..17148462))
FT                   /locus_tag="mCG_3124"
FT                   /product="mCG3124, transcript variant mCT173633"
FT                   /note="gene_id=mCG3124.2 transcript_id=mCT173633.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(17147530..17147719,17147863..17147976,
FT                   17148279..17148462))
FT                   /locus_tag="mCG_3124"
FT                   /product="mCG3124, transcript variant mCT173632"
FT                   /note="gene_id=mCG3124.2 transcript_id=mCT173632.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(17147530..17147719,17147863..17148035,
FT                   17148237..17148462))
FT                   /locus_tag="mCG_3124"
FT                   /product="mCG3124, transcript variant mCT1730"
FT                   /note="gene_id=mCG3124.2 transcript_id=mCT1730.2 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(17147653..17147719,17147863..17148035,
FT                   17148237..17148344))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3124"
FT                   /product="mCG3124, isoform CRA_b"
FT                   /note="gene_id=mCG3124.2 transcript_id=mCT1730.2
FT                   protein_id=mCP9283.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q545F0"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR019829"
FT                   /db_xref="MGI:MGI:96982"
FT                   /db_xref="UniProtKB/TrEMBL:Q545F0"
FT                   /protein_id="EDL31879.1"
FT                   /translation="MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPD
FT                   QLMTFSGTNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNA
FT                   ANVGWNGSTFA"
FT   CDS             complement(join(17147653..17147719,17147863..17147976,
FT                   17148279..17148319))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3124"
FT                   /product="mCG3124, isoform CRA_c"
FT                   /note="gene_id=mCG3124.2 transcript_id=mCT173632.0
FT                   protein_id=mCP96552.0 isoform=CRA_c"
FT                   /protein_id="EDL31880.1"
FT                   /translation="MFPAPPCQRGFCRSCALCSLHSIGKIGGAQNRNYSKLLCGLLSDR
FT                   LHISPDRVYINYYDMNAANVGWNGSTFA"
FT   CDS             complement(17147653..17147697)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3124"
FT                   /product="mCG3124, isoform CRA_a"
FT                   /note="gene_id=mCG3124.2 transcript_id=mCT173633.0
FT                   protein_id=mCP96551.0 isoform=CRA_a"
FT                   /protein_id="EDL31878.1"
FT                   /translation="MNAANVGWNGSTFA"
FT   gene            17181573..17184120
FT                   /gene="Derl3"
FT                   /locus_tag="mCG_3103"
FT                   /note="gene_id=mCG3103.2"
FT   mRNA            join(17181573..17181692,17181794..17181859,
FT                   17181945..17182018,17182142..17182235,17182607..17182802,
FT                   17183214..17183304,17183422..17184120)
FT                   /gene="Derl3"
FT                   /locus_tag="mCG_3103"
FT                   /product="Der1-like domain family, member 3, transcript
FT                   variant mCT1758"
FT                   /note="gene_id=mCG3103.2 transcript_id=mCT1758.2 created on
FT                   23-SEP-2002"
FT   mRNA            join(17181573..17181692,17181794..17181859,
FT                   17181945..17182018,17182142..17182235,17182730..17182802,
FT                   17183214..17183304,17183422..17184120)
FT                   /gene="Derl3"
FT                   /locus_tag="mCG_3103"
FT                   /product="Der1-like domain family, member 3, transcript
FT                   variant mCT173624"
FT                   /note="gene_id=mCG3103.2 transcript_id=mCT173624.0 created
FT                   on 23-SEP-2002"
FT   mRNA            join(17181573..17181692,17181794..17181859,
FT                   17181945..17182018,17182607..17182802,17183214..17183304,
FT                   17183422..17184120)
FT                   /gene="Derl3"
FT                   /locus_tag="mCG_3103"
FT                   /product="Der1-like domain family, member 3, transcript
FT                   variant mCT173623"
FT                   /note="gene_id=mCG3103.2 transcript_id=mCT173623.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(17181600..17181692,17181794..17181859,
FT                   17181945..17182018,17182142..17182235,17182607..17182802,
FT                   17183214..17183304,17183422..17183494)
FT                   /codon_start=1
FT                   /gene="Derl3"
FT                   /locus_tag="mCG_3103"
FT                   /product="Der1-like domain family, member 3, isoform CRA_c"
FT                   /note="gene_id=mCG3103.2 transcript_id=mCT1758.2
FT                   protein_id=mCP9309.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q14C34"
FT                   /db_xref="InterPro:IPR007599"
FT                   /db_xref="MGI:MGI:1917627"
FT                   /db_xref="UniProtKB/TrEMBL:Q14C34"
FT                   /protein_id="EDL31877.1"
FT                   /translation="MAGQRLAAGFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNP
FT                   HLVFRKFQVWRLITTFLFFGPLGFGFFFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFG
FT                   GVLMTLLGFLGSLFFLGQALMAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSL
FT                   LLGNSVVTDLLGILVGHIYYFLEDVFPNQPGGKRLLLTPSVLKLLLDDPQEDPDYLPLP
FT                   EEQPEL"
FT   CDS             join(17181600..17181692,17181794..17181859,
FT                   17181945..17182018,17182142..17182235,17182730..17182802,
FT                   17183214..17183304,17183422..17183494)
FT                   /codon_start=1
FT                   /gene="Derl3"
FT                   /locus_tag="mCG_3103"
FT                   /product="Der1-like domain family, member 3, isoform CRA_b"
FT                   /note="gene_id=mCG3103.2 transcript_id=mCT173624.0
FT                   protein_id=mCP96542.0 isoform=CRA_b"
FT                   /protein_id="EDL31876.1"
FT                   /translation="MAGQRLAAGFLQVPAVTRAYTAACVLTTAAVQLELLSPFQLYFNP
FT                   HLVFRKFQVWRLITTFLFFGPLGFGFFFNMLFVFRYCRMLEEGSFRGRKADFVFMFLFG
FT                   GVLMTAPFLPWALMGFSLLLGNSVVTDLLGILVGHIYYFLEDVFPNQPGGKRLLLTPSV
FT                   LKLLLDDPQEDPDYLPLPEEQPEL"
FT   CDS             join(17182652..17182802,17183214..17183304,
FT                   17183422..17183494)
FT                   /codon_start=1
FT                   /gene="Derl3"
FT                   /locus_tag="mCG_3103"
FT                   /product="Der1-like domain family, member 3, isoform CRA_a"
FT                   /note="gene_id=mCG3103.2 transcript_id=mCT173623.0
FT                   protein_id=mCP96543.0 isoform=CRA_a"
FT                   /protein_id="EDL31875.1"
FT                   /translation="MAMLVYVWSRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSV
FT                   VTDLLGILVGHIYYFLEDVFPNQPGGKRLLLTPSVLKLLLDDPQEDPDYLPLPEEQPEL
FT                   "
FT   gene            complement(17184944..17209760)
FT                   /gene="Smarcb1"
FT                   /locus_tag="mCG_3118"
FT                   /note="gene_id=mCG3118.2"
FT   mRNA            complement(join(17184944..17185263,17185620..17185751,
FT                   17192559..17192749,17194205..17194371,17198329..17198456,
FT                   17199694..17199831,17209474..17209760))
FT                   /gene="Smarcb1"
FT                   /locus_tag="mCG_3118"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily b, member 1,
FT                   transcript variant mCT173630"
FT                   /note="gene_id=mCG3118.2 transcript_id=mCT173630.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(17184950..17185263,17185620..17185751,
FT                   17192559..17192749,17194205..17194371,17198329..17198456,
FT                   17199694..17199831,17203235..17203364,17204971..17205082,
FT                   17209474..17209759))
FT                   /gene="Smarcb1"
FT                   /locus_tag="mCG_3118"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily b, member 1,
FT                   transcript variant mCT173631"
FT                   /note="gene_id=mCG3118.2 transcript_id=mCT173631.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(17184950..17185263,17185620..17185751,
FT                   17192559..17192749,17194205..17194371,17198329..17198456,
FT                   17199694..17199831,17203235..17203364,17204944..17205082,
FT                   17209474..17209759))
FT                   /gene="Smarcb1"
FT                   /locus_tag="mCG_3118"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily b, member 1,
FT                   transcript variant mCT1733"
FT                   /note="gene_id=mCG3118.2 transcript_id=mCT1733.0 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(17185224..17185263,17185620..17185751,
FT                   17192559..17192749,17194205..17194371,17198329..17198456,
FT                   17199694..17199831,17203235..17203364,17204971..17205082,
FT                   17209474..17209566))
FT                   /codon_start=1
FT                   /gene="Smarcb1"
FT                   /locus_tag="mCG_3118"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily b, member 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3118.2 transcript_id=mCT173631.0
FT                   protein_id=mCP96549.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UDA4"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR017393"
FT                   /db_xref="MGI:MGI:1328366"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UDA4"
FT                   /protein_id="EDL31873.1"
FT                   /translation="MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYK
FT                   RYPSLWRRLATVEERKKIVASSHDHGYTTLATSVTLLKASEVEEILDGNDEKYKAVSIS
FT                   TEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRTFPLCFDDHD
FT                   PAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPL
FT                   TFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEKENSP
FT                   EKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQW
FT                   CPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW"
FT   CDS             complement(join(17185224..17185263,17185620..17185751,
FT                   17192559..17192749,17194205..17194371,17198329..17198456,
FT                   17199694..17199831,17203235..17203364,17204944..17205082,
FT                   17209474..17209566))
FT                   /codon_start=1
FT                   /gene="Smarcb1"
FT                   /locus_tag="mCG_3118"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily b, member 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3118.2 transcript_id=mCT1733.0
FT                   protein_id=mCP9246.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q6ZWP4"
FT                   /db_xref="InterPro:IPR006939"
FT                   /db_xref="InterPro:IPR017393"
FT                   /db_xref="MGI:MGI:1328366"
FT                   /db_xref="UniProtKB/TrEMBL:Q6ZWP4"
FT                   /protein_id="EDL31872.1"
FT                   /translation="MMMMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYK
FT                   RYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVTLLKASEVEEILDGND
FT                   EKYKAVSISTEPPTYLREQKAKRNSQWVPTLPNSSHHLDAVPCSTTINRNRMGRDKKRT
FT                   FPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEIL
FT                   CDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEW
FT                   DMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAI
FT                   RNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAPAW"
FT   CDS             complement(join(17185224..17185263,17185620..17185751,
FT                   17192559..17192749,17194205..17194371,17198329..17198456,
FT                   17199694..17199728))
FT                   /codon_start=1
FT                   /gene="Smarcb1"
FT                   /locus_tag="mCG_3118"
FT                   /product="SWI/SNF related, matrix associated, actin
FT                   dependent regulator of chromatin, subfamily b, member 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG3118.2 transcript_id=mCT173630.0
FT                   protein_id=mCP96550.0 isoform=CRA_c"
FT                   /protein_id="EDL31874.1"
FT                   /translation="MGRDKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKL
FT                   RDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSD
FT                   QRVIIKLNIHVGNISLVDQFEWDMSEKENSPEKFALKLCSELGLGGEFVTTIAYSIRGQ
FT                   LSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRR
FT                   LANTAPAW"
FT   gene            complement(17211395..17220634)
FT                   /gene="Mmp11"
FT                   /locus_tag="mCG_3111"
FT                   /note="gene_id=mCG3111.1"
FT   mRNA            complement(join(17211395..17211661,17212234..17212286,
FT                   17213591..17213848,17214582..17214798,17214919..17215160,
FT                   17215300..17215433,17215518..17215661,17216451..17216680,
FT                   17220505..17220634))
FT                   /gene="Mmp11"
FT                   /locus_tag="mCG_3111"
FT                   /product="matrix metallopeptidase 11, transcript variant
FT                   mCT173629"
FT                   /note="gene_id=mCG3111.1 transcript_id=mCT173629.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(17211395..17211661,17212130..17212286,
FT                   17213591..17213848,17214582..17214798,17214919..17215160,
FT                   17215300..17215433,17215518..17215661,17216451..17216680,
FT                   17220505..17220634))
FT                   /gene="Mmp11"
FT                   /locus_tag="mCG_3111"
FT                   /product="matrix metallopeptidase 11, transcript variant
FT                   mCT173628"
FT                   /note="gene_id=mCG3111.1 transcript_id=mCT173628.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(17211395..17212286,17213591..17213848,
FT                   17214582..17214798,17214919..17215160,17215300..17215433,
FT                   17215518..17215661,17216451..17216680,17220505..17220634))
FT                   /gene="Mmp11"
FT                   /locus_tag="mCG_3111"
FT                   /product="matrix metallopeptidase 11, transcript variant
FT                   mCT1744"
FT                   /note="gene_id=mCG3111.1 transcript_id=mCT1744.0 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(17211509..17211661,17212234..17212286,
FT                   17213591..17213848,17214582..17214798,17214919..17215160,
FT                   17215300..17215433,17215518..17215661,17216451..17216680,
FT                   17220505..17220624))
FT                   /codon_start=1
FT                   /gene="Mmp11"
FT                   /locus_tag="mCG_3111"
FT                   /product="matrix metallopeptidase 11, isoform CRA_b"
FT                   /note="gene_id=mCG3111.1 transcript_id=mCT173629.0
FT                   protein_id=mCP96547.0 isoform=CRA_b"
FT                   /protein_id="EDL31871.1"
FT                   /translation="MARAACLLRAISRVLLLPLPLLLLLLLLLPSPLMARARPPESHRH
FT                   HPVKKGPRLLHAALPNTLTSVPASHWVPSPAGSSRPLRCGVPDLPDVLNARNRQKRFVL
FT                   SGGRWEKTDLTYRILRFPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDF
FT                   ARYWHGDNLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDNQGTDLLQVAAHEFG
FT                   HVLGLQHTTAAKALMSPFYTFRYPLSLSPDDRRGIQHLYGRPQMAPTSPAPTLSSQAGT
FT                   DTNEIALLEPETPPDVCETSFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHW
FT                   QGLPSPVDAAFEDAQGQIWFFQGAQYWVYDGEKPVLGPAPLSKLGLQGSPVHAALVWGP
FT                   EKNKIYFFRGGDYWRFHPRTQRVDNPVPRRSTDWRGVPSEIDAAFQDAEGYAYFLRGHL
FT                   YWKFDPVKVIQTSASWNSGQKVHSQPRRQLLPPRDTEPQRPHIPHSLAPGHFFLGPSS"
FT   CDS             complement(join(17212153..17212286,17213591..17213848,
FT                   17214582..17214798,17214919..17215160,17215300..17215433,
FT                   17215518..17215661,17216451..17216680,17220505..17220624))
FT                   /codon_start=1
FT                   /gene="Mmp11"
FT                   /locus_tag="mCG_3111"
FT                   /product="matrix metallopeptidase 11, isoform CRA_a"
FT                   /note="gene_id=mCG3111.1 transcript_id=mCT173628.0
FT                   protein_id=mCP96548.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UQT3"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR016293"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028705"
FT                   /db_xref="MGI:MGI:97008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UQT3"
FT                   /protein_id="EDL31869.1"
FT                   /translation="MARAACLLRAISRVLLLPLPLLLLLLLLLPSPLMARARPPESHRH
FT                   HPVKKGPRLLHAALPNTLTSVPASHWVPSPAGSSRPLRCGVPDLPDVLNARNRQKRFVL
FT                   SGGRWEKTDLTYRILRFPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDF
FT                   ARYWHGDNLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDNQGTDLLQVAAHEFG
FT                   HVLGLQHTTAAKALMSPFYTFRYPLSLSPDDRRGIQHLYGRPQMAPTSPAPTLSSQAGT
FT                   DTNEIALLEPETPPDVCETSFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHW
FT                   QGLPSPVDAAFEDAQGQIWFFQGAQYWVYDGEKPVLGPAPLSKLGLQGSPVHAALVWGP
FT                   EKNKIYFFRGGDYWRFHPRTQRVDNPVPRRSTDWRGVPSEIDAAFQDAEGYAYFLRGHL
FT                   YWKFDPVKVKVLEGFPRPVGPDFFDCAEPANTFR"
FT   CDS             complement(join(17212153..17212286,17213591..17213848,
FT                   17214582..17214798,17214919..17215160,17215300..17215433,
FT                   17215518..17215661,17216451..17216680,17220505..17220624))
FT                   /codon_start=1
FT                   /gene="Mmp11"
FT                   /locus_tag="mCG_3111"
FT                   /product="matrix metallopeptidase 11, isoform CRA_a"
FT                   /note="gene_id=mCG3111.1 transcript_id=mCT1744.0
FT                   protein_id=mCP9234.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UQT3"
FT                   /db_xref="InterPro:IPR000585"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR016293"
FT                   /db_xref="InterPro:IPR018486"
FT                   /db_xref="InterPro:IPR018487"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR028705"
FT                   /db_xref="MGI:MGI:97008"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UQT3"
FT                   /protein_id="EDL31870.1"
FT                   /translation="MARAACLLRAISRVLLLPLPLLLLLLLLLPSPLMARARPPESHRH
FT                   HPVKKGPRLLHAALPNTLTSVPASHWVPSPAGSSRPLRCGVPDLPDVLNARNRQKRFVL
FT                   SGGRWEKTDLTYRILRFPWQLVREQVRQTVAEALQVWSEVTPLTFTEVHEGRADIMIDF
FT                   ARYWHGDNLPFDGPGGILAHAFFPKTHREGDVHFDYDETWTIGDNQGTDLLQVAAHEFG
FT                   HVLGLQHTTAAKALMSPFYTFRYPLSLSPDDRRGIQHLYGRPQMAPTSPAPTLSSQAGT
FT                   DTNEIALLEPETPPDVCETSFDAVSTIRGELFFFKAGFVWRLRSGRLQPGYPALASRHW
FT                   QGLPSPVDAAFEDAQGQIWFFQGAQYWVYDGEKPVLGPAPLSKLGLQGSPVHAALVWGP
FT                   EKNKIYFFRGGDYWRFHPRTQRVDNPVPRRSTDWRGVPSEIDAAFQDAEGYAYFLRGHL
FT                   YWKFDPVKVKVLEGFPRPVGPDFFDCAEPANTFR"
FT   gene            17221136..17225923
FT                   /gene="Ndg2"
FT                   /locus_tag="mCG_3110"
FT                   /note="gene_id=mCG3110.2"
FT   mRNA            join(17221136..17221669,17223586..17224175,
FT                   17224409..17224616,17225478..17225625,17225746..17225923)
FT                   /gene="Ndg2"
FT                   /locus_tag="mCG_3110"
FT                   /product="Nur77 downstream gene 2"
FT                   /note="gene_id=mCG3110.2 transcript_id=mCT1743.2 created on
FT                   30-OCT-2002"
FT   CDS             join(17224135..17224175,17224409..17224616,
FT                   17225478..17225625,17225746..17225765)
FT                   /codon_start=1
FT                   /gene="Ndg2"
FT                   /locus_tag="mCG_3110"
FT                   /product="Nur77 downstream gene 2"
FT                   /note="gene_id=mCG3110.2 transcript_id=mCT1743.2
FT                   protein_id=mCP9297.2"
FT                   /db_xref="GOA:Q7TNL9"
FT                   /db_xref="InterPro:IPR010625"
FT                   /db_xref="MGI:MGI:2143558"
FT                   /db_xref="UniProtKB/TrEMBL:Q7TNL9"
FT                   /protein_id="EDL31868.1"
FT                   /translation="MPRGSRSAAARPVSRPAPPPAHPPPSAAAPAPAAPGQPGLMAQMA
FT                   STAAGVAVGSAVGHVMGSALTSAFSGGNSEPAQPAVQQAPARPASHPLQMGPCSYEIKQ
FT                   FLDCSTTQSDLTLCEGFSEALKQCKYNHGLSSLP"
FT   gene            complement(17233445..17233890)
FT                   /pseudo
FT                   /locus_tag="mCG_50695"
FT                   /note="gene_id=mCG50695.1"
FT   mRNA            complement(17233445..17233890)
FT                   /pseudo
FT                   /locus_tag="mCG_50695"
FT                   /note="gene_id=mCG50695.1 transcript_id=mCT50878.1 created
FT                   on 30-OCT-2002"
FT   gene            17236476..17237811
FT                   /gene="Vpreb3"
FT                   /locus_tag="mCG_3108"
FT                   /note="gene_id=mCG3108.1"
FT   mRNA            join(17236476..17236574,17237308..17237811)
FT                   /gene="Vpreb3"
FT                   /locus_tag="mCG_3108"
FT                   /product="pre-B lymphocyte gene 3, transcript variant
FT                   mCT1750"
FT                   /note="gene_id=mCG3108.1 transcript_id=mCT1750.1 created on
FT                   23-SEP-2002"
FT   mRNA            join(17236476..17236574,17237347..17237806)
FT                   /gene="Vpreb3"
FT                   /locus_tag="mCG_3108"
FT                   /product="pre-B lymphocyte gene 3, transcript variant
FT                   mCT173627"
FT                   /note="gene_id=mCG3108.1 transcript_id=mCT173627.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(17236523..17236574,17237308..17237627)
FT                   /codon_start=1
FT                   /gene="Vpreb3"
FT                   /locus_tag="mCG_3108"
FT                   /product="pre-B lymphocyte gene 3, isoform CRA_b"
FT                   /note="gene_id=mCG3108.1 transcript_id=mCT1750.1
FT                   protein_id=mCP9311.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q61243"
FT                   /db_xref="InterPro:IPR003596"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:98938"
FT                   /db_xref="UniProtKB/TrEMBL:Q61243"
FT                   /protein_id="EDL31867.1"
FT                   /translation="MACPGCLPLLLIGTFVAVFQPTLTQPDAFSVFPGQDAHLSCTINS
FT                   QHATAGDIGVSWYQQQPGSAPHLLYYYAEEEHYRPADIPDRFSATVDAAHNACILTISP
FT                   VLPEDDADYFCSIAHTFEP"
FT   CDS             join(17236523..17236574,17237347..17237627)
FT                   /codon_start=1
FT                   /gene="Vpreb3"
FT                   /locus_tag="mCG_3108"
FT                   /product="pre-B lymphocyte gene 3, isoform CRA_a"
FT                   /note="gene_id=mCG3108.1 transcript_id=mCT173627.0
FT                   protein_id=mCP96546.0 isoform=CRA_a"
FT                   /protein_id="EDL31866.1"
FT                   /translation="MACPGCLPLLLIGTFVAVFPGQDAHLSCTINSQHATAGDIGVSWY
FT                   QQQPGSAPHLLYYYAEEEHYRPADIPDRFSATVDAAHNACILTISPVLPEDDADYFCSI
FT                   AHTFEP"
FT   gene            17242681..>17293742
FT                   /gene="LOC333669"
FT                   /locus_tag="mCG_141379"
FT                   /note="gene_id=mCG141379.0"
FT   mRNA            join(17242681..17242865,17252581..17252685,
FT                   17254516..17254575,17262346..17262450,17264477..17264582,
FT                   17266474..17266554,17273340..17273560,17279815..17279950,
FT                   17281245..17281352,17283200..17283350,17287809..17287977,
FT                   17292115..17292330,17293410..>17293742)
FT                   /gene="LOC333669"
FT                   /locus_tag="mCG_141379"
FT                   /product="hypothetical protein LOC333669"
FT                   /note="gene_id=mCG141379.0 transcript_id=mCT175052.0
FT                   created on 08-JAN-2003"
FT   CDS             join(17242737..17242865,17252581..17252685,
FT                   17254516..17254575,17262346..17262450,17264477..17264582,
FT                   17266474..17266554,17273340..17273560,17279815..17279950,
FT                   17281245..17281352,17283200..17283350,17287809..17287977,
FT                   17292115..17292330,17293410..17293742)
FT                   /codon_start=1
FT                   /gene="LOC333669"
FT                   /locus_tag="mCG_141379"
FT                   /product="hypothetical protein LOC333669"
FT                   /note="gene_id=mCG141379.0 transcript_id=mCT175052.0
FT                   protein_id=mCP97971.0"
FT                   /protein_id="EDL31865.1"
FT                   /translation="MDPAESHHGVTWNQSTLGLSLHSTTDTLVMTFYLLLVVCVGLWMG
FT                   ISIYSSNIGSGHYMALAGIGAASGIAVGALEWNSIFMLFLLGWIFVPIYSKAEVVTLPE
FT                   YLKKRFGSLRIQLFFTFIFLIVYIFSRISMEIGFGAMFLKMVWDTDIYQTMLTVLTIIG
FT                   MYTITGGLATVAYVESLQAGIMILGSALLMGYAFYEVGGYPKLVSKYMEAIPSKTQQGN
FT                   WTAQPECYLPRQDAFHIFRSCVSGDIPWPGLILGATTVSLFYGCADQVSVQRFLAGKSR
FT                   LHMEGGCLLCGYLKLLPMFLMVMPGMISRILYPDQVACVVPSECQKFCGRGTGCSALAY
FT                   PVLVLGVMPHGLQGFMLSTVCASLMSSLTSIFNSSSALFTLNIYTWIRPTATEKELMIA
FT                   GRFFVIILLAVTIVWIPIIEMAPNEILFEYMQVLKSCLTPSMTAVFLLAVFCKRVNEQG
FT                   AFWGLIVGTTIGVFRLLAEFFYGPVTCGRDRQCPIFICGLHYLYFGFCLFLVTILIILA
FT                   ISLATEPIPDHHLHGLCWSLRNSQQRRVALDKEMRWKAFPSFTSQPGNDKQLQPWEASL
FT                   CGPRSWGSCPKHLLPHHPYPQTHLDRTTSIVRFLPTKMLLGLFAHMESVRPGGPWRGGK
FT                   GRRD"
FT   gene            17320045..17327404
FT                   /gene="Suhw2"
FT                   /locus_tag="mCG_3125"
FT                   /note="gene_id=mCG3125.2"
FT   mRNA            join(17320045..17320170,17325651..17327404)
FT                   /gene="Suhw2"
FT                   /locus_tag="mCG_3125"
FT                   /product="suppressor of hairy wing homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG3125.2 transcript_id=mCT1731.2 created on
FT                   30-OCT-2002"
FT   CDS             17325706..17327310
FT                   /codon_start=1
FT                   /gene="Suhw2"
FT                   /locus_tag="mCG_3125"
FT                   /product="suppressor of hairy wing homolog 2 (Drosophila)"
FT                   /note="gene_id=mCG3125.2 transcript_id=mCT1731.2
FT                   protein_id=mCP9250.2"
FT                   /db_xref="GOA:Q505F4"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR025243"
FT                   /db_xref="MGI:MGI:1927865"
FT                   /db_xref="UniProtKB/TrEMBL:Q505F4"
FT                   /protein_id="EDL31864.1"
FT                   /translation="MEQPFTVDDEDEQDPEPQPRSGEPIQVLDDDAAEDAELIFVGVEK
FT                   VKEDAELIFVGVTSASQPANSNILNRVTPGSRLKRKHDRLRATTTQRLQPSRPAAPTSE
FT                   AVVVLPASPAESRSTDSPIAIEPLSESDYRSSSPQVVPSSSSKCCSPLVTLSSSENSPV
FT                   KAALSGGDLNENLYVSKCHFSINPQRPDHSIEIVEPLSSALPPSGTFHTSNMQQRTPSF
FT                   DAPNSLSRLVNGAPPSEDSAHPRQDSGLAEADFSSPASQETFDPKKGSLTLLLSDFYYG
FT                   QYKGDGKPEQKTHTTFKCPSCLKALKNVKFMNHTKHHLELERQGSEDAWESHTTCLRCH
FT                   RQFDSPFQLECHIDRVHTSPDPSVVCKICELSFETDQVLLQHMKDNHKPGEMPYVCQVC
FT                   KYRSSGFADVETHFTKCHVNTKNLLCPFCLKIFKTGMPYMCHYRGHWERSGHQCSKCRL
FT                   QFLTFKEKMEHKTQCHQMFKKPKQLEGLPPETKVVIQVSLQPVESESVKVASITVSTTD
FT                   WEPSNPRPQGRLSQKPH"
FT   gene            complement(17346044..>17398442)
FT                   /locus_tag="mCG_3105"
FT                   /note="gene_id=mCG3105.2"
FT   mRNA            complement(join(17346044..17346313,17347763..17347868,
FT                   17349628..17349843,17351368..17351536,17357918..17358068,
FT                   17359842..17359949,17362394..17362529,17368730..17368950,
FT                   17377321..17377401,17378094..17378199,17391248..17391352,
FT                   17394131..17394190,17395922..17396026,17397442..17397513,
FT                   17398226..17398442))
FT                   /locus_tag="mCG_3105"
FT                   /product="mCG3105, transcript variant mCT1748"
FT                   /note="gene_id=mCG3105.2 transcript_id=mCT1748.2 created on
FT                   23-SEP-2002"
FT   mRNA            complement(join(17346100..17346313,17347763..17347868,
FT                   17349628..17349843,17351368..17351536,17357918..17358068,
FT                   17359842..17359949,17362390..17362529,17368730..17368950,
FT                   17377321..17377401,17378094..17378199,17391248..17391352,
FT                   17394131..17394190,17395922..17396026,17397442..17397513,
FT                   17398226..>17398442))
FT                   /locus_tag="mCG_3105"
FT                   /product="mCG3105, transcript variant mCT192944"
FT                   /note="gene_id=mCG3105.2 transcript_id=mCT192944.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(17346102..17346313,17347763..17347868,
FT                   17349628..17349843,17351368..17351536,17357918..17358068,
FT                   17359842..17359949,17362394..17362529,17368730..17368950,
FT                   17377321..17377401,17378094..17378199,17391248..17391352,
FT                   17394131..17394190,17395922..17396026,17397442..17397513,
FT                   17398226..17398360))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3105"
FT                   /product="mCG3105, isoform CRA_a"
FT                   /note="gene_id=mCG3105.2 transcript_id=mCT1748.2
FT                   protein_id=mCP9298.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q91ZP4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="MGI:MGI:1890478"
FT                   /db_xref="UniProtKB/TrEMBL:Q91ZP4"
FT                   /protein_id="EDL31862.1"
FT                   /translation="MASTLSPSITPQTEEPPVVPVRIQNAADISVIVIYFIVVLAVGLW
FT                   SMVRSNRGTVGGFFLAGHDMAWWPMGASLFASNIGSNHFVGLAGTGAASGIAIAAVEWN
FT                   ALLMVLVLGWVFLPIYIKAGVLTMPEYLRKRFGGKRLQIYLSVLSLFIMVALQTSSIIF
FT                   SGAIFIQLALGLNLYLAVFILLAITAFYTVAGGLASVIYTDSVQTFIMLLGSLILMGFA
FT                   FAEVGGYESFTEKYMNAIPSVVEGDNLTISPKCYTPQPDSFHVFRDPVTGDIPWPGLIF
FT                   GMTILAIWYWCADQVIVQRCLCGKNMSHVKAACILCGYLKLLPMFLMVMPGMISRILYT
FT                   DKVACVVPSECEKQCGTAVGCTNYAYPTLVLELMPDGLRGLMLSVMLASLMSSLTSIFN
FT                   SASTLFTIDLYTKIRKKASERELMIAGRIFGMVLIAVSILWVPLVQVSQNGQLFHYIGS
FT                   VSSYLGPPLGAVFMLAIFFKRVNEQGAFWGLMVGLVVGLIRLIAEFVYGTGSCVAPSNC
FT                   PKIICGVHYMYFAIILFFVSIIVILGVSFLTEPIPDVHLYRLCWSLWNNTEERIDLDAE
FT                   ELETQEEAGGALEEDSEQSRGCLKRACCLLCGLQNTGPKLTKEEEAALRQKFSDTSEKP
FT                   LWRTVMNINAVLLLGVAVFVHAYFA"
FT   CDS             complement(join(17359946..17359949,17362390..17362529,
FT                   17368730..17368950,17377321..17377401,17378094..17378199,
FT                   17391248..17391352,17394131..17394190,17395922..17396026,
FT                   17397442..17397513,17398226..>17398423))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3105"
FT                   /product="mCG3105, isoform CRA_b"
FT                   /note="gene_id=mCG3105.2 transcript_id=mCT192944.0
FT                   protein_id=mCP113920.0 isoform=CRA_b"
FT                   /protein_id="EDL31863.1"
FT                   /translation="SSAYIKTGGGILRKGPEPPEAMASTLSPSITPQTEEPPVVPVRIQ
FT                   NAADISVIVIYFIVVLAVGLWSMVRSNRGTVGGFFLAGHDMAWWPMGASLFASNIGSNH
FT                   FVGLAGTGAASGIAIAAVEWNALLMVLVLGWVFLPIYIKAGVLTMPEYLRKRFGGKRLQ
FT                   IYLSVLSLFIMVALQTSSIIFSGAIFIQLALGLNLYLAVFILLAITAFYTVAGGLASVI
FT                   YTDSVQTFIMLLGSLILMGFAFAEVGGYESFTEKYMNAIPSVVEGDNLTISPKCYTPQP
FT                   DSFHVFRDPVTGDIPWPGLIFGMTILAIWYWCADQVIVQRCLCGKNMSHVKAACILCGY
FT                   LKLLPMFLMVMPGMISRILYTGK"
FT   gene            17434868..17476682
FT                   /locus_tag="mCG_3127"
FT                   /note="gene_id=mCG3127.2"
FT   mRNA            join(17434868..17435082,17435778..17435849,
FT                   17437885..17437989,17440995..17441054,17444438..17444542,
FT                   17449943..17450048,17451109..17451189,17454096..17454316,
FT                   17458069..17458204,17463937..17464044,17465508..17465658,
FT                   17469069..17469237,17470088..17470303,17473914..17474016,
FT                   17476475..17476682)
FT                   /locus_tag="mCG_3127"
FT                   /product="mCG3127"
FT                   /note="gene_id=mCG3127.2 transcript_id=mCT1722.2 created on
FT                   23-SEP-2002"
FT   CDS             join(17434948..17435082,17435778..17435849,
FT                   17437885..17437989,17440995..17441054,17444438..17444542,
FT                   17449943..17450048,17451109..17451189,17454096..17454316,
FT                   17458069..17458204,17463937..17464044,17465508..17465658,
FT                   17469069..17469237,17470088..17470303,17473914..17474016,
FT                   17476475..17476677)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3127"
FT                   /product="mCG3127"
FT                   /note="gene_id=mCG3127.2 transcript_id=mCT1722.2
FT                   protein_id=mCP9252.2"
FT                   /db_xref="GOA:G5E836"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR019900"
FT                   /db_xref="MGI:MGI:1927848"
FT                   /db_xref="UniProtKB/TrEMBL:G5E836"
FT                   /protein_id="EDL31861.1"
FT                   /translation="MASTASVSTSTASSELSSLSNNINNAADISVIVIYFVVVMAVGVW
FT                   AMLKTNRSTVGGFFLAGRSMTWWPMGASLFASNIGSGHFVGLAGTGAASGIAVTAFESH
FT                   SFALLLVLGWIFVPIYIKAGVMTMPEYLKKRFGGKRLQIYLSILFLFICVILTISADIF
FT                   SGAIFIKLALGLNLYLAILILLAITAIFTITGGLASVIYTDTVQAVIMLVGSFILMVFA
FT                   FVEVGGYESFTEKFMNAIPSVVEGDNLTINSRCYTPQPDSFHIFRDPVTGDIPWPGTAF
FT                   GMPITALWYWCINQVIVQRCLCGKNLSHVKAACILCGYLKLLPLFFMVMPGMISRILYT
FT                   DMVACVVPSECVKHCGVDVGCTNYAYPMLVLKLMPMGLRGLMLSVMLASLMSSLTSVFN
FT                   SASTLFTIDLYTKIRKKASERELLIAGRLFVSVLIVTSILWVPIVEVSQGGQLVHYTEA
FT                   ISSYLGPPIAAVFLVAVFCKRANEQGAFWGLMVGLVMGLIRMIAEFSYGTGSCLAPSSC
FT                   PKIICGVHYLYFAIILFFVCILVILGVSYLTKPIPDVHLHRLCWALRNSKEERIDLDAE
FT                   DKEENGADDRTEEDQTEKPRGCLKKTCDLFCGLQRAEFKLTKVEEEALTDTTEKPFWRT
FT                   VMNVNVILLLAVAAFFYGYFA"
FT   gene            complement(17494645..17525261)
FT                   /gene="Prmt2"
FT                   /locus_tag="mCG_3122"
FT                   /note="gene_id=mCG3122.2"
FT   mRNA            complement(join(17494645..17495209,17495828..17495999,
FT                   17496753..17496889,17497813..17497942,17504731..17504906,
FT                   17508415..17508579,17509864..17510025,17512703..17512885,
FT                   17513605..17513730,17524127..17524236,17525165..17525261))
FT                   /gene="Prmt2"
FT                   /locus_tag="mCG_3122"
FT                   /product="protein arginine N-methyltransferase 2"
FT                   /note="gene_id=mCG3122.2 transcript_id=mCT1735.2 created on
FT                   23-SEP-2002"
FT   CDS             complement(join(17495177..17495209,17495828..17495999,
FT                   17496753..17496889,17497813..17497942,17504731..17504906,
FT                   17508415..17508579,17509864..17510025,17512703..17512885,
FT                   17513605..17513730,17524127..17524180))
FT                   /codon_start=1
FT                   /gene="Prmt2"
FT                   /locus_tag="mCG_3122"
FT                   /product="protein arginine N-methyltransferase 2"
FT                   /note="gene_id=mCG3122.2 transcript_id=mCT1735.2
FT                   protein_id=mCP9231.2"
FT                   /db_xref="GOA:Q3UKX1"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR025799"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="MGI:MGI:1316652"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UKX1"
FT                   /protein_id="EDL31860.1"
FT                   /translation="MEAPGEGPCSESQVIPVLEEDPVDYGCEMQLLQDGAQLQLQLQPE
FT                   EFVAIADYTATDETQLSFLRGEKILILRQTTADWWWGERAGCCGYIPANHLGKQLEEYD
FT                   PEDTWQDEEYFDSYGTLKLHLEMLADQPRTTKYHSVILQNKESLKDKVILDVGCGTGII
FT                   SLFCAHHARPKAVYAVEASDMAQHTSQLVLQNGFADTITVFQQKVEDVVLPEKVDVLVS
FT                   EWMGTCLLFEFMIESILYARDTWLKGDGIIWPTTAALHLVPCSAEKDYHSKVLFWDNAY
FT                   EFNLSALKSLAIKEFFSRPKSNHILKPEDCLSEPCTILQLDMRTVQVPDLETMRGELRF
FT                   DIQKAGTLHGFTAWFSVYFQSLEEGQPQQVLSTGPLHPTTHWKQTLFMMDDPVPVHTGD
FT                   VVTGSVVLQRNPVWRRHMSVSLSWVVTSALDPTSQRVGEKVFPIWR"
FT   gene            17541283..17548731
FT                   /gene="S100b"
FT                   /locus_tag="mCG_3101"
FT                   /note="gene_id=mCG3101.2"
FT   mRNA            join(17541283..17541371,17544440..17544585,
FT                   17547341..17547477,17548619..17548731)
FT                   /gene="S100b"
FT                   /locus_tag="mCG_3101"
FT                   /product="S100 protein, beta polypeptide, neural,
FT                   transcript variant mCT173622"
FT                   /note="gene_id=mCG3101.2 transcript_id=mCT173622.0 created
FT                   on 23-SEP-2002"
FT   mRNA            join(17541283..17541371,17544440..17544585,
FT                   17547341..17548693)
FT                   /gene="S100b"
FT                   /locus_tag="mCG_3101"
FT                   /product="S100 protein, beta polypeptide, neural,
FT                   transcript variant mCT1757"
FT                   /note="gene_id=mCG3101.2 transcript_id=mCT1757.1 created on
FT                   23-SEP-2002"
FT   CDS             join(17544448..17544585,17547341..17547477,
FT                   17548619..17548631)
FT                   /codon_start=1
FT                   /gene="S100b"
FT                   /locus_tag="mCG_3101"
FT                   /product="S100 protein, beta polypeptide, neural, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3101.2 transcript_id=mCT173622.0
FT                   protein_id=mCP96541.0 isoform=CRA_a"
FT                   /protein_id="EDL31858.1"
FT                   /translation="MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFL
FT                   EEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHEEET"
FT   CDS             join(17544448..17544585,17547341..17547481)
FT                   /codon_start=1
FT                   /gene="S100b"
FT                   /locus_tag="mCG_3101"
FT                   /product="S100 protein, beta polypeptide, neural, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3101.2 transcript_id=mCT1757.1
FT                   protein_id=mCP9295.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UY00"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028481"
FT                   /db_xref="MGI:MGI:98217"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UY00"
FT                   /protein_id="EDL31859.1"
FT                   /translation="MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFL
FT                   EEIKEQEVVDKVMETLDEDGDGECDFQEFMAFVAMVTTACHEFFEHE"
FT   gene            complement(17550151..17633080)
FT                   /locus_tag="mCG_141346"
FT                   /note="gene_id=mCG141346.0"
FT   mRNA            complement(join(17550151..17552286,17552911..17553034,
FT                   17553730..17553904,17555905..17555979,17557517..17557574,
FT                   17557809..17557870,17559946..17560116,17560448..17560616,
FT                   17561562..17561692,17562402..17562511,17563742..17563853,
FT                   17563997..17564118,17565901..17566024,17567119..17567199,
FT                   17567270..17567379,17568089..17568290,17569926..17570040,
FT                   17572939..17573066,17573775..17573855,17574725..17574861,
FT                   17578420..17578559,17579724..17579838,17581906..17582025,
FT                   17583479..17583572,17583765..17583829,17585167..17585269,
FT                   17585665..17585774,17586082..17586205,17587315..17587425,
FT                   17589616..17589707,17592424..17592625,17594485..17594604,
FT                   17600279..17600311,17604970..17605197,17606570..17606689,
FT                   17614801..17614874,17632994..17633080))
FT                   /locus_tag="mCG_141346"
FT                   /product="mCG141346, transcript variant mCT174810"
FT                   /note="gene_id=mCG141346.0 transcript_id=mCT174810.0
FT                   created on 24-OCT-2002"
FT   mRNA            complement(join(17550151..17552286,17552911..17553034,
FT                   17553730..17553904,17555905..17555979,17557517..17557574,
FT                   17557809..17557870,17559946..17560116,17560448..17560616,
FT                   17561562..17561692,17562402..17562511,17563742..17563853,
FT                   17563997..17564118,17565901..17566024,17567119..17567199,
FT                   17567270..17567379,17568089..17568290,17569926..17570040,
FT                   17572939..17573066,17573775..17573855,17574725..17574861,
FT                   17578420..17578559,17579724..17579838,17581906..17582025,
FT                   17583479..17583572,17583765..17583829,17585167..17585269,
FT                   17585665..17585774,17586082..17586205,17587315..17587425,
FT                   17589616..17589707,17592424..17592625,17594485..17594604,
FT                   17600279..17600407,17604970..17605197,17606570..17606689,
FT                   17608593..17608709,17614801..17614874,17632994..17633080))
FT                   /locus_tag="mCG_141346"
FT                   /product="mCG141346, transcript variant mCT174811"
FT                   /note="gene_id=mCG141346.0 transcript_id=mCT174811.0
FT                   created on 24-OCT-2002"
FT   mRNA            complement(join(17550151..17552286,17552911..17553034,
FT                   17553730..17553904,17555905..17555979,17557517..17557574,
FT                   17557809..17557870,17558789..17558818,17559946..17560116,
FT                   17560448..17560616,17561562..17561692,17562402..17562511,
FT                   17563742..17563853,17563997..17564118,17565901..17566024,
FT                   17567119..17567199,17567270..17567379,17568089..17568290,
FT                   17569926..17570040,17572939..17573066,17573775..17573855,
FT                   17574725..17574861,17578420..17578559,17579724..17579838,
FT                   17581906..17582025,17583479..17583572,17583765..17583829,
FT                   17585167..17585269,17585665..17585774,17586082..17586205,
FT                   17587315..17587425,17589616..17589707,17592424..17592625,
FT                   17594485..17594604,17600279..17600407,17604970..17605197,
FT                   17606570..17606689,17608593..17608709,17614801..17614880,
FT                   17632994..17633080))
FT                   /locus_tag="mCG_141346"
FT                   /product="mCG141346, transcript variant mCT174812"
FT                   /note="gene_id=mCG141346.0 transcript_id=mCT174812.0
FT                   created on 24-OCT-2002"
FT   CDS             complement(join(17552034..17552286,17552911..17553034,
FT                   17553730..17553904,17555905..17555979,17557517..17557574,
FT                   17557809..17557870,17559946..17560116,17560448..17560616,
FT                   17561562..17561692,17562402..17562511,17563742..17563853,
FT                   17563997..17564118,17565901..17566024,17567119..17567199,
FT                   17567270..17567379,17568089..17568290,17569926..17570040,
FT                   17572939..17573066,17573775..17573855,17574725..17574861,
FT                   17578420..17578559,17579724..17579838,17581906..17582025,
FT                   17583479..17583572,17583765..17583829,17585167..17585269,
FT                   17585665..17585774,17586082..17586205,17587315..17587425,
FT                   17589616..17589707,17592424..17592430))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141346"
FT                   /product="mCG141346, isoform CRA_b"
FT                   /note="gene_id=mCG141346.0 transcript_id=mCT174810.0
FT                   protein_id=mCP97729.0 isoform=CRA_b"
FT                   /protein_id="EDL31856.1"
FT                   /translation="MASKLWSRSLKLAYTLLNKLTSKNEPLLNPGDRVALVFPNSDPVM
FT                   FMVAFYGCLLAELVPVPIEVPLTRKDAGSQQVGFLLGSCGVTLALTTDACQKGLPKAPT
FT                   GEVATFKGWPPLAWLVIDGKHLTRPPKDWYPLAQDTGSRTAYIEYKTSKEGSTVGVTVS
FT                   HSSLLAQCQALTQACGYTEAETLTNVLDFKRDAGLWHGVLTSVMNRMHVITIPYALMKV
FT                   NPLSWIQKVCSYKARAALVKSRDMHWSLLAQRGQRDVCLSSLRMLIVADGANPWSISSC
FT                   DAFLNVFQSRGLRPEVICPCASSPEALTVAIRRPPDLGGPPPRKAVLSMNGLSYGVIRV
FT                   DTEEKLSVLTVQDVGQVMPGASVCVVKVDGAPYLCKTDEIGEICVNSVATGTAYYGLLG
FT                   ITKNTFETVPVTADGVPVSDRPFTRTGLLGFIGPDNLVFVVGKLDGLMVVGVRRHNADD
FT                   IVATALAVEPMKFVYRGRIAVFSVTVLHDDRIVLVAEQRPDASEEDSFQWMSRVLQAID
FT                   SIHQVGVYCLALVPANTLPKAPLGGIHISETKQRFLEGTLHPCNVLMCPHTCVTNLPKP
FT                   RQKQPEVGPASMIVGNLVAGKRIAQASGRELAHLEDSDQARKFLFLADVLQWRAHTTPD
FT                   HPLFLLLNAKGTVTSTATCIQLHKRAERVAAALMEKGRLDAGDHVALVYPPGVDLIAAF
FT                   YGCLYCGCVPVTVRPPHPQNLGTTLPTVKMIVEVSKSACVLSTQAITRLLKSKEAAAAV
FT                   DVRTWPTILDTDDIPKKKVASIFRPPSPDVLAYLDFSVSTTGILAGVKMSHAATSALCR
FT                   SIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLVPPLELESNVSLWLSAV
FT                   SQYKARVTFCSYSVMEMCTKGLGAQTGALRMKGVNLSCVRTCMVVAEERPRISLTQSFS
FT                   KLFKDLGLPARAVSTTFGCRVNVAICLQGTTGPDPTTVYVDMRALRHDRVRLVERGSPH
FT                   SLPLMESGKILPGVKVIIAHTETKGPLGDSHLGEIWVSSPHNATGYYTVYGEETLHADH
FT                   FSARLSFGDTQTIWARTGYLGFLRRTELTDASGERHDALYVVGSLDETLELRGMRYHPI
FT                   DIETSVIRAHRSIAECAVFTWTNLLVVVVELDGLEQDALDLVALVTNVVLEEHYLVVGV
FT                   VVIVDPGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM"
FT   CDS             complement(join(17552034..17552286,17552911..17553034,
FT                   17553730..17553904,17555905..17555979,17557517..17557574,
FT                   17557809..17557870,17559946..17560116,17560448..17560616,
FT                   17561562..17561692,17562402..17562511,17563742..17563853,
FT                   17563997..17564118,17565901..17566024,17567119..17567199,
FT                   17567270..17567379,17568089..17568290,17569926..17570040,
FT                   17572939..17573066,17573775..17573855,17574725..17574861,
FT                   17578420..17578559,17579724..17579838,17581906..17582025,
FT                   17583479..17583572,17583765..17583829,17585167..17585269,
FT                   17585665..17585774,17586082..17586205,17587315..17587425,
FT                   17589616..17589707,17592424..17592430))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141346"
FT                   /product="mCG141346, isoform CRA_b"
FT                   /note="gene_id=mCG141346.0 transcript_id=mCT174811.0
FT                   protein_id=mCP97730.0 isoform=CRA_b"
FT                   /protein_id="EDL31857.1"
FT                   /translation="MASKLWSRSLKLAYTLLNKLTSKNEPLLNPGDRVALVFPNSDPVM
FT                   FMVAFYGCLLAELVPVPIEVPLTRKDAGSQQVGFLLGSCGVTLALTTDACQKGLPKAPT
FT                   GEVATFKGWPPLAWLVIDGKHLTRPPKDWYPLAQDTGSRTAYIEYKTSKEGSTVGVTVS
FT                   HSSLLAQCQALTQACGYTEAETLTNVLDFKRDAGLWHGVLTSVMNRMHVITIPYALMKV
FT                   NPLSWIQKVCSYKARAALVKSRDMHWSLLAQRGQRDVCLSSLRMLIVADGANPWSISSC
FT                   DAFLNVFQSRGLRPEVICPCASSPEALTVAIRRPPDLGGPPPRKAVLSMNGLSYGVIRV
FT                   DTEEKLSVLTVQDVGQVMPGASVCVVKVDGAPYLCKTDEIGEICVNSVATGTAYYGLLG
FT                   ITKNTFETVPVTADGVPVSDRPFTRTGLLGFIGPDNLVFVVGKLDGLMVVGVRRHNADD
FT                   IVATALAVEPMKFVYRGRIAVFSVTVLHDDRIVLVAEQRPDASEEDSFQWMSRVLQAID
FT                   SIHQVGVYCLALVPANTLPKAPLGGIHISETKQRFLEGTLHPCNVLMCPHTCVTNLPKP
FT                   RQKQPEVGPASMIVGNLVAGKRIAQASGRELAHLEDSDQARKFLFLADVLQWRAHTTPD
FT                   HPLFLLLNAKGTVTSTATCIQLHKRAERVAAALMEKGRLDAGDHVALVYPPGVDLIAAF
FT                   YGCLYCGCVPVTVRPPHPQNLGTTLPTVKMIVEVSKSACVLSTQAITRLLKSKEAAAAV
FT                   DVRTWPTILDTDDIPKKKVASIFRPPSPDVLAYLDFSVSTTGILAGVKMSHAATSALCR
FT                   SIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLVPPLELESNVSLWLSAV
FT                   SQYKARVTFCSYSVMEMCTKGLGAQTGALRMKGVNLSCVRTCMVVAEERPRISLTQSFS
FT                   KLFKDLGLPARAVSTTFGCRVNVAICLQGTTGPDPTTVYVDMRALRHDRVRLVERGSPH
FT                   SLPLMESGKILPGVKVIIAHTETKGPLGDSHLGEIWVSSPHNATGYYTVYGEETLHADH
FT                   FSARLSFGDTQTIWARTGYLGFLRRTELTDASGERHDALYVVGSLDETLELRGMRYHPI
FT                   DIETSVIRAHRSIAECAVFTWTNLLVVVVELDGLEQDALDLVALVTNVVLEEHYLVVGV
FT                   VVIVDPGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM"
FT   CDS             complement(join(17552034..17552286,17552911..17553034,
FT                   17553730..17553904,17555905..17555979,17557517..17557574,
FT                   17557809..17557870,17558789..17558818,17559946..17560116,
FT                   17560448..17560616,17561562..17561692,17562402..17562511,
FT                   17563742..17563853,17563997..17564118,17565901..17566024,
FT                   17567119..17567199,17567270..17567379,17568089..17568290,
FT                   17569926..17570040,17572939..17573066,17573775..17573855,
FT                   17574725..17574861,17578420..17578559,17579724..17579838,
FT                   17581906..17582025,17583479..17583572,17583765..17583829,
FT                   17585167..17585269,17585665..17585774,17586082..17586205,
FT                   17587315..17587425,17589616..17589707,17592424..17592430))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141346"
FT                   /product="mCG141346, isoform CRA_a"
FT                   /note="gene_id=mCG141346.0 transcript_id=mCT174812.0
FT                   protein_id=mCP97731.0 isoform=CRA_a"
FT                   /protein_id="EDL31855.1"
FT                   /translation="MASKLWSRSLKLAYTLLNKLTSKNEPLLNPGDRVALVFPNSDPVM
FT                   FMVAFYGCLLAELVPVPIEVPLTRKDAGSQQVGFLLGSCGVTLALTTDACQKGLPKAPT
FT                   GEVATFKGWPPLAWLVIDGKHLTRPPKDWYPLAQDTGSRTAYIEYKTSKEGSTVGVTVS
FT                   HSSLLAQCQALTQACGYTEAETLTNVLDFKRDAGLWHGVLTSVMNRMHVITIPYALMKV
FT                   NPLSWIQKVCSYKARAALVKSRDMHWSLLAQRGQRDVCLSSLRMLIVADGANPWSISSC
FT                   DAFLNVFQSRGLRPEVICPCASSPEALTVAIRRPPDLGGPPPRKAVLSMNGLSYGVIRV
FT                   DTEEKLSVLTVQDVGQVMPGASVCVVKVDGAPYLCKTDEIGEICVNSVATGTAYYGLLG
FT                   ITKNTFETVPVTADGVPVSDRPFTRTGLLGFIGPDNLVFVVGKLDGLMVVGVRRHNADD
FT                   IVATALAVEPMKFVYRGRIAVFSVTVLHDDRIVLVAEQRPDASEEDSFQWMSRVLQAID
FT                   SIHQVGVYCLALVPANTLPKAPLGGIHISETKQRFLEGTLHPCNVLMCPHTCVTNLPKP
FT                   RQKQPEVGPASMIVGNLVAGKRIAQASGRELAHLEDSDQARKFLFLADVLQWRAHTTPD
FT                   HPLFLLLNAKGTVTSTATCIQLHKRAERVAAALMEKGRLDAGDHVALVYPPGVDLIAAF
FT                   YGCLYCGCVPVTVRPPHPQNLGTTLPTVKMIVEVSKSACVLSTQAITRLLKSKEAAAAV
FT                   DVRTWPTILDTDDIPKKKVASIFRPPSPDVLAYLDFSVSTTGILAGVKMSHAATSALCR
FT                   SIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLVPPLELESNVSLWLSAV
FT                   SQYKARVTFCSYSVMEMCTKGLGAQTGALRMKGVNLSCVRTCMVVAEERPRISLTQSFS
FT                   KLFKDLGLPARAVSTTFGCRVNVAICLQPNRLGKLAEQGTTGPDPTTVYVDMRALRHDR
FT                   VRLVERGSPHSLPLMESGKILPGVKVIIAHTETKGPLGDSHLGEIWVSSPHNATGYYTV
FT                   YGEETLHADHFSARLSFGDTQTIWARTGYLGFLRRTELTDASGERHDALYVVGSLDETL
FT                   ELRGMRYHPIDIETSVIRAHRSIAECAVFTWTNLLVVVVELDGLEQDALDLVALVTNVV
FT                   LEEHYLVVGVVVIVDPGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM"
FT   gene            complement(17639052..17731322)
FT                   /gene="Pcnt"
FT                   /locus_tag="mCG_121345"
FT                   /note="gene_id=mCG121345.1"
FT   mRNA            complement(join(17639052..17639566,17640696..17640823,
FT                   17641960..17642098,17642846..17642922,17643951..17644183,
FT                   17644822..17644941,17655095..17655268,17656518..17656620,
FT                   17657622..17657866,17662640..17663089,17667694..17667844,
FT                   17668006..17668228,17669022..17669214,17669809..17669976,
FT                   17672530..17672694,17673493..17673659,17675220..17675322,
FT                   17676645..17677325,17679987..17680473,17687717..17687889,
FT                   17689195..17689398,17691487..17691507,17691621..17691737,
FT                   17692285..17692514,17696561..17696773,17697331..17697493,
FT                   17699401..17699633,17699896..17700047,17700373..17700524,
FT                   17706235..17706441,17707853..17708417,17710643..17711100,
FT                   17714760..17714847,17715688..17715928,17717075..17717186,
FT                   17720879..17721015,17721482..17721656,17721860..17721915,
FT                   17724301..17724556,17725020..17725091,17728018..17728230,
FT                   17730440..17731322))
FT                   /gene="Pcnt"
FT                   /locus_tag="mCG_121345"
FT                   /product="pericentrin (kendrin)"
FT                   /note="gene_id=mCG121345.1 transcript_id=mCT122545.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(17639526..17639566,17640696..17640823,
FT                   17641960..17642098,17642846..17642922,17643951..17644183,
FT                   17644822..17644941,17655095..17655268,17656518..17656620,
FT                   17657622..17657866,17662640..17663089,17667694..17667844,
FT                   17668006..17668228,17669022..17669214,17669809..17669976,
FT                   17672530..17672694,17673493..17673659,17675220..17675322,
FT                   17676645..17677325,17679987..17680473,17687717..17687889,
FT                   17689195..17689398,17691487..17691507,17691621..17691737,
FT                   17692285..17692514,17696561..17696773,17697331..17697493,
FT                   17699401..17699633,17699896..17700047,17700373..17700524,
FT                   17706235..17706441,17707853..17708417,17710643..17711100,
FT                   17714760..17714847,17715688..17715928,17717075..17717186,
FT                   17720879..17721015,17721482..17721656,17721860..17721915,
FT                   17724301..17724556,17725020..17725091,17728018..17728230,
FT                   17730440..17730493))
FT                   /codon_start=1
FT                   /gene="Pcnt"
FT                   /locus_tag="mCG_121345"
FT                   /product="pericentrin (kendrin)"
FT                   /note="gene_id=mCG121345.1 transcript_id=mCT122545.1
FT                   protein_id=mCP55166.1"
FT                   /protein_id="EDL31853.1"
FT                   /translation="MEDEQEQRRRKVEAGRAKLANFRQRKTKGDCPNSKKKTAKRKGSA
FT                   VHASVQEEGSVATPNSELPQGGAVFESPSCSNTLEGTRGASAAQEQEDCELDVTDLQGQ
FT                   QQTQPPPPQTAHSLELEALRLSLNNMHTAQLELTQANLQKEKETALTELREMLNGRRAQ
FT                   ELALLQSRQQCELELLREQHAREKEEMALRSGQEAAELKEKLRSEMEKNAQTIETLKQD
FT                   WESERELCLENLRQELSLKHQSEMEGLQSQFQKELSEQKVELEKIFQAKHEAEVSLKNL
FT                   EAQHQAAIKKLQEDLQSEHCQYLQDLEQKFREKEKAKELELETLQASYEDLKAQSQEEI
FT                   RLLWSQLESMKTNREELNGSWDPVLAQASHLEELEHLRSGFAQQQQQERAQHESELEHL
FT                   RVYFEKKLKDAEKTYQEDLTVFQQRLQEAREDSLESTEISSSCVLPEETSGREGKEPPD
FT                   PLDLQLGQPKVQESLVEDCQVKLSKAEEKIQQMKEEFQKKEAEWELSREELKREAEERL
FT                   ASMFLELREKAESEKLSIISRFEHRESSMRHLQDQQAAQILDLERSLMEQQGHLRQLEQ
FT                   ELTRDDLLPCSQCGQEPAMAQEEKNGALLREKEDCALQLLMAQNRFLEERKEIMEKFAK
FT                   EQDAFLRDAQEKHNHELQLLQQGHQQQLLALRMELETKHRSELTEQLASSESRRQALLE
FT                   THVAELQVKHNAEISALEKRHLSNLDELESCYVADVQTIRDEHQQALELLRAELEEQLQ
FT                   KKESCHREMLTQELENLKRQHAEELQSVRDSLRMEMSAQHIENGKGPAADLQGAHQQDP
FT                   AMALHNEGHLLVEDGDAVLRSVDAEGLLHQAGPQELGDAHTVEMQKSQAELAKPQELQA
FT                   SQDQVAQVRDKVFLLNRELEECRAELEQLQQRRERENQEGTTLICMLRADLELAQGEGK
FT                   ALRDALRRLLDLFGDTLKAAVTLKSRISERAGLLLDHEDAADTSDARLAAAALGDMWSD
FT                   EGLLEIDRTLPEGAETSSVCEISSHVCESFFISPENTLDCEQPIRRVYQSLSTAVEGLL
FT                   EMALDSSKQLEEARQLHRCVEREFRHRNEEMAQAMQKQQELLERLREESAAKDRLALEL
FT                   HTAKGLLEGFKVEKVDLQEALGKKEESEQQLILELEDLRKQLQQAARELLTLKEEKSVL
FT                   WNQKETLTNEAKEREAALQEEVESLTRVQWESRKQSEKDRATLLSQMRVLESELEDQLV
FT                   QHRGCAQLAEEVATLKQQLAALDKHLRSQRQFMDDQAAEREHEREEFQQEIQRLEGQLR
FT                   QAARPRPPGPRDSQCVQLDEEVELLQEKLREKLDGFNELVIKKDFADQQLLIQEEEIKR
FT                   LEETNASIQRQMVQLQEELEKQKKSMEELKEKEILKQENMGDLLLTTVSRSGLDEAGCP
FT                   MLPQGSSSRGPEAQPDVTERALLQHENEVDAEEVAARHLAELEHCVALREAEVEAMASQ
FT                   IQEFAATLKAKEAIIEQRDLEIDAVNKWKVSHSLELEAILLALAHFRHALEQQTCATPD
FT                   EPPELRQLRVQCARLSHQLQVLYRPFLKCRMQLDQHQPHVASIGCANPCADDELEQEGV
FT                   SNRLALAPHSLAAQAKEELEDCPLGKANLMAQVRQLQEELDHRVHSVASRDTNSETCKL
FT                   QQPNLSENGPRNHCCNGEESKPSPPDDVLNIAKTTWDVIDIIKNQDLLVQVEMPDFPTQ
FT                   EKLTSQGGPFSSQASGHSGSLLPEEAAEPQQDPVRALDLSSWSSPEVVRKDPSLEPQHS
FT                   LPLTPGVGTVSLHSVDISPDWTDPLLQADVSGLLCYPGKSASGQAPLWAVAPSAGKHHA
FT                   ERTATEKDVEDFIVTSFDSQELLTSPSHELARRSDGSRKSDGPDIAMMLTLGSEGSETP
FT                   TTDLVAAAAAAVPFSRRFVQSPGAMKEKEIHAKQMKALLQMVFDESHQILALSESQDPS
FT                   SALNKGEPRDPLDGFPRDSQALSEVTTDKGEKESLETHLTWSEELLRAIQEVFAREQEK
FT                   AELQPRPYGSNLGDYNSLVQRLEKVIQEQGDPQKVQDHLCLSDRSSLLAEIQALRAQLR
FT                   MTHLQNQEKLQQLCAALTSTEARGSQREHQLRRQVELLAYKVEQEKCIANELQKTLSKE
FT                   QETASDVRKRLVVEQNAVQDLKSELHACKQENTSLLESLDKVQQEVLRLRAVLDGKEKE
FT                   LKVVLEELESERGKGQALQAQQEEQQLRYLQREGQSSRALEELKLSLEKQLAQNNQLCV
FT                   ALKHERAAKDNLQKELQIEASRCEALLAQEKGQLSELQKSLEAERSRSLELSEALQHER
FT                   LLTEQLSRNSQEACARQETQVQHALLRKLKAEKTRALELEAMLEKVQKQAAHTQQQLEA
FT                   QAQERCVELRREKERELEIQRQRDEHKIEQLQRLVRELRWKEEVSGGNGPCRGSPGRGS
FT                   LERDQFQEQQQELEKIRQQLLCAAGLLTSFTNHTVDRTIKDWTSSNEKAVSSLMRTLEE
FT                   LKSELSMPTSFQKKMTAELQVQLMNELLSDNDALTKAVGMATREKAELCRTVSRLEKTL
FT                   KHHTQKGCVLNRQSKSSLKQDGTDLQSSLRHSDPEWHSQTTSGDTNTCNIKMEKLYLHY
FT                   LRAESFRKALIYQKKYLLLLIGGFQDSEQETLSMIAHLGVFPSKADKKITMSRPFTKFR
FT                   TAVRVVIAVLRLRFLVKKWQEVDRKGALVHPKSTRHGHRTSQRQRSPSGPRASLPTRDT
FT                   SSGPTKASRHSPRSAAAGSPGKERSTSTPSSRLERSLTASQDPEHSLTEYIHHLEMIQQ
FT                   RLGGLPPDSTQKSCHQKIKQ"
FT   gene            <17676808..17689370
FT                   /locus_tag="mCG_146037"
FT                   /note="gene_id=mCG146037.0"
FT   mRNA            join(<17676808..17676899,17677179..17677353,
FT                   17686213..17686757,17688649..17688693,17689231..17689370)
FT                   /locus_tag="mCG_146037"
FT                   /product="mCG146037"
FT                   /note="gene_id=mCG146037.0 transcript_id=mCT186145.0
FT                   created on 04-JUL-2003"
FT   CDS             <17686437..17686688
FT                   /codon_start=1
FT                   /locus_tag="mCG_146037"
FT                   /product="mCG146037"
FT                   /note="gene_id=mCG146037.0 transcript_id=mCT186145.0
FT                   protein_id=mCP107464.0"
FT                   /protein_id="EDL31854.1"
FT                   /translation="EILKDTVSETPLRAETWCQSHLELTYCYKHIGNYRNACASWEISL
FT                   GLVSPLLVQKNHELINTYAERPRQRKNDSLLFIYIKRD"
FT   gene            17730244..17731743
FT                   /locus_tag="mCG_148081"
FT                   /note="gene_id=mCG148081.0"
FT   mRNA            17730244..17731743
FT                   /locus_tag="mCG_148081"
FT                   /product="mCG148081"
FT                   /note="gene_id=mCG148081.0 transcript_id=mCT188344.0
FT                   created on 13-JAN-2004"
FT   CDS             17730749..17731144
FT                   /codon_start=1
FT                   /locus_tag="mCG_148081"
FT                   /product="mCG148081"
FT                   /note="gene_id=mCG148081.0 transcript_id=mCT188344.0
FT                   protein_id=mCP108310.0"
FT                   /protein_id="EDL31852.1"
FT                   /translation="MSEARRSRGSRAFVDWAAGRFGQTVFPRRCYLSPSPDRRRTYIPA
FT                   ALHASGALWALSPALCQSRFFCRDVFLRTLGHPLGSTSPHFWFSGAVNWESCFPSLTTS
FT                   APPEHGPLSSIQIQRTEYSQSYSLNDT"
FT   gene            17737001..17749282
FT                   /gene="2610028H24Rik"
FT                   /locus_tag="mCG_3128"
FT                   /note="gene_id=mCG3128.2"
FT   mRNA            join(17737001..17737196,17738508..17738544,
FT                   17739188..17739261,17740659..17740823,17742580..17742694,
FT                   17745376..17745491,17745755..17746037,17748362..17749282)
FT                   /gene="2610028H24Rik"
FT                   /locus_tag="mCG_3128"
FT                   /product="RIKEN cDNA 2610028H24"
FT                   /note="gene_id=mCG3128.2 transcript_id=mCT1723.2 created on
FT                   24-OCT-2002"
FT   CDS             join(17737134..17737196,17738508..17738544,
FT                   17739188..17739261,17740659..17740823,17742580..17742694,
FT                   17745376..17745491,17745755..17745997)
FT                   /codon_start=1
FT                   /gene="2610028H24Rik"
FT                   /locus_tag="mCG_3128"
FT                   /product="RIKEN cDNA 2610028H24"
FT                   /note="gene_id=mCG3128.2 transcript_id=mCT1723.2
FT                   protein_id=mCP9300.1"
FT                   /db_xref="GOA:G5E8K1"
FT                   /db_xref="InterPro:IPR027904"
FT                   /db_xref="MGI:MGI:1924214"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8K1"
FT                   /protein_id="EDL31851.1"
FT                   /translation="MTLDSSMADQMTRLRLQLLEQMLEQERDSMDRAGQQEKSDTALQS
FT                   ALRRRKDLLQRLWEQQLMDEHSPAHAWRMHGRAAVPTLNPEVPPTDVFPAASPPLPRPP
FT                   EPPRIIQHPVPQAPATIIQQLPQQQPLIAQISPPQAFPTPRSGSIKEDMVEMMLMQNAQ
FT                   MHQILMQNMMLKALPPGSSGPRAATLQDQRWMHHGVPRAEKQKPPPVHHHHHYAPTTQL
FT                   PAASTAGAPAGYAMWPPVVAATAFPHAASFLPTVSHLTEASTSHPSYP"
FT   gene            complement(17750037..17756741)
FT                   /gene="A130042E20Rik"
FT                   /locus_tag="mCG_3126"
FT                   /note="gene_id=mCG3126.2"
FT   mRNA            complement(join(17750037..17751194,17752132..17752200,
FT                   17754112..17754240,17756032..17756261,17756649..17756741))
FT                   /gene="A130042E20Rik"
FT                   /locus_tag="mCG_3126"
FT                   /product="RIKEN cDNA A130042E20"
FT                   /note="gene_id=mCG3126.2 transcript_id=mCT1726.2 created on
FT                   24-OCT-2002"
FT   CDS             complement(join(17751108..17751194,17752132..17752200,
FT                   17754112..17754240,17756032..17756241))
FT                   /codon_start=1
FT                   /gene="A130042E20Rik"
FT                   /locus_tag="mCG_3126"
FT                   /product="RIKEN cDNA A130042E20"
FT                   /note="gene_id=mCG3126.2 transcript_id=mCT1726.2
FT                   protein_id=mCP9290.2"
FT                   /protein_id="EDL31850.1"
FT                   /translation="MSLVIKNLQRVVPIRRVPLRRKMDLVRSILGVKKFDLGIICVDNK
FT                   TIQNINRIYRNKNVPTDVLSFSFHENLKAGEFPQPHSPDDYNLGDIFLGVEYILQHCRE
FT                   SEDYCDVLTVTATHGLCHLLGFTHSSKAEWQKMYNQEKLVLEELSRYTGARLQPLSRGL
FT                   Y"
FT   gene            17756813..17803734
FT                   /gene="Mcm3ap"
FT                   /locus_tag="mCG_3107"
FT                   /note="gene_id=mCG3107.2"
FT   mRNA            join(17756813..17757089,17757824..17759127,
FT                   17759298..17759524,17764389..17764467,17764658..17764799,
FT                   17765595..17765785,17768876..17769015,17770499..17770696,
FT                   17770990..17771258,17772529..17772691,17776217..17776377,
FT                   17777210..17777451,17777743..17777942,17778603..17778703,
FT                   17780736..17780867,17781305..17781418,17784283..17784435,
FT                   17787331..17787528,17788937..17789005,17789085..17789219,
FT                   17790527..17790680,17792038..17792296,17792505..17792602,
FT                   17794173..17794563,17795165..17795422,17796173..17796302,
FT                   17798895..17799098,17800293..17800443,17803458..17803734)
FT                   /gene="Mcm3ap"
FT                   /locus_tag="mCG_3107"
FT                   /product="minichromosome maintenance deficient 3 (S.
FT                   cerevisiae) associated protein, transcript variant mCT1749"
FT                   /note="gene_id=mCG3107.2 transcript_id=mCT1749.1 created on
FT                   23-SEP-2002"
FT   mRNA            join(17756813..17757089,17757824..17759127,
FT                   17759298..17759524,17764389..17764467,17764658..17764799,
FT                   17765595..17765785,17768876..17769015,17770499..17770696,
FT                   17770990..17771258,17772529..17772691,17776217..17776377,
FT                   17777210..17777451,17777743..17777942,17778603..17778703,
FT                   17780736..17780867,17781305..17781418,17784283..17784435,
FT                   17787331..17787528,17788937..17789005,17789085..17789219,
FT                   17790527..17790680,17792038..17792296,17792505..17792602,
FT                   17794173..17794563,17795165..17795422,17796173..17796302,
FT                   17800293..17800443,17803458..17803734)
FT                   /gene="Mcm3ap"
FT                   /locus_tag="mCG_3107"
FT                   /product="minichromosome maintenance deficient 3 (S.
FT                   cerevisiae) associated protein, transcript variant
FT                   mCT173626"
FT                   /note="gene_id=mCG3107.2 transcript_id=mCT173626.0 created
FT                   on 23-SEP-2002"
FT   CDS             join(17757930..17759127,17759298..17759524,
FT                   17764389..17764467,17764658..17764799,17765595..17765785,
FT                   17768876..17769015,17770499..17770696,17770990..17771258,
FT                   17772529..17772691,17776217..17776377,17777210..17777451,
FT                   17777743..17777942,17778603..17778703,17780736..17780867,
FT                   17781305..17781418,17784283..17784435,17787331..17787528,
FT                   17788937..17789005,17789085..17789219,17790527..17790680,
FT                   17792038..17792296,17792505..17792602,17794173..17794563,
FT                   17795165..17795422,17796173..17796302,17798895..17799098,
FT                   17800293..17800443,17803458..17803616)
FT                   /codon_start=1
FT                   /gene="Mcm3ap"
FT                   /locus_tag="mCG_3107"
FT                   /product="minichromosome maintenance deficient 3 (S.
FT                   cerevisiae) associated protein, isoform CRA_b"
FT                   /note="gene_id=mCG3107.2 transcript_id=mCT1749.1
FT                   protein_id=mCP9284.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9WUU9"
FT                   /db_xref="InterPro:IPR005062"
FT                   /db_xref="MGI:MGI:1930089"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WUU9"
FT                   /protein_id="EDL31849.1"
FT                   /translation="MHPVNPFGGQQPSAFAVSSSTTGTYQTKSPFRFGQPSLFGQNSTP
FT                   SKSLAFSQVPSFATPSGGSHSSSLPAFGLTQTSSVGLFSSLESTPSFAATSSSSVPGNT
FT                   AFSFKSTSSVGVFPSGATFGPETGEVAGSGFRKTEFKFKPLENAVFKPIPGPESEPEKT
FT                   QSQISSGFFTFSHPVGSGSGGLTPFSFPQVTNSSVTSSSFIFSKPVTSNTPAFASPLSN
FT                   QNVEEEKRVSTSAFGSSNSSFSTFPTASPGSLGEPFPANKPSLRQGCEEAISQVEPLPT
FT                   LMKGLKRKEDQDRSPRRHCHEAAEDPDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQEV
FT                   FKSNKEAGRLGSKESKESGFAEPGESDHAAVPGGSQSTMVPSRLPAVTKEEEESRDEKE
FT                   DSLRGKSVRQSKRREEWIYSLGGVSSLELTAIQCKNIPDYLNDRAILEKHFSKIAKVQR
FT                   VFTRRSKKLAVIHFFDHASAALARKKGKGLHKDVVIFWHKKKISPSKKLFPLKEKLGES
FT                   EASQGIEDSPFQHSPLSKPIVRPAAGSLLSKSSPVKKPSLLKMHQFEADPFDSGSEGSE
FT                   GLGSCVSSLSTLIGTVADTSEEKYRLLDQRDRIMRQARVKRTDLDKARAFVGTCPDMCP
FT                   EKERYLRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPSAVLSRTM
FT                   DYLVTQIMDQKEGSLRDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAH
FT                   FMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLNLNKGD
FT                   ILREVQQFHPDVRNSPEVNFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFNQIR
FT                   KDALRALNVAYTVSTQRSTVFPLDGVVRMLLFRDSEEATNFLNYHGLTVADGCVELNRS
FT                   AFLEPEGLCKARKSVFIGRKLTVSVGEVVNGGPLPPVPRHTPVCSFNSQNKYVGESLAT
FT                   ELPISTQRAGGDPAGGGRGEDCEAEVDVPTLAVLPQPPPASSATPALHVQPLAPAAAPS
FT                   LLQASTQPEVLLPKPAPVYSDSDLVQVVDELIQEALQVDCEEVSSAGAAYVAAALGVSN
FT                   AAVEDLITAATTGILRHVAAEEVSMERQRLEEEKQRAEEERLKQERELMLTQLSEGLAA
FT                   ELTELTVTECVWETCSQELQSAVEIDQKVRVARCCEAVCAHLVDLFLAEEIFQTAKETL
FT                   QELQCFCKYLQRWREAVAARKKFRRQMRAFPAAPCCVDVNDRLQALVPSAECPITEENL
FT                   AKGLLDLGHAGKVGVSCTRLRRLRNKTAHQIKVQHFHQQLLRNAAWAPLDLPSIVSEHL
FT                   PMKQKRRFWKLVLVLPDVEEQTPESPGRILENWLKVKFTGDDSMVGDIGDNAGDIQTLS
FT                   VFNTLSSKGDQTVSVNVCIKVAHGTLSDSALDAVETQKDLLGTSGLMLLLPPKVKSEEV
FT                   AEEELSWLSALLQLKQLLQAKPFQPALPLVVLVPSSRGDSAGRAVEDGLMLQDLVSAKL
FT                   ISDYIVVEIPDSVNDLQGTVKVSGAVQWLISRCPQALDLCCQTLVQYVEDGISREFSRR
FT                   FFHDRRERRLASLPSQEPSTIIELFNSVLQFLASVVSSEQLCDISWPVMEFAEVGGSQL
FT                   LPHLHWNSPEHLAWLKQAVLGFQLPQMDLPPPGAPWLPVCSMVIQYTSQIPSSSQTQPV
FT                   LQSQVENLLCRTYQKWKNKSLSPGQELGPSVAEIPWDDIITLCINHKLRDWTPPRLPVT
FT                   LEALSEDGQICVYFFKNLLRKYHVPLSWEQARMQTQRELQLSHGRSGMRSIHPPTSTFP
FT                   TPLLHVHQKGKKKEESGREGSLSTEDLLRGASAEELLAQSLSSSLLEEKEENKRFEDQL
FT                   QQWLSQDSQAFTESTRLPLYLPQTLVSFPDSIKTQTMVKTSTSPQNSGTGKQLRFSEAS
FT                   GSSLTEKLKLLERLIQSSRAEEAASELHLSALLEMVDM"
FT   CDS             join(17757930..17759127,17759298..17759524,
FT                   17764389..17764467,17764658..17764799,17765595..17765785,
FT                   17768876..17769015,17770499..17770696,17770990..17771258,
FT                   17772529..17772691,17776217..17776377,17777210..17777451,
FT                   17777743..17777942,17778603..17778703,17780736..17780867,
FT                   17781305..17781418,17784283..17784435,17787331..17787528,
FT                   17788937..17789005,17789085..17789219,17790527..17790680,
FT                   17792038..17792296,17792505..17792602,17794173..17794563,
FT                   17795165..17795422,17796173..17796302,17800293..17800443,
FT                   17803458..17803616)
FT                   /codon_start=1
FT                   /gene="Mcm3ap"
FT                   /locus_tag="mCG_3107"
FT                   /product="minichromosome maintenance deficient 3 (S.
FT                   cerevisiae) associated protein, isoform CRA_a"
FT                   /note="gene_id=mCG3107.2 transcript_id=mCT173626.0
FT                   protein_id=mCP96545.0 isoform=CRA_a"
FT                   /protein_id="EDL31848.1"
FT                   /translation="MHPVNPFGGQQPSAFAVSSSTTGTYQTKSPFRFGQPSLFGQNSTP
FT                   SKSLAFSQVPSFATPSGGSHSSSLPAFGLTQTSSVGLFSSLESTPSFAATSSSSVPGNT
FT                   AFSFKSTSSVGVFPSGATFGPETGEVAGSGFRKTEFKFKPLENAVFKPIPGPESEPEKT
FT                   QSQISSGFFTFSHPVGSGSGGLTPFSFPQVTNSSVTSSSFIFSKPVTSNTPAFASPLSN
FT                   QNVEEEKRVSTSAFGSSNSSFSTFPTASPGSLGEPFPANKPSLRQGCEEAISQVEPLPT
FT                   LMKGLKRKEDQDRSPRRHCHEAAEDPDPLSRGDHPPDKRPVRLNRPRGGTLFGRTIQEV
FT                   FKSNKEAGRLGSKESKESGFAEPGESDHAAVPGGSQSTMVPSRLPAVTKEEEESRDEKE
FT                   DSLRGKSVRQSKRREEWIYSLGGVSSLELTAIQCKNIPDYLNDRAILEKHFSKIAKVQR
FT                   VFTRRSKKLAVIHFFDHASAALARKKGKGLHKDVVIFWHKKKISPSKKLFPLKEKLGES
FT                   EASQGIEDSPFQHSPLSKPIVRPAAGSLLSKSSPVKKPSLLKMHQFEADPFDSGSEGSE
FT                   GLGSCVSSLSTLIGTVADTSEEKYRLLDQRDRIMRQARVKRTDLDKARAFVGTCPDMCP
FT                   EKERYLRETRSQLSVFEVVPGTDQVDHAAAVKEYSRSSADQEEPLPHELRPSAVLSRTM
FT                   DYLVTQIMDQKEGSLRDWYDFVWNRTRGIRKDITQQHLCDPLTVSLIEKCTRFHIHCAH
FT                   FMCEEPMSSFDAKINNENMTKCLQSLKEMYQDLRNKGVFCASEAEFQGYNVLLNLNKGD
FT                   ILREVQQFHPDVRNSPEVNFAVQAFAALNSNNFVRFFKLVQSASYLNACLLHCYFNQIR
FT                   KDALRALNVAYTVSTQRSTVFPLDGVVRMLLFRDSEEATNFLNYHGLTVADGCVELNRS
FT                   AFLEPEGLCKARKSVFIGRKLTVSVGEVVNGGPLPPVPRHTPVCSFNSQNKYVGESLAT
FT                   ELPISTQRAGGDPAGGGRGEDCEAEVDVPTLAVLPQPPPASSATPALHVQPLAPAAAPS
FT                   LLQASTQPEVLLPKPAPVYSDSDLVQVVDELIQEALQVDCEEVSSAGAAYVAAALGVSN
FT                   AAVEDLITAATTGILRHVAAEEVSMERQRLEEEKQRAEEERLKQERELMLTQLSEGLAA
FT                   ELTELTVTECVWETCSQELQSAVEIDQKVRVARCCEAVCAHLVDLFLAEEIFQTAKETL
FT                   QELQCFCKYLQRWREAVAARKKFRRQMRAFPAAPCCVDVNDRLQALVPSAECPITEENL
FT                   AKGLLDLGHAGKVGVSCTRLRRLRNKTAHQIKVQHFHQQLLRNAAWAPLDLPSIVSEHL
FT                   PMKQKRRFWKLVLVLPDVEEQTPESPGRILENWLKVKFTGDDSMVGDIGDNAGDIQTLS
FT                   VFNTLSSKGDQTVSVNVCIKVAHGTLSDSALDAVETQKDLLGTSGLMLLLPPKVKSEEV
FT                   AEEELSWLSALLQLKQLLQAKPFQPALPLVVLVPSSRGDSAGRAVEDGLMLQDLVSAKL
FT                   ISDYIVVEIPDSVNDLQGTVKVSGAVQWLISRCPQALDLCCQTLVQYVEDGISREFSRR
FT                   FFHDRRERRLASLPSQEPSTIIELFNSVLQFLASVVSSEQLCDISWPVMEFAEVGGSQL
FT                   LPHLHWNSPEHLAWLKQAVLGFQLPQMDLPPPGAPWLPVCSMVIQYTSQIPSSSQTQPV
FT                   LQSQVENLLCRTYQKWKNKSLSPGQELGPSVAEIPWDDIITLCINHKLRDWTPPRLPVT
FT                   LEALSEDGQICVYFFKNLLRKYHVPLSWEQARMQTQRELQLSHGRFEDQLQQWLSQDSQ
FT                   AFTESTRLPLYLPQTLVSFPDSIKTQTMVKTSTSPQNSGTGKQLRFSEASGSSLTEKLK
FT                   LLERLIQSSRAEEAASELHLSALLEMVDM"
FT   gene            17819607..17845139
FT                   /gene="Lss"
FT                   /locus_tag="mCG_3123"
FT                   /note="gene_id=mCG3123.2"
FT   mRNA            join(17819607..17819675,17819851..17820019,
FT                   17821514..17821652,17823560..17823668,17824245..17824366,
FT                   17826353..17826449,17827786..17827921,17828313..17828421,
FT                   17828847..17828965,17829820..17829917,17830469..17830496,
FT                   17831852..17831908,17832466..17832537,17833452..17833502,
FT                   17834063..17834212,17834764..17834860,17835436..17835541,
FT                   17837221..17837286,17837804..17837884,17838586..17838756,
FT                   17840321..17840399,17840938..17845139)
FT                   /gene="Lss"
FT                   /locus_tag="mCG_3123"
FT                   /product="lanosterol synthase"
FT                   /note="gene_id=mCG3123.2 transcript_id=mCT1729.2 created on
FT                   24-OCT-2002"
FT   CDS             join(17819662..17819675,17819851..17820019,
FT                   17821514..17821652,17823560..17823668,17824245..17824366,
FT                   17826353..17826449,17827786..17827921,17828313..17828421,
FT                   17828847..17828965,17829820..17829917,17830469..17830496,
FT                   17831852..17831908,17832466..17832537,17833452..17833502,
FT                   17834063..17834212,17834764..17834860,17835436..17835541,
FT                   17837221..17837286,17837804..17837884,17838586..17838756,
FT                   17840321..17840399,17840938..17841069)
FT                   /codon_start=1
FT                   /gene="Lss"
FT                   /locus_tag="mCG_3123"
FT                   /product="lanosterol synthase"
FT                   /note="gene_id=mCG3123.2 transcript_id=mCT1729.2
FT                   protein_id=mCP9261.2"
FT                   /protein_id="EDL31847.1"
FT                   /translation="MTEGTCLRRRGGPYKTEPATDLTRWRLQNELGRQRWTYYQAEDDP
FT                   GREQTGLEAHSLGLDTRSYFTDLPKAQTAHEGALNGVTFYAKLQAEDGHWAGDYGGPLF
FT                   LLPGLLITCHISHISLPAGYREEMVRYLRSVQLPDGGWGLHIEDKSTVFGTALNYVALR
FT                   ILGIGPDDPDLVRARNVLHKKGGAVAIPSWGKFWLAVLNVYSWEGLNTLFPEMWLFPEW
FT                   VPAHPSTLWCHCRQVYLPMSYCYATRLSASEDPLVQSLRQELYVQDYASIDWPAQRNNV
FT                   SPDEMYTPHSWLLHVVYGLLNLYERFHSTSLRKWAVQMLYEHIAADDCFTKCISIGPIS
FT                   KTINMLVRWSVDGPSSPAFQEHVSRIKDYLWLGLDGMKMQGTNGSQIWDTSFAIQALLE
FT                   AGAHHRPEFLPCLQKAHEFLRLSQVPENCPDYQKYYRHMRKGGFSFSTLDCGWIVADCT
FT                   AEGLKAVLLLQNQCPSITEHIPRERLCDAVDVLLSLRNADGGFATYEKKRGGYLLELLN
FT                   PSEVFGDIMIDYTYVECTSAVMQALKHFHEHFPDYRAAEVRETLNQGLDFCRRKQRADG
FT                   SWEGSWGVCFTYGTWFGLEAFACMGHTYQDGAACAEVAQACNFLLSQQMADGGWGEDFE
FT                   SCEQRRYVQSARSQVHSTCWALMGLMAVRHPDITAQERGIRCLLGKQLPNGDWPQENIS
FT                   GVFNKSCAISYTSYRNIFPIWALGRFSNLYPDNTLAGHI"
FT   gene            complement(17833870..>17850230)
FT                   /locus_tag="mCG_146038"
FT                   /note="gene_id=mCG146038.0"
FT   mRNA            complement(join(17833870..17834801,17842977..17843064,
FT                   17843204..17843308,17850114..>17850230))
FT                   /locus_tag="mCG_146038"
FT                   /product="mCG146038"
FT                   /note="gene_id=mCG146038.0 transcript_id=mCT186146.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(17834475..17834801,17842977..>17843000))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146038"
FT                   /product="mCG146038"
FT                   /note="gene_id=mCG146038.0 transcript_id=mCT186146.0
FT                   protein_id=mCP107465.0"
FT                   /protein_id="EDL31846.1"
FT                   /translation="ELLLDSYLVANPPSAFLKLSNWNERAPRQLSGQGRRDLAEAPLTA
FT                   NRTGMRDKKPVSVCGRCPVQLHNIWRHTLISGQYSMGKYIQEADMPKGLCIKKNRHLQF
FT                   FGYPAKTTKPPK"
FT   gene            17850273..17858201
FT                   /gene="1700027D21Rik"
FT                   /locus_tag="mCG_3112"
FT                   /note="gene_id=mCG3112.2"
FT   mRNA            join(17850273..17850568,17851849..17852196,
FT                   17857337..17857488,17857667..17858201)
FT                   /gene="1700027D21Rik"
FT                   /locus_tag="mCG_3112"
FT                   /product="RIKEN cDNA 1700027D21, transcript variant
FT                   mCT1745"
FT                   /note="gene_id=mCG3112.2 transcript_id=mCT1745.1 created on
FT                   24-OCT-2002"
FT   mRNA            join(17850273..17850568,17851849..17852132,
FT                   17857337..17857488,17857667..17858201)
FT                   /gene="1700027D21Rik"
FT                   /locus_tag="mCG_3112"
FT                   /product="RIKEN cDNA 1700027D21, transcript variant
FT                   mCT174813"
FT                   /note="gene_id=mCG3112.2 transcript_id=mCT174813.0 created
FT                   on 24-OCT-2002"
FT   CDS             join(17850367..17850568,17851849..17852196,
FT                   17857337..17857488,17857667..17857993)
FT                   /codon_start=1
FT                   /gene="1700027D21Rik"
FT                   /locus_tag="mCG_3112"
FT                   /product="RIKEN cDNA 1700027D21, isoform CRA_a"
FT                   /note="gene_id=mCG3112.2 transcript_id=mCT1745.1
FT                   protein_id=mCP9216.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D9W0"
FT                   /db_xref="InterPro:IPR026715"
FT                   /db_xref="InterPro:IPR029384"
FT                   /db_xref="InterPro:IPR029385"
FT                   /db_xref="MGI:MGI:1923823"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D9W0"
FT                   /protein_id="EDL31844.1"
FT                   /translation="MAEGSELMSRLMSENADLKKQVRLLKENQMLKRLLSESCQESCGR
FT                   GSRDLLYPKVPTYPEACSPGNGGPDFGRFAGVPDTPSQLPTSSLEDLLCSHAPLSSEDE
FT                   ASPGCATTSQMPFKSFLSPSELHSRIADRKLSPLLSPLQDSLADKTLLEPREISRPKKV
FT                   CFSESNLPTGDRSRRTYYLNEIQSFSGAEKDGRIVGEIAFQLDRRILAYVFPGVTRLYG
FT                   FTVSNIPEKIKQTSIKSLDGSVDEKKLRELTHRYLTLTARLEKLGYSREVHPVFSEFLI
FT                   NTYGILKQRPDLRANPLHSSPAALRKLVIDIVPPKFLGDSLLLLNCLCELSKEDSKPLF
FT                   AW"
FT   CDS             join(17850367..17850568,17851849..17852132,
FT                   17857337..17857438)
FT                   /codon_start=1
FT                   /gene="1700027D21Rik"
FT                   /locus_tag="mCG_3112"
FT                   /product="RIKEN cDNA 1700027D21, isoform CRA_b"
FT                   /note="gene_id=mCG3112.2 transcript_id=mCT174813.0
FT                   protein_id=mCP97732.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z7D4"
FT                   /db_xref="InterPro:IPR026715"
FT                   /db_xref="InterPro:IPR029385"
FT                   /db_xref="MGI:MGI:1923823"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z7D4"
FT                   /protein_id="EDL31845.1"
FT                   /translation="MAEGSELMSRLMSENADLKKQVRLLKENQMLKRLLSESCQESCGR
FT                   GSRDLLYPKVPTYPEACSPGNGGPDFGRFAGVPDTPSQLPTSSLEDLLCSHAPLSSEDE
FT                   ASPGCATTSQMPFKSFLSPSELHSRIADRKLSPLLSPLQDSLADKTLLEPREISRPKKR
FT                   SRVFRVLRRMAESLGRSRSSLTGVSWPMCSQG"
FT   gene            17863648..17878166
FT                   /gene="Ftcd"
FT                   /locus_tag="mCG_3129"
FT                   /note="gene_id=mCG3129.2"
FT   mRNA            join(17863648..17863760,17864502..17864685,
FT                   17865999..17866127,17867780..17867868,17867987..17868166,
FT                   17869292..17869429,17869500..17869631,17872418..17872479,
FT                   17872777..17872906,17873139..17873300,17875740..17875783,
FT                   17875908..17876046,17876677..17876772,17877833..17878166)
FT                   /gene="Ftcd"
FT                   /locus_tag="mCG_3129"
FT                   /product="formiminotransferase cyclodeaminase"
FT                   /note="gene_id=mCG3129.2 transcript_id=mCT1724.2 created on
FT                   23-SEP-2002"
FT   CDS             join(17863707..17863760,17864502..17864685,
FT                   17865999..17866127,17867780..17867868,17867987..17868166,
FT                   17869292..17869429,17869500..17869631,17872418..17872479,
FT                   17872777..17872906,17873139..17873300,17875740..17875783,
FT                   17875908..17876046,17876677..17876772,17877833..17877919)
FT                   /codon_start=1
FT                   /gene="Ftcd"
FT                   /locus_tag="mCG_3129"
FT                   /product="formiminotransferase cyclodeaminase"
FT                   /note="gene_id=mCG3129.2 transcript_id=mCT1724.2
FT                   protein_id=mCP9281.2"
FT                   /protein_id="EDL31843.1"
FT                   /translation="MSQLVECVPNFSEGNNQEVIDAISRAISQTPGCVLLDVDAGPSTN
FT                   RTVYTFVGQPECVVEGALHAARTASQLIDMSKHKGEHPRMGALDVCPFIPVRGVSMEEC
FT                   VLCAKAFGQRLAEELNVPVYLYGEAAQTPSRQTLPAIRAGEYEALPEKLKQAEWVPDFG
FT                   PSSFVPSWGATVTGARKFLIAFNINLLSTKEQAHRIALNLREQGRGKDQPGRLKKVQGI
FT                   GWYLEEKNLAQVSTNLLDFEVTALHTVFEEARREAQELNLPVVGSQLVGLVPLKALLDA
FT                   AAFYCDKEKLFVLEEEHRIRLVVNRLGLDSLAPFDPKERIIEYLVPDSGPEQSLLDTSL
FT                   RGFVREVGARSAAPGGGSVAAAVAALGAALASMVGQMTYGRRQFDHLDSTMRRLIPPFH
FT                   AASAQLTSLVDADARAFAACLEAIKLPKNTPEERDRRACALQEGLRQAVAVPLKLAETV
FT                   SQLWPALQELAHCGNLSCLSDLQVAAKALETGVFGAYFNVLINLKDMTDDVFKEKTHHR
FT                   ISSLLQEAKTQAALVLGSLEARKE"
FT   gene            complement(17884358..17911760)
FT                   /gene="Col6a2"
FT                   /locus_tag="mCG_3117"
FT                   /note="gene_id=mCG3117.2"
FT   mRNA            complement(join(17884358..17885416,17891934..17891972,
FT                   17892067..17892519,17892661..17892813,17892950..17892995,
FT                   17893454..17893489,17893665..17893727,17894379..17894441,
FT                   17894777..17894812,17895180..17895230,17895700..17895762,
FT                   17896332..17896394,17896712..17896774,17897313..17897375,
FT                   17897862..17897951,17898125..17898187,17898765..17898827,
FT                   17899255..17899308,17899634..17899678,17899768..17899794,
FT                   17900021..17900047,17900397..17900441,17900553..17900606,
FT                   17901860..17901925,17902714..17902734,17902942..17903540,
FT                   17903651..17903823,17911686..17911760))
FT                   /gene="Col6a2"
FT                   /locus_tag="mCG_3117"
FT                   /product="procollagen, type VI, alpha 2"
FT                   /note="gene_id=mCG3117.2 transcript_id=mCT1736.2 created on
FT                   24-OCT-2002"
FT   CDS             complement(join(17884818..17885416,17891934..17891972,
FT                   17892067..17892519,17892661..17892813,17892950..17892995,
FT                   17893454..17893489,17893665..17893727,17894379..17894441,
FT                   17894777..17894812,17895180..17895230,17895700..17895762,
FT                   17896332..17896394,17896712..17896774,17897313..17897375,
FT                   17897862..17897951,17898125..17898187,17898765..17898827,
FT                   17899255..17899308,17899634..17899678,17899768..17899794,
FT                   17900021..17900047,17900397..17900441,17900553..17900606,
FT                   17901860..17901925,17902714..17902734,17902942..17903540,
FT                   17903651..17903810))
FT                   /codon_start=1
FT                   /gene="Col6a2"
FT                   /locus_tag="mCG_3117"
FT                   /product="procollagen, type VI, alpha 2"
FT                   /note="gene_id=mCG3117.2 transcript_id=mCT1736.2
FT                   protein_id=mCP9291.2"
FT                   /protein_id="EDL31842.1"
FT                   /translation="MTTIKMLQGPLSVLLIGGLLGVLHAQQQEAISPQEQEAVSPDIST
FT                   TERNNNCPEKADCPVNVYFVLDTSESVAMQSPTDSLLYHMQQFVPQFISQLQNEFYLDQ
FT                   VALSWRYGGLHFSDQVEVFSPPGSDRASFTKSLQGIRSFRRGTFTDCALANMTQQIRQH
FT                   VGKGVVNFAVVITDGHVTGSPCGGIKMQAERAREEGIRLFAVAPNRNLNEQGLRDIANS
FT                   PHELYRNNYATMRPDSTEIDQDTINRIIKVMKHEAYGECYKVSCLEIPGPHGPKGYRGQ
FT                   KGAKGNMGEPGEPGQKGRQGDPGIEGPIGFPGPKGVPGFKGEKGEFGSDGRKGAPGLAG
FT                   KNGTDGQKGKLGRIGPPGCKGDPGSRGPDGYPGEAGSPGERGDQGAKGDSGRPGRRGPP
FT                   GDPGDKGSKGYQGNNGAPGSPGVKGGKGGPGPRGPKGEPGRRGDPGTKGGPGSDGPKGE
FT                   KGDPGPEGPRGLAGEVGSKGAKGDRGLPGPRGPQGALGEPGKQGSRGDPGDAGPRGDSG
FT                   QPGPKGDPGRPGFSYPGPRGTPGEKGEPGPPGPEGGRGDFGLKGTPGRKGDKGEPADPG
FT                   PPGEPGPRGPRGIPGPEGEPGPPGDPGLTECDVMTYVRETCGCCDCEKRCGALDVVFVI
FT                   DSSESIGYTNFTLEKNFVINVVNRLGAIAKDPKSETGTRVGVVQYSHEGTFEAIRLDDE
FT                   RVNSLSSFKEAVKNLEWIAGGTWTPSALKFAYNQLIKESRRQKTRVFAVVITDGRHDPR
FT                   DDDLNLRALCDRDVTVTAIGIGDMFHETHESENLYSIACDKPQQVRNMTLFSDLVAEKF
FT                   IDDMEDVLCPDPQIVCPELPCQTELYVAQCTQRPVDIVFLLDGSERLGEQNFHKVRRFV
FT                   EDVSRRLTLARRDDDPLNARMALLQYGSQNQQQVAFPLTYNVTTIHEALERATYLNSFS
FT                   HVGTGIVHAINNVVRGARGGARRHAELSFVFLTDGVTGNDSLEESVHSMRKQNVVPTVV
FT                   AVGGDVDMDVLTKISLGDRAAIFREKDFDSLAQPSFFDRFIRWIC"
FT   gene            complement(17996514..18013893)
FT                   /gene="Col6a1"
FT                   /locus_tag="mCG_3104"
FT                   /note="gene_id=mCG3104.2"
FT   mRNA            complement(join(17996514..17997906,17998071..17998100,
FT                   17998687..17998864,17999008..17999191,17999300..17999409,
FT                   17999993..18000126,18000590..18000598,18000910..18000946,
FT                   18001351..18001386,18001598..18001663,18001839..18001901,
FT                   18002139..18002174,18002383..18002433,18002720..18002782,
FT                   18002996..18003058,18003986..18004048,18004444..18004506,
FT                   18004854..18004889,18004987..18005040,18005125..18005187,
FT                   18005520..18005582,18005784..18005837,18006098..18006142,
FT                   18006242..18006268,18006704..18006730,18006850..18006894,
FT                   18007348..18007401,18008686..18008730,18008813..18008833,
FT                   18008988..18009008,18009128..18009256,18009541..18009700,
FT                   18011101..18011301,18012664..18012793,18013545..18013893))
FT                   /gene="Col6a1"
FT                   /locus_tag="mCG_3104"
FT                   /product="procollagen, type VI, alpha 1, transcript variant
FT                   mCT1747"
FT                   /note="gene_id=mCG3104.2 transcript_id=mCT1747.2 created on
FT                   23-SEP-2002"
FT   mRNA            complement(join(17996514..17997906,17998071..17998100,
FT                   17998687..17998864,17999008..17999191,17999300..17999409,
FT                   17999993..18000126,18000590..18000598,18000910..18000946,
FT                   18001351..18001386,18001598..18001663,18001839..18001901,
FT                   18002139..18002174,18002383..18002433,18002720..18002782,
FT                   18002996..18003058,18003986..18004048,18004444..18004506,
FT                   18004854..18004889,18004987..18005040,18005125..18005187,
FT                   18005520..18005582,18005784..18005837,18006098..18006142,
FT                   18006242..18006268,18006704..18006730,18006850..18006935,
FT                   18009442..18009700,18011101..18011301,18012664..18012793,
FT                   18013545..18013893))
FT                   /gene="Col6a1"
FT                   /locus_tag="mCG_3104"
FT                   /product="procollagen, type VI, alpha 1, transcript variant
FT                   mCT173625"
FT                   /note="gene_id=mCG3104.2 transcript_id=mCT173625.0 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(17996517..17997906,17998071..17998100,
FT                   17998687..17998864,17999008..17999191,17999300..17999409,
FT                   17999993..18000126,18000906..18000946,18001351..18001386,
FT                   18001598..18001663,18001839..18001901,18002139..18002174,
FT                   18002383..18002433,18002720..18002782,18002996..18003058,
FT                   18003986..18004048,18004444..18004506,18004854..18004889,
FT                   18004987..18005040,18005125..18005187,18005520..18005582,
FT                   18005784..18005837,18006098..18006142,18006242..18006268,
FT                   18006704..18006730,18006850..18006894,18007348..18007401,
FT                   18008686..18008730,18008813..18008833,18008988..18009008,
FT                   18009128..18009256,18009541..18009700,18011101..18011301,
FT                   18012664..18012793,18013545..>18013769))
FT                   /gene="Col6a1"
FT                   /locus_tag="mCG_3104"
FT                   /product="procollagen, type VI, alpha 1, transcript variant
FT                   mCT192943"
FT                   /note="gene_id=mCG3104.2 transcript_id=mCT192943.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(17997284..17997906,17998071..17998100,
FT                   17998687..17998864,17999008..17999191,17999300..17999409,
FT                   17999993..18000126,18000590..18000598,18000910..18000946,
FT                   18001351..18001386,18001598..18001663,18001839..18001901,
FT                   18002139..18002174,18002383..18002433,18002720..18002782,
FT                   18002996..18003058,18003986..18004048,18004444..18004506,
FT                   18004854..18004889,18004987..18005040,18005125..18005187,
FT                   18005520..18005582,18005784..18005837,18006098..18006142,
FT                   18006242..18006268,18006704..18006730,18006850..18006894,
FT                   18007348..18007401,18008686..18008730,18008813..18008833,
FT                   18008988..18009008,18009128..18009256,18009541..18009700,
FT                   18011101..18011301,18012664..18012793,18013545..18013638))
FT                   /codon_start=1
FT                   /gene="Col6a1"
FT                   /locus_tag="mCG_3104"
FT                   /product="procollagen, type VI, alpha 1, isoform CRA_a"
FT                   /note="gene_id=mCG3104.2 transcript_id=mCT1747.2
FT                   protein_id=mCP9248.2 isoform=CRA_a"
FT                   /protein_id="EDL31839.1"
FT                   /translation="MRLAHALLPLLLQACWVATQDIQGSKAIAFQDCPVDLFFVLDTSE
FT                   SVALRLKPYGALVDKVKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIRGLTR
FT                   MPSGRDELKASVDAVKYFGKGTYTDCAIKKGLEELLIGGSHLKENKYLIVVTDGHPLEG
FT                   YKEPCGGLEDAVNEAKHLGIKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGHSRD
FT                   AEEVISQTIDTIVDMIKNNVEQVCCSFECQAARGPPGPRGDPGYEGERGKPGLPGEKGE
FT                   AGDPGRPGDLGPVGYQGMKGEKGSRGEKGSRGPKGYKGEKGKRGIDGVDGMKGETGYPG
FT                   LPGCKGSPGFDGIQGPPGPKGDAGAFGMKGEKGEAGADGEAGRPGNSGSPGDEGDPGEP
FT                   GPPGEKGEAGDEGNAGPDGAPGERGGPGERGPRGTPGVRGPRGDPGEAGPQGDQGREGP
FT                   VGIPGDSGEAGPIGPKGYRGDEGPPGPEGLRGAPGPVGPPGDPGLMGERGEDGPPGNGT
FT                   EGFPGFPGYPGNRGPPGLNGTKGYPGLKGDEGEVGDPGEDNNDISPRGVKGAKGYRGPE
FT                   GPQGPPGHVGPPGPDECEILDIIMKMCSCCECTCGPIDILFVLDSSESIGLQNFEIAKD
FT                   FIIKVIDRLSKDELVKFEPGQSHAGVVQYSHNQMQEHVDMRSPNVRNAQDFKEAVKKLQ
FT                   WMAGGTFTGEALQYTRDRLLPPTQNNRIALVITDGRSDTQRDTTPLSVLCGADIQVVSV
FT                   GIKDVFGFVAGSDQLNVISCQGLSQGRPGISLVKENYAELLDDGFLKNITAQICIDKKC
FT                   PDYTCPITFSSPADITILLDSSASVGSHNFETTKVFAKRLAERFLSAGRADPSQDVRVA
FT                   VVQYSGQGQQQPGRAALQFLQNYTVLASSVDSMDFINDATDVNDALSYVTRFYREASSG
FT                   ATKKRVLLFSDGNSQGATAEAIEKAVQEAQRAGIEIFVVVVGPQVNEPHIRVLVTGKTA
FT                   EYDVAFGERHLFRVPNYQALLRGVLYQTVSRKVALG"
FT   CDS             complement(join(18000105..18000126,18000906..18000946,
FT                   18001351..18001386,18001598..18001663,18001839..18001901,
FT                   18002139..18002174,18002383..18002433,18002720..18002782,
FT                   18002996..18003058,18003986..18004048,18004444..18004506,
FT                   18004854..18004889,18004987..18005040,18005125..18005187,
FT                   18005520..18005582,18005784..18005837,18006098..18006142,
FT                   18006242..18006268,18006704..18006730,18006850..18006894,
FT                   18007348..18007401,18008686..18008730,18008813..18008833,
FT                   18008988..18009008,18009128..18009256,18009541..18009700,
FT                   18011101..18011301,18012664..18012793,18013545..>18013734))
FT                   /codon_start=1
FT                   /gene="Col6a1"
FT                   /locus_tag="mCG_3104"
FT                   /product="procollagen, type VI, alpha 1, isoform CRA_b"
FT                   /note="gene_id=mCG3104.2 transcript_id=mCT192943.0
FT                   protein_id=mCP113919.0 isoform=CRA_b"
FT                   /protein_id="EDL31840.1"
FT                   /translation="LQQAETTSHSAFPSAHPDPGPHLTVTRRPARNMRLAHALLPLLLQ
FT                   ACWVATQDIQGSKAIAFQDCPVDLFFVLDTSESVALRLKPYGALVDKVKSFTKRFIDNL
FT                   RDRYYRCDRNLVWNAGALHYSDEVEIIRGLTRMPSGRDELKASVDAVKYFGKGTYTDCA
FT                   IKKGLEELLIGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKHLGIKVFSVAI
FT                   TPDHLEPRLSIIATDHTYRRNFTAADWGHSRDAEEVISQTIDTIVDMIKNNVEQVCCSF
FT                   ECQAARGPPGPRGDPGYEGERGKPGLPGEKGEAGDPGRPGDLGPVGYQGMKGEKGSRGE
FT                   KGSRGPKGYKGEKGKRGIDGVDGMKGETGYPGLPGCKGSPGFDGIQGPPGPKGDAGAFG
FT                   MKGEKGEAGADGEAGRPGNSGSPGDEGDPGEPGPPGEKGEAGDEGNAGPDGAPGERGGP
FT                   GERGPRGTPGVRGPRGDPGEAGPQGDQGREGPVGIPGDSGEAGPIGPKGYRGDEGPPGP
FT                   EGLRGAPGPVGPPGDPGLMGERGEDGPPGNGTEGFPGFPGYPGNRGPPGLNGTKGYPGL
FT                   KGDEGEVGDPGEDNNDISPRGVKGAKGYRGPEGPQGPPGHVGPPGPDECEILDIIMKMC
FT                   CEVHMWTH"
FT   CDS             complement(join(18009442..18009700,18011101..18011301,
FT                   18012664..18012793,18013545..18013638))
FT                   /codon_start=1
FT                   /gene="Col6a1"
FT                   /locus_tag="mCG_3104"
FT                   /product="procollagen, type VI, alpha 1, isoform CRA_c"
FT                   /note="gene_id=mCG3104.2 transcript_id=mCT173625.0
FT                   protein_id=mCP96544.0 isoform=CRA_c"
FT                   /protein_id="EDL31841.1"
FT                   /translation="MRLAHALLPLLLQACWVATQDIQGSKAIAFQDCPVDLFFVLDTSE
FT                   SVALRLKPYGALVDKVKSFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIIRGLTR
FT                   MPSGRDELKASVDAVKYFGKGTYTDCAIKKGLEELLIGGSHLKENKYLIVVTDGHPLEG
FT                   YKEPCGGLEDAVNEAKHLGIKVFSVAITPDHLVRVPPPLIPNSQMEGLWPPGPQSTGIL
FT                   SSVTV"
FT   gene            complement(18014308..18017999)
FT                   /locus_tag="mCG_148092"
FT                   /note="gene_id=mCG148092.0"
FT   mRNA            complement(join(18014308..18016373,18017680..18017999))
FT                   /locus_tag="mCG_148092"
FT                   /product="mCG148092"
FT                   /note="gene_id=mCG148092.0 transcript_id=mCT188355.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(18014406..18014819)
FT                   /codon_start=1
FT                   /locus_tag="mCG_148092"
FT                   /product="mCG148092"
FT                   /note="gene_id=mCG148092.0 transcript_id=mCT188355.0
FT                   protein_id=mCP108322.0"
FT                   /protein_id="EDL31838.1"
FT                   /translation="MGIMAASVSIPVSVRVSINTQGHTRPCPEGLKLSLLCNHPIKEIA
FT                   QLVEAPKAKKKSHMYSMKPQPKANGLMLRLGRWVGMRLLPGRTCVHHGDIYCRAGMRRT
FT                   KDTVSLSPRSHCHFSLQTFIINDAEICNQVFVL"
FT   gene            complement(18049553..18249415)
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /note="gene_id=mCG141182.0"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113688,
FT                   18137698..18137824,18249231..18249415))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173599"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173599.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113688,
FT                   18180054..18180153,18249231..18249415))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173598"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173598.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113688,
FT                   18135212..18135288,18180054..18180153,18249231..18249271))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173600"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173600.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113688,
FT                   18135212..18135288,18136853..18137086,18137698..18137824,
FT                   18180054..18180153,18249231..18249271))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173601"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173601.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18110442..18110514))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173604"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173604.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18110439..18110514))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173606"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173606.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18110426..18110514))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173605"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173605.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18107043..18107104))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173603"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173603.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049553..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18104307..18104438))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT173602"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173602.0
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(18049556..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058732,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113688,
FT                   18135212..18135288,18136853..18137086,18137698..18137824,
FT                   18180054..18180153,18249231..>18249371))
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, transcript variant
FT                   mCT192983"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT192983.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058732,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..>18113574))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT192983.0
FT                   protein_id=mCP113950.0 isoform=CRA_c"
FT                   /protein_id="EDL31834.1"
FT                   /translation="SLPMGEGDAIWAPPILPHSTLGTLSHHPELHFGGKMESKVSEGGL
FT                   NVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIF
FT                   KAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTG
FT                   AQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPV
FT                   IFAGGQAYTIQGQYAIPHPDLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQN
FT                   LMGQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSE
FT                   RQITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113565))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173598.0
FT                   protein_id=mCP96524.0 isoform=CRA_a"
FT                   /protein_id="EDL31828.1"
FT                   /translation="MGEGDAIWAPPILPHSTLGTLSHHPELHFGGKMESKVSEGGLNVT
FT                   LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAF
FT                   AMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV
FT                   QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFA
FT                   GGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLM
FT                   GQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQ
FT                   ITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113565))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173600.0
FT                   protein_id=mCP96517.0 isoform=CRA_a"
FT                   /protein_id="EDL31829.1"
FT                   /translation="MGEGDAIWAPPILPHSTLGTLSHHPELHFGGKMESKVSEGGLNVT
FT                   LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAF
FT                   AMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV
FT                   QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFA
FT                   GGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLM
FT                   GQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQ
FT                   ITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113565))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173601.0
FT                   protein_id=mCP96518.0 isoform=CRA_a"
FT                   /protein_id="EDL31830.1"
FT                   /translation="MGEGDAIWAPPILPHSTLGTLSHHPELHFGGKMESKVSEGGLNVT
FT                   LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAF
FT                   AMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV
FT                   QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFA
FT                   GGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLM
FT                   GQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQ
FT                   ITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088610,18113556..18113565))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173599.0
FT                   protein_id=mCP96525.0 isoform=CRA_a"
FT                   /protein_id="EDL31835.1"
FT                   /translation="MGEGDAIWAPPILPHSTLGTLSHHPELHFGGKMESKVSEGGLNVT
FT                   LTIRLLMHGKEVGSIIGKKGETVKKMREESGARINISEGNCPERIVTITGPTDAIFKAF
FT                   AMIAYKFEEDIINSMSNSPATSKPPVTLRLVVPASQCGSLIGKGGSKIKEIRESTGAQV
FT                   QVAGDMLPNSTERAVTISGTPDAIIQCVKQICVVMLESPPKGATIPYRPKPASTPVIFA
FT                   GGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPFPPLGQTNPAFPGEKLPLHSSEEAQNLM
FT                   GQSSGLDASPPASTHELTIPNDLIGCIIGRQGTKINEIRQMSGAQIKIANATEGSSERQ
FT                   ITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088524))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173603.0
FT                   protein_id=mCP96521.0 isoform=CRA_b"
FT                   /protein_id="EDL31831.1"
FT                   /translation="MESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGA
FT                   RINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVV
FT                   PASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQIC
FT                   VVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPF
FT                   PPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQG
FT                   TKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088524))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173604.0
FT                   protein_id=mCP96519.0 isoform=CRA_b"
FT                   /protein_id="EDL31832.1"
FT                   /translation="MESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGA
FT                   RINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVV
FT                   PASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQIC
FT                   VVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPF
FT                   PPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQG
FT                   TKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088524))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173606.0
FT                   protein_id=mCP96523.0 isoform=CRA_b"
FT                   /protein_id="EDL31833.1"
FT                   /translation="MESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGA
FT                   RINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVV
FT                   PASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQIC
FT                   VVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPF
FT                   PPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQG
FT                   TKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088524))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173602.0
FT                   protein_id=mCP96520.0 isoform=CRA_b"
FT                   /protein_id="EDL31836.1"
FT                   /translation="MESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGA
FT                   RINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVV
FT                   PASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQIC
FT                   VVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPF
FT                   PPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQG
FT                   TKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   CDS             complement(join(18050186..18050222,18050918..18051087,
FT                   18055560..18055612,18057956..18058015,18058657..18058735,
FT                   18069528..18069569,18072836..18072910,18076087..18076215,
FT                   18077434..18077565,18085491..18085607,18086323..18086355,
FT                   18087225..18087248,18088456..18088524))
FT                   /codon_start=1
FT                   /gene="Pcbp3"
FT                   /locus_tag="mCG_141182"
FT                   /product="poly(rC) binding protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG141182.0 transcript_id=mCT173605.0
FT                   protein_id=mCP96522.0 isoform=CRA_b"
FT                   /protein_id="EDL31837.1"
FT                   /translation="MESKVSEGGLNVTLTIRLLMHGKEVGSIIGKKGETVKKMREESGA
FT                   RINISEGNCPERIVTITGPTDAIFKAFAMIAYKFEEDIINSMSNSPATSKPPVTLRLVV
FT                   PASQCGSLIGKGGSKIKEIRESTGAQVQVAGDMLPNSTERAVTISGTPDAIIQCVKQIC
FT                   VVMLESPPKGATIPYRPKPASTPVIFAGGQAYTIQGQYAIPHPDQLTKLHQLAMQQTPF
FT                   PPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTIPNDLIGCIIGRQG
FT                   TKINEIRQMSGAQIKIANATEGSSERQITITGTPANISLAQYLINARLTSEVTGMGAL"
FT   gene            complement(<18281911..>18295837)
FT                   /locus_tag="mCG_1044253"
FT                   /note="gene_id=mCG1044253.1"
FT   mRNA            complement(join(<18281911..18282031,18295690..>18295837))
FT                   /locus_tag="mCG_1044253"
FT                   /product="mCG1044253"
FT                   /note="gene_id=mCG1044253.1 transcript_id=mCT161957.1
FT                   created on 24-OCT-2002"
FT   CDS             complement(join(18281911..18282031,18295690..>18295835))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044253"
FT                   /product="mCG1044253"
FT                   /note="gene_id=mCG1044253.1 transcript_id=mCT161957.1
FT                   protein_id=mCP54965.1"
FT                   /protein_id="EDL31827.1"
FT                   /translation="RVLPGEPSDSSLSLLRRHPLSSHLNWRGVEVSLASQNCSEVCVNA
FT                   VCLGFCFALFSRSYLLLCVRRGPGWETLRQRRALGTRWEGKGV"
FT   gene            complement(18298091..18317062)
FT                   /locus_tag="mCG_1044252"
FT                   /note="gene_id=mCG1044252.1"
FT   mRNA            complement(join(18298091..18299140,18299563..18299668,
FT                   18305584..18305730,18317023..18317062))
FT                   /locus_tag="mCG_1044252"
FT                   /product="mCG1044252, transcript variant mCT161956"
FT                   /note="gene_id=mCG1044252.1 transcript_id=mCT161956.1
FT                   created on 24-OCT-2002"
FT   mRNA            complement(join(18298091..18299140,18299563..18299668,
FT                   18305584..18305730,18307557..18307730,18317023..18317062))
FT                   /locus_tag="mCG_1044252"
FT                   /product="mCG1044252, transcript variant mCT174809"
FT                   /note="gene_id=mCG1044252.1 transcript_id=mCT174809.0
FT                   created on 24-OCT-2002"
FT   CDS             complement(join(18299054..18299140,18299563..18299668,
FT                   18305584..18305591))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044252"
FT                   /product="mCG1044252, isoform CRA_a"
FT                   /note="gene_id=mCG1044252.1 transcript_id=mCT161956.1
FT                   protein_id=mCP54960.1 isoform=CRA_a"
FT                   /protein_id="EDL31825.1"
FT                   /translation="MLWIEASTEMTDPQTQANSADDEPGVSVRAEYGILEQTTPEDSEG
FT                   HSGRQHVSVQNILEQYSQGHQ"
FT   CDS             complement(join(18299054..18299140,18299563..18299668,
FT                   18305584..18305591))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044252"
FT                   /product="mCG1044252, isoform CRA_a"
FT                   /note="gene_id=mCG1044252.1 transcript_id=mCT174809.0
FT                   protein_id=mCP97728.0 isoform=CRA_a"
FT                   /protein_id="EDL31826.1"
FT                   /translation="MLWIEASTEMTDPQTQANSADDEPGVSVRAEYGILEQTTPEDSEG
FT                   HSGRQHVSVQNILEQYSQGHQ"
FT   gene            18320214..18337983
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /note="gene_id=mCG3384.2"
FT   mRNA            join(18320214..18320266,18325836..18326065,
FT                   18329302..18330055,18330268..18330460,18332247..18332388,
FT                   18337026..18337983)
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /product="solute carrier family 19 (sodium/hydrogen
FT                   exchanger), member 1, transcript variant mCT173312"
FT                   /note="gene_id=mCG3384.2 transcript_id=mCT173312.0 created
FT                   on 20-SEP-2002"
FT   mRNA            join(18320745..18320833,18325836..18326065,
FT                   18329302..18330055,18330268..18330460,18332247..18332388,
FT                   18337026..18337983)
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /product="solute carrier family 19 (sodium/hydrogen
FT                   exchanger), member 1, transcript variant mCT2273"
FT                   /note="gene_id=mCG3384.2 transcript_id=mCT2273.2 created on
FT                   20-SEP-2002"
FT   mRNA            join(18320766..18320931,18325836..18326065,
FT                   18329302..18330055,18330268..18330460,18332247..18332388,
FT                   18337026..18337983)
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /product="solute carrier family 19 (sodium/hydrogen
FT                   exchanger), member 1, transcript variant mCT173314"
FT                   /note="gene_id=mCG3384.2 transcript_id=mCT173314.0 created
FT                   on 20-SEP-2002"
FT   mRNA            join(18320803..18320936,18325836..18326065,
FT                   18329302..18330055,18330268..18330460,18332247..18332388,
FT                   18337026..18337983)
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /product="solute carrier family 19 (sodium/hydrogen
FT                   exchanger), member 1, transcript variant mCT173313"
FT                   /note="gene_id=mCG3384.2 transcript_id=mCT173313.0 created
FT                   on 20-SEP-2002"
FT   CDS             join(18325883..18326065,18329302..18330055,
FT                   18330268..18330460,18332247..18332388,18337026..18337292)
FT                   /codon_start=1
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /product="solute carrier family 19 (sodium/hydrogen
FT                   exchanger), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG3384.2 transcript_id=mCT173312.0
FT                   protein_id=mCP96231.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542F3"
FT                   /db_xref="InterPro:IPR002666"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR028339"
FT                   /db_xref="MGI:MGI:103182"
FT                   /db_xref="UniProtKB/TrEMBL:Q542F3"
FT                   /protein_id="EDL31821.1"
FT                   /translation="MVPTGQVAEKQAYEEPRQDHELKSWRCLVFYLCFFGFMAQLRPGE
FT                   SFITPFLLERKFTKEQVTNEIIPMLPYSHLAVLVPVFLLTDYLRYKPVLVLQCLSFVCV
FT                   WLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVHPSRYQRMASYSRAAVLLGVF
FT                   ISSVLGQALVTVGHISTYTLNCVSLGFILFSLVLSLFLKRPKRSLFFNRSTLARGALPC
FT                   ELDQMHPGPDRPETRKLDRMLGTCRDSFLVRMLSELVENARQPQLRLWCLWWVFNSSGY
FT                   YLITYYVHVLWRSTDSSLSYNGAVDAASTLLSAITSFSAGFLSIRWTLWSKLVIAGVIA
FT                   IQASLVFCMFQIRDIWVCYVTFVLFRGAYQFLVPIATFQIASSLSKELCALVFGINTFL
FT                   ATALKTCITLVVSDKRGLGLQVRDQFRIYFIYFLMLSITCFAWAGLDGLRYCQRGRHQP
FT                   LAQAQELRSPLETSVQAISLQDGDLRGPQPSAPQLLSEDGMEDDRGDLRVEAKA"
FT   CDS             join(18325883..18326065,18329302..18330055,
FT                   18330268..18330460,18332247..18332388,18337026..18337292)
FT                   /codon_start=1
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /product="solute carrier family 19 (sodium/hydrogen
FT                   exchanger), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG3384.2 transcript_id=mCT173313.0
FT                   protein_id=mCP96233.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542F3"
FT                   /db_xref="InterPro:IPR002666"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR028339"
FT                   /db_xref="MGI:MGI:103182"
FT                   /db_xref="UniProtKB/TrEMBL:Q542F3"
FT                   /protein_id="EDL31822.1"
FT                   /translation="MVPTGQVAEKQAYEEPRQDHELKSWRCLVFYLCFFGFMAQLRPGE
FT                   SFITPFLLERKFTKEQVTNEIIPMLPYSHLAVLVPVFLLTDYLRYKPVLVLQCLSFVCV
FT                   WLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVHPSRYQRMASYSRAAVLLGVF
FT                   ISSVLGQALVTVGHISTYTLNCVSLGFILFSLVLSLFLKRPKRSLFFNRSTLARGALPC
FT                   ELDQMHPGPDRPETRKLDRMLGTCRDSFLVRMLSELVENARQPQLRLWCLWWVFNSSGY
FT                   YLITYYVHVLWRSTDSSLSYNGAVDAASTLLSAITSFSAGFLSIRWTLWSKLVIAGVIA
FT                   IQASLVFCMFQIRDIWVCYVTFVLFRGAYQFLVPIATFQIASSLSKELCALVFGINTFL
FT                   ATALKTCITLVVSDKRGLGLQVRDQFRIYFIYFLMLSITCFAWAGLDGLRYCQRGRHQP
FT                   LAQAQELRSPLETSVQAISLQDGDLRGPQPSAPQLLSEDGMEDDRGDLRVEAKA"
FT   CDS             join(18325883..18326065,18329302..18330055,
FT                   18330268..18330460,18332247..18332388,18337026..18337292)
FT                   /codon_start=1
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /product="solute carrier family 19 (sodium/hydrogen
FT                   exchanger), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG3384.2 transcript_id=mCT173314.0
FT                   protein_id=mCP96232.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q542F3"
FT                   /db_xref="InterPro:IPR002666"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR028339"
FT                   /db_xref="MGI:MGI:103182"
FT                   /db_xref="UniProtKB/TrEMBL:Q542F3"
FT                   /protein_id="EDL31823.1"
FT                   /translation="MVPTGQVAEKQAYEEPRQDHELKSWRCLVFYLCFFGFMAQLRPGE
FT                   SFITPFLLERKFTKEQVTNEIIPMLPYSHLAVLVPVFLLTDYLRYKPVLVLQCLSFVCV
FT                   WLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVHPSRYQRMASYSRAAVLLGVF
FT                   ISSVLGQALVTVGHISTYTLNCVSLGFILFSLVLSLFLKRPKRSLFFNRSTLARGALPC
FT                   ELDQMHPGPDRPETRKLDRMLGTCRDSFLVRMLSELVENARQPQLRLWCLWWVFNSSGY
FT                   YLITYYVHVLWRSTDSSLSYNGAVDAASTLLSAITSFSAGFLSIRWTLWSKLVIAGVIA
FT                   IQASLVFCMFQIRDIWVCYVTFVLFRGAYQFLVPIATFQIASSLSKELCALVFGINTFL
FT                   ATALKTCITLVVSDKRGLGLQVRDQFRIYFIYFLMLSITCFAWAGLDGLRYCQRGRHQP
FT                   LAQAQELRSPLETSVQAISLQDGDLRGPQPSAPQLLSEDGMEDDRGDLRVEAKA"
FT   CDS             join(18325883..18326065,18329302..18330055,
FT                   18330268..18330460,18332247..18332388,18337026..18337292)
FT                   /codon_start=1
FT                   /gene="Slc19a1"
FT                   /locus_tag="mCG_3384"
FT                   /product="solute carrier family 19 (sodium/hydrogen
FT                   exchanger), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG3384.2 transcript_id=mCT2273.2
FT                   protein_id=mCP9257.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q542F3"
FT                   /db_xref="InterPro:IPR002666"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR028339"
FT                   /db_xref="MGI:MGI:103182"
FT                   /db_xref="UniProtKB/TrEMBL:Q542F3"
FT                   /protein_id="EDL31824.1"
FT                   /translation="MVPTGQVAEKQAYEEPRQDHELKSWRCLVFYLCFFGFMAQLRPGE
FT                   SFITPFLLERKFTKEQVTNEIIPMLPYSHLAVLVPVFLLTDYLRYKPVLVLQCLSFVCV
FT                   WLLLLLGTSVVHMQLMEVFYSVTMAARIAYSSYIFSLVHPSRYQRMASYSRAAVLLGVF
FT                   ISSVLGQALVTVGHISTYTLNCVSLGFILFSLVLSLFLKRPKRSLFFNRSTLARGALPC
FT                   ELDQMHPGPDRPETRKLDRMLGTCRDSFLVRMLSELVENARQPQLRLWCLWWVFNSSGY
FT                   YLITYYVHVLWRSTDSSLSYNGAVDAASTLLSAITSFSAGFLSIRWTLWSKLVIAGVIA
FT                   IQASLVFCMFQIRDIWVCYVTFVLFRGAYQFLVPIATFQIASSLSKELCALVFGINTFL
FT                   ATALKTCITLVVSDKRGLGLQVRDQFRIYFIYFLMLSITCFAWAGLDGLRYCQRGRHQP
FT                   LAQAQELRSPLETSVQAISLQDGDLRGPQPSAPQLLSEDGMEDDRGDLRVEAKA"
FT   gene            complement(18339666..18454107)
FT                   /gene="Col18a1"
FT                   /locus_tag="mCG_116482"
FT                   /note="gene_id=mCG116482.1"
FT   mRNA            complement(join(18339666..18340893,18341641..18341756,
FT                   18342270..18342467,18343065..18343313,18344855..18344887,
FT                   18346185..18346316,18346591..18346664,18346744..18346888,
FT                   18347381..18347509,18347855..18347898,18351465..18351527,
FT                   18352023..18352065,18352721..18352789,18354436..18354510,
FT                   18354865..18354918,18355118..18355144,18355876..18355950,
FT                   18356922..18356984,18357306..18357332,18357436..18357465,
FT                   18358447..18358536,18358797..18358832,18359090..18359161,
FT                   18359513..18359548,18360428..18360454,18361226..18361288,
FT                   18361836..18361967,18363634..18363660,18364645..18364707,
FT                   18365170..18365328,18365485..18365538,18365762..18365839,
FT                   18365943..18366005,18366747..18366773,18368165..18368350,
FT                   18368635..18368711,18372753..18372882,18374862..18374915,
FT                   18376356..18376442,18383477..18384021,18453859..18453929,
FT                   18454008..18454107))
FT                   /gene="Col18a1"
FT                   /locus_tag="mCG_116482"
FT                   /product="procollagen, type XVIII, alpha 1, transcript
FT                   variant mCT117604"
FT                   /note="gene_id=mCG116482.1 transcript_id=mCT117604.1
FT                   created on 20-SEP-2002"
FT   mRNA            complement(join(18339666..18340893,18341641..18341756,
FT                   18342270..18342467,18343065..18343313,18344855..18344887,
FT                   18346185..18346316,18346591..18346664,18346744..18346888,
FT                   18347381..18347509,18347855..18347898,18351465..18351527,
FT                   18352023..18352065,18352721..18352789,18354436..18354510,
FT                   18354865..18354918,18355118..18355144,18355876..18355950,
FT                   18356922..18356984,18357306..18357332,18357436..18357465,
FT                   18358447..18358536,18358797..18358832,18359090..18359161,
FT                   18359513..18359548,18360428..18360454,18361226..18361288,
FT                   18361836..18361967,18363634..18363660,18364645..18364707,
FT                   18365170..18365328,18365485..18365538,18365762..18365839,
FT                   18365943..18366005,18366747..18366773,18368165..18368350,
FT                   18368635..18368711,18372753..18372882,18374862..18374915,
FT                   18376356..18376442,18383477..18384021,18400589..18401601))
FT                   /gene="Col18a1"
FT                   /locus_tag="mCG_116482"
FT                   /product="procollagen, type XVIII, alpha 1, transcript
FT                   variant mCT173281"
FT                   /note="gene_id=mCG116482.1 transcript_id=mCT173281.0
FT                   created on 20-SEP-2002"
FT   CDS             complement(join(18340680..18340893,18341641..18341756,
FT                   18342270..18342467,18343065..18343313,18344855..18344887,
FT                   18346185..18346316,18346591..18346664,18346744..18346888,
FT                   18347381..18347509,18347855..18347898,18351465..18351527,
FT                   18352023..18352065,18352721..18352789,18354436..18354510,
FT                   18354865..18354918,18355118..18355144,18355876..18355950,
FT                   18356922..18356984,18357306..18357332,18357436..18357465,
FT                   18358447..18358536,18358797..18358832,18359090..18359161,
FT                   18359513..18359548,18360428..18360454,18361226..18361288,
FT                   18361836..18361967,18363634..18363660,18364645..18364707,
FT                   18365170..18365328,18365485..18365538,18365762..18365839,
FT                   18365943..18366005,18366747..18366773,18368165..18368350,
FT                   18368635..18368711,18372753..18372882,18374862..18374915,
FT                   18376356..18376442,18383477..18384021,18453859..18453929,
FT                   18454008..18454018))
FT                   /codon_start=1
FT                   /gene="Col18a1"
FT                   /locus_tag="mCG_116482"
FT                   /product="procollagen, type XVIII, alpha 1, isoform CRA_a"
FT                   /note="gene_id=mCG116482.1 transcript_id=mCT117604.1
FT                   protein_id=mCP55266.1 isoform=CRA_a"
FT                   /protein_id="EDL31819.1"
FT                   /translation="MAPRWHLLDVLTSLVLLLVARVSWAEPENVAEEVGLLQLLGDPLP
FT                   EKISQIDDPHVGPAYIFGPDSNSGQVAQYHFPKLFFRDFSLLFHVRPATEAAGVLFAIT
FT                   DAAQVVVSLGVKLSEVRDGQQNISLLYTEPGASQTQTGASFRLPAFVGQWTHFALSVDG
FT                   GSVALYVDCEEFQRVPFARASQGLELERGAGLFVGQAGTADPDKFQGMISELKVRKTPR
FT                   VSPVHCLDEEDDDEDRASGDFGSGFEESSKSHKEDTSLLPGLPQPPPVTSPPLAGGSTT
FT                   EDPRTEETEEDAAVDSIGAETLPGTGSSGAWDEAIQNPGRGLIKGGMKGQKGEPGAQGP
FT                   PGPAGPQGPAGPVVQSPNSQPVPGAQGPPGPQGPPGKDGTPGRDGEPGDPGEDGRPGDT
FT                   GPQGFPGTPGDVGPKGEKGDPGIGPRGPPGPPGPPGPSFRQDKLTFIDMEGSGFSGDIE
FT                   SLRGPRGFPGPPGPPGVPGLPGEPGRFGINGSYAPGPAGLPGVPGKEGPPGFPGPPGPP
FT                   GPPGKEGPPGVAGQKGSVGDVGIPGPKGSKGDLGPIGMPGKSGLAGSPGPVGPPGPPGP
FT                   PGPPGPGFAAGFDDMEGSGIPLWTTARSSDGLQGPPGSPGLKGDPGVAGLPGAKGEVGA
FT                   DGAQGIPGPPGREGAAGSPGPKGEKGMPGEKGNPGKDGVGRPGLPGPPGPPGPVIYVSS
FT                   EDKAIVSTPGPEGKPGYAGFPGPAGPKGDLGSKGEQGLPGPKGEKGEPGTIFSPDGRAL
FT                   GHPQKGAKGEPGFRGPPGPYGRPGHKGEIGFPGRPGRPGTNGLKGEKGEPGDASLGFSM
FT                   RGLPGPPGPPGPPGPPGMPIYDSNAFVESGRPGLPGQQGVQGPSGPKGDKGEVGPPGPP
FT                   GQFPIDLFHLEAEMKGDKGDRGDAGQKGERGEPGAPGGGFFSSSVPGPPGPPGYPGIPG
FT                   PKGESIRGPPGPPGPQGPPGIGYEGRQGPPGPPGPPGPPSFPGPHRQTVSVPGPPGPPG
FT                   PPGPPGAMGASAGQVRIWATYQTMLDKIREVPEGWLIFVAEREELYVRVRNGFRKVLLE
FT                   ARTALPRGTGNEVAALQPPLVQLHEGSPYTRREYSYSTARPWRADDILANPPRLPDRQP
FT                   YPGVPHHHSSYVHLPPARPTLSLAHTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQ
FT                   QARAVGLSGTFRAFLSSRLQDLYSIVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQL
FT                   QPGARIFSFDGRDVLRHPAWPQKSVWHGSDPSGRRLMESYCETWRTETTGATGQASSLL
FT                   SGRLLEQKAASCHNSYIVLCIENSFMTSFSK"
FT   CDS             complement(join(18340680..18340893,18341641..18341756,
FT                   18342270..18342467,18343065..18343313,18344855..18344887,
FT                   18346185..18346316,18346591..18346664,18346744..18346888,
FT                   18347381..18347509,18347855..18347898,18351465..18351527,
FT                   18352023..18352065,18352721..18352789,18354436..18354510,
FT                   18354865..18354918,18355118..18355144,18355876..18355950,
FT                   18356922..18356984,18357306..18357332,18357436..18357465,
FT                   18358447..18358536,18358797..18358832,18359090..18359161,
FT                   18359513..18359548,18360428..18360454,18361226..18361288,
FT                   18361836..18361967,18363634..18363660,18364645..18364707,
FT                   18365170..18365328,18365485..18365538,18365762..18365839,
FT                   18365943..18366005,18366747..18366773,18368165..18368350,
FT                   18368635..18368711,18372753..18372882,18374862..18374915,
FT                   18376356..18376442,18383477..18384021,18400589..18401306))
FT                   /codon_start=1
FT                   /gene="Col18a1"
FT                   /locus_tag="mCG_116482"
FT                   /product="procollagen, type XVIII, alpha 1, isoform CRA_b"
FT                   /note="gene_id=mCG116482.1 transcript_id=mCT173281.0
FT                   protein_id=mCP96200.0 isoform=CRA_b"
FT                   /protein_id="EDL31820.1"
FT                   /translation="MAPDPSRRLCLLLLLLLSCRLVPASADGNSLSPLNPLVWLWPPKT
FT                   SDSLEGPVSKPQNSSPVQSTENPTTHVVPQDGLTEQQTTPASSELPPEEEEEEDQKAGQ
FT                   GGSPATPAVPIPLVAPAASPDMKEENVAGVGAKILNVAQGIRSFVQLWDEDSTIGHSAG
FT                   TEVPDSSIPTVLPSPAELSSAPQGSKTTLWLSSAIPSSPDAQTTEAGTLAVPTQLPPFQ
FT                   SNLQAPLGRPSAPPDFPENVAEEVGLLQLLGDPLPEKISQIDDPHVGPAYIFGPDSNSG
FT                   QVAQYHFPKLFFRDFSLLFHVRPATEAAGVLFAITDAAQVVVSLGVKLSEVRDGQQNIS
FT                   LLYTEPGASQTQTGASFRLPAFVGQWTHFALSVDGGSVALYVDCEEFQRVPFARASQGL
FT                   ELERGAGLFVGQAGTADPDKFQGMISELKVRKTPRVSPVHCLDEEDDDEDRASGDFGSG
FT                   FEESSKSHKEDTSLLPGLPQPPPVTSPPLAGGSTTEDPRTEETEEDAAVDSIGAETLPG
FT                   TGSSGAWDEAIQNPGRGLIKGGMKGQKGEPGAQGPPGPAGPQGPAGPVVQSPNSQPVPG
FT                   AQGPPGPQGPPGKDGTPGRDGEPGDPGEDGRPGDTGPQGFPGTPGDVGPKGEKGDPGIG
FT                   PRGPPGPPGPPGPSFRQDKLTFIDMEGSGFSGDIESLRGPRGFPGPPGPPGVPGLPGEP
FT                   GRFGINGSYAPGPAGLPGVPGKEGPPGFPGPPGPPGPPGKEGPPGVAGQKGSVGDVGIP
FT                   GPKGSKGDLGPIGMPGKSGLAGSPGPVGPPGPPGPPGPPGPGFAAGFDDMEGSGIPLWT
FT                   TARSSDGLQGPPGSPGLKGDPGVAGLPGAKGEVGADGAQGIPGPPGREGAAGSPGPKGE
FT                   KGMPGEKGNPGKDGVGRPGLPGPPGPPGPVIYVSSEDKAIVSTPGPEGKPGYAGFPGPA
FT                   GPKGDLGSKGEQGLPGPKGEKGEPGTIFSPDGRALGHPQKGAKGEPGFRGPPGPYGRPG
FT                   HKGEIGFPGRPGRPGTNGLKGEKGEPGDASLGFSMRGLPGPPGPPGPPGPPGMPIYDSN
FT                   AFVESGRPGLPGQQGVQGPSGPKGDKGEVGPPGPPGQFPIDLFHLEAEMKGDKGDRGDA
FT                   GQKGERGEPGAPGGGFFSSSVPGPPGPPGYPGIPGPKGESIRGPPGPPGPQGPPGIGYE
FT                   GRQGPPGPPGPPGPPSFPGPHRQTVSVPGPPGPPGPPGPPGAMGASAGQVRIWATYQTM
FT                   LDKIREVPEGWLIFVAEREELYVRVRNGFRKVLLEARTALPRGTGNEVAALQPPLVQLH
FT                   EGSPYTRREYSYSTARPWRADDILANPPRLPDRQPYPGVPHHHSSYVHLPPARPTLSLA
FT                   HTHQDFQPVLHLVALNTPLSGGMRGIRGADFQCFQQARAVGLSGTFRAFLSSRLQDLYS
FT                   IVRRADRGSVPIVNLKDEVLSPSWDSLFSGSQGQLQPGARIFSFDGRDVLRHPAWPQKS
FT                   VWHGSDPSGRRLMESYCETWRTETTGATGQASSLLSGRLLEQKAASCHNSYIVLCIENS
FT                   FMTSFSK"
FT   gene            18424730..18425867
FT                   /pseudo
FT                   /locus_tag="mCG_3374"
FT                   /note="gene_id=mCG3374.1"
FT   mRNA            18424730..18425867
FT                   /pseudo
FT                   /locus_tag="mCG_3374"
FT                   /note="gene_id=mCG3374.1 transcript_id=mCT2275.1 created on
FT                   24-OCT-2002"
FT   gene            18546607..18556880
FT                   /gene="Pofut2"
FT                   /locus_tag="mCG_3385"
FT                   /note="gene_id=mCG3385.2"
FT   mRNA            join(18546607..18546761,18547882..18548132,
FT                   18549745..18549889,18550573..18550683,18552264..18552330,
FT                   18553144..18553340,18554221..18554401,18554492..18554615,
FT                   18555835..18556880)
FT                   /gene="Pofut2"
FT                   /locus_tag="mCG_3385"
FT                   /product="protein O-fucosyltransferase 2, transcript
FT                   variant mCT173315"
FT                   /note="gene_id=mCG3385.2 transcript_id=mCT173315.0 created
FT                   on 20-SEP-2002"
FT   mRNA            join(18546607..18546761,18547882..18548132,
FT                   18549745..18549889,18550573..18550683,18552264..18552330,
FT                   18553144..18553269,18554221..18554401,18554492..18554615,
FT                   18555835..18556880)
FT                   /gene="Pofut2"
FT                   /locus_tag="mCG_3385"
FT                   /product="protein O-fucosyltransferase 2, transcript
FT                   variant mCT2266"
FT                   /note="gene_id=mCG3385.2 transcript_id=mCT2266.2 created on
FT                   20-SEP-2002"
FT   CDS             join(18546631..18546761,18547882..18548132,
FT                   18549745..18549889,18550573..18550683,18552264..18552330,
FT                   18553144..18553269,18554221..18554401,18554492..18554615,
FT                   18555835..18555988)
FT                   /codon_start=1
FT                   /gene="Pofut2"
FT                   /locus_tag="mCG_3385"
FT                   /product="protein O-fucosyltransferase 2, isoform CRA_b"
FT                   /note="gene_id=mCG3385.2 transcript_id=mCT2266.2
FT                   protein_id=mCP9301.2 isoform=CRA_b"
FT                   /db_xref="GOA:B2RV73"
FT                   /db_xref="InterPro:IPR019378"
FT                   /db_xref="MGI:MGI:1916863"
FT                   /db_xref="UniProtKB/TrEMBL:B2RV73"
FT                   /protein_id="EDL31818.1"
FT                   /translation="MAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASRRRY
FT                   LLYDVNPPEGFNLRRDVYIRVASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPW
FT                   SEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQGYAEGWKEGTWEEKVDARPCID
FT                   PLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPVLLKNTSARSVMLDRAEN
FT                   LLHDHYGGREYWDTRRSMVFAKHLRAVGDEFRSQHLNSTDAADKMAPEEDWTKMKVKLG
FT                   SALGGPYLGVHLRRKDFIWGHREDVPSLEGAVKKIRSLMKTHQLDKVFVATDAIRKEQE
FT                   ELRKLLPEMVRFEPTWEELELYKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREI
FT                   LGLDPKTTYNRFCGDQEKACEQPTHWKIAY"
FT   CDS             join(18546631..18546761,18547882..18548132,
FT                   18549745..18549889,18550573..18550683,18552264..18552330,
FT                   18553144..18553323)
FT                   /codon_start=1
FT                   /gene="Pofut2"
FT                   /locus_tag="mCG_3385"
FT                   /product="protein O-fucosyltransferase 2, isoform CRA_a"
FT                   /note="gene_id=mCG3385.2 transcript_id=mCT173315.0
FT                   protein_id=mCP96234.0 isoform=CRA_a"
FT                   /protein_id="EDL31817.1"
FT                   /translation="MAALSVVCLLLAAASWRPVSASGEEFWPGQSAADILSGAASRRRY
FT                   LLYDVNPPEGFNLRRDVYIRVASLLKTLLKTEEWVLVLPPWGRLYHWQSPDIHQVRIPW
FT                   SEFFDLPSLNKNIPVIEYEQFIAESGGPFIDQVYVLQGYAEGWKEGTWEEKVDARPCID
FT                   PLLYSQDKHEYYRGWFWGYEETRGLNVSCLSVQGSASIVAPVLLKNTSARSVMLDRAEN
FT                   LLHDHYGGREYWDTRRSMVFAKHLRAVGDEFRSQHLNSTDAADKMAPEEDWTKMKVAAL
FT                   LLPEKELGTGLLP"
FT   gene            complement(18577666..18704064)
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /note="gene_id=mCG3378.2"
FT   mRNA            complement(join(18577666..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599667..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609873,
FT                   18613156..18613230,18645356..18645524,18703886..18704064))
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, transcript
FT                   variant mCT2274"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT2274.2 created on
FT                   20-SEP-2002"
FT   mRNA            complement(join(18577666..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599637..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609873,
FT                   18613156..18613230,18645356..18645524,18703886..18704064))
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, transcript
FT                   variant mCT173308"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT173308.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(18577666..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599667..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609873,
FT                   18612909..18612981,18613156..18613230,18645356..18645524,
FT                   18703886..18704064))
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, transcript
FT                   variant mCT173305"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT173305.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(18577666..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599667..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609919,
FT                   18613155..18613230,18645356..18645524,18703886..18704064))
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, transcript
FT                   variant mCT173307"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT173307.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(18577666..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599637..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609919,
FT                   18613155..18613230,18645356..18645524,18703886..18704064))
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, transcript
FT                   variant mCT173306"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT173306.0 created
FT                   on 20-SEP-2002"
FT   mRNA            complement(join(18581272..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599667..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609919,
FT                   18613156..18613230,18645356..18645524,18703886..>18704018))
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, transcript
FT                   variant mCT192934"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT192934.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(18581272..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599637..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609919,
FT                   18613156..18613230,18645356..18645524,18703886..>18704018))
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, transcript
FT                   variant mCT192933"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT192933.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(18582055..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599667..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609873,
FT                   18613156..18613183))
FT                   /codon_start=1
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT2274.2
FT                   protein_id=mCP9217.2 isoform=CRA_g"
FT                   /protein_id="EDL31816.1"
FT                   /translation="MDIEDEENMSSSSTDIKENRNLDNMPPKDSSTPGPGEGIPLSNGG
FT                   GGSTSRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYMLLSQTGPV
FT                   HAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNT
FT                   DFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPL
FT                   PIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNK
FT                   KLAKARAAQSALATVFNLHLDQTPSRQPVLSEGLQLHLPQVLADAVSRLVLGKFSDLTD
FT                   NFSSPHARRKVLSGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIIS
FT                   RRSLLRFLYAQLELYLNNKEDQKKSIFQKSERGGFRLKDTVQFHLYISTSPCGDARIFS
FT                   PHEPVLEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCS
FT                   DKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTL
FT                   NKPLLSGISNAEARQPGKAPNFSVNWTVGDATIEVINATTGKDELGRPSRLCKHALYCR
FT                   WMRVHGKVPPHLLRTKITKPTTYHESKLAAREYQAAKARLFTAFIKAGLGAWVEKPTEQ
FT                   DQFSFTP"
FT   CDS             complement(join(18582055..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599637..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609873,
FT                   18613156..18613183))
FT                   /codon_start=1
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT173308.0
FT                   protein_id=mCP96226.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q91ZS8"
FT                   /db_xref="InterPro:IPR002466"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="MGI:MGI:891999"
FT                   /db_xref="PDB:2L2K"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91ZS8"
FT                   /protein_id="EDL31813.1"
FT                   /translation="MDIEDEENMSSSSTDIKENRNLDNMPPKDSSTPGPGEGIPLSNGG
FT                   GGSTSRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYMLLSQTGPV
FT                   HAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNT
FT                   DFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPL
FT                   PIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNK
FT                   KLAKARAAQSALATVFNLHLDQTPSRQPVLSEGLQLHLPQVLADAVSRLVLGKFSDLTD
FT                   NFSSPHARRKVLSGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIIS
FT                   RRSLLRFLYAQLELYLNNKEDQKKSIFQKSERGGFRLKDTVQFHLYISTSPCGDARIFS
FT                   PHEPVLEGMTPDSHQLTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQ
FT                   GERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISN
FT                   IEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDATIEVINATTGKDELGRPS
FT                   RLCKHALYCRWMRVHGKVPPHLLRTKITKPTTYHESKLAAREYQAAKARLFTAFIKAGL
FT                   GAWVEKPTEQDQFSFTP"
FT   CDS             complement(join(18582055..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599667..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609873,
FT                   18612909..18612918))
FT                   /codon_start=1
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT173305.0
FT                   protein_id=mCP96225.0 isoform=CRA_a"
FT                   /protein_id="EDL31810.1"
FT                   /translation="MPLGSSSTDIKENRNLDNMPPKDSSTPGPGEGIPLSNGGGGSTSR
FT                   KRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFV
FT                   MSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQ
FT                   ADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPF
FT                   PPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKAR
FT                   AAQSALATVFNLHLDQTPSRQPVLSEGLQLHLPQVLADAVSRLVLGKFSDLTDNFSSPH
FT                   ARRKVLSGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLR
FT                   FLYAQLELYLNNKEDQKKSIFQKSERGGFRLKDTVQFHLYISTSPCGDARIFSPHEPVL
FT                   EEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARW
FT                   NVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLS
FT                   GISNAEARQPGKAPNFSVNWTVGDATIEVINATTGKDELGRPSRLCKHALYCRWMRVHG
FT                   KVPPHLLRTKITKPTTYHESKLAAREYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSFT
FT                   P"
FT   CDS             complement(join(18582055..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599667..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..>18609919))
FT                   /codon_start=1
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT192934.0
FT                   protein_id=mCP113923.0 isoform=CRA_f"
FT                   /protein_id="EDL31815.1"
FT                   /translation="ILQRRRCKLLFLGTTGSSSTDIKENRNLDNMPPKDSSTPGPGEGI
FT                   PLSNGGGGSTSRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYMLL
FT                   SQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGR
FT                   TLSVNTDFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPAS
FT                   LTQPPLPIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFE
FT                   GSGRNKKLAKARAAQSALATVFNLHLDQTPSRQPVLSEGLQLHLPQVLADAVSRLVLGK
FT                   FSDLTDNFSSPHARRKVLSGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDC
FT                   HAEIISRRSLLRFLYAQLELYLNNKEDQKKSIFQKSERGGFRLKDTVQFHLYISTSPCG
FT                   DARIFSPHEPVLEEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERL
FT                   LTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDL
FT                   PPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDATIEVINATTGKDELGRPSRLCK
FT                   HALYCRWMRVHGKVPPHLLRTKITKPTTYHESKLAAREYQAAKARLFTAFIKAGLGAWV
FT                   EKPTEQDQFSFTP"
FT   CDS             complement(join(18582055..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599637..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..>18609919))
FT                   /codon_start=1
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT192933.0
FT                   protein_id=mCP113922.0 isoform=CRA_e"
FT                   /protein_id="EDL31814.1"
FT                   /translation="ILQRRRCKLLFLGTTGSSSTDIKENRNLDNMPPKDSSTPGPGEGI
FT                   PLSNGGGGSTSRKRPLEEGSNGHSKYRLKKRRKTPGPVLPKNALMQLNEIKPGLQYMLL
FT                   SQTGPVHAPLFVMSVEVNGQVFEGSGPTKKKAKLHAAEKALRSFVQFPNASEAHLAMGR
FT                   TLSVNTDFTSDQADFPDTLFNGFETPDKSEPPFYVGSNGDDSFSSSGDVSLSASPVPAS
FT                   LTQPPLPIPPPFPPPSGKNPVMILNELRPGLKYDFLSESGESHAKSFVMSVVVDGQFFE
FT                   GSGRNKKLAKARAAQSALATVFNLHLDQTPSRQPVLSEGLQLHLPQVLADAVSRLVLGK
FT                   FSDLTDNFSSPHARRKVLSGVVMTTGTDVKDAKVISVSTGTKCINGEYMSDRGLALNDC
FT                   HAEIISRRSLLRFLYAQLELYLNNKEDQKKSIFQKSERGGFRLKDTVQFHLYISTSPCG
FT                   DARIFSPHEPVLEGMTPDSHQLTEPADRHPNRKARGQLRTKIESGEGTIPVRSNASIQT
FT                   WDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIYFSSIILGSLYHGDHLSRAM
FT                   YQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSVNWTVGDATIEVINATTGKD
FT                   ELGRPSRLCKHALYCRWMRVHGKVPPHLLRTKITKPTTYHESKLAAREYQAAKARLFTA
FT                   FIKAGLGAWVEKPTEQDQFSFTP"
FT   CDS             complement(join(18582055..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599667..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609829))
FT                   /codon_start=1
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT173307.0
FT                   protein_id=mCP96227.0 isoform=CRA_c"
FT                   /protein_id="EDL31812.1"
FT                   /translation="MPPKDSSTPGPGEGIPLSNGGGGSTSRKRPLEEGSNGHSKYRLKK
FT                   RRKTPGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKK
FT                   KAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKSE
FT                   PPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPPPSGKNPVMILNELRPG
FT                   LKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLDQTP
FT                   SRQPVLSEGLQLHLPQVLADAVSRLVLGKFSDLTDNFSSPHARRKVLSGVVMTTGTDVK
FT                   DAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYAQLELYLNNKEDQKK
FT                   SIFQKSERGGFRLKDTVQFHLYISTSPCGDARIFSPHEPVLEEPADRHPNRKARGQLRT
FT                   KIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGSLLSIFVEPIY
FT                   FSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEARQPGKAPNFSV
FT                   NWTVGDATIEVINATTGKDELGRPSRLCKHALYCRWMRVHGKVPPHLLRTKITKPTTYH
FT                   ESKLAAREYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSFTP"
FT   CDS             complement(join(18582055..18582234,18582971..18583149,
FT                   18590446..18590627,18598395..18598563,18599637..18599815,
FT                   18600694..18600862,18604526..18604640,18608939..18609829))
FT                   /codon_start=1
FT                   /gene="Adarb1"
FT                   /locus_tag="mCG_3378"
FT                   /product="adenosine deaminase, RNA-specific, B1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3378.2 transcript_id=mCT173306.0
FT                   protein_id=mCP96224.0 isoform=CRA_b"
FT                   /protein_id="EDL31811.1"
FT                   /translation="MPPKDSSTPGPGEGIPLSNGGGGSTSRKRPLEEGSNGHSKYRLKK
FT                   RRKTPGPVLPKNALMQLNEIKPGLQYMLLSQTGPVHAPLFVMSVEVNGQVFEGSGPTKK
FT                   KAKLHAAEKALRSFVQFPNASEAHLAMGRTLSVNTDFTSDQADFPDTLFNGFETPDKSE
FT                   PPFYVGSNGDDSFSSSGDVSLSASPVPASLTQPPLPIPPPFPPPSGKNPVMILNELRPG
FT                   LKYDFLSESGESHAKSFVMSVVVDGQFFEGSGRNKKLAKARAAQSALATVFNLHLDQTP
FT                   SRQPVLSEGLQLHLPQVLADAVSRLVLGKFSDLTDNFSSPHARRKVLSGVVMTTGTDVK
FT                   DAKVISVSTGTKCINGEYMSDRGLALNDCHAEIISRRSLLRFLYAQLELYLNNKEDQKK
FT                   SIFQKSERGGFRLKDTVQFHLYISTSPCGDARIFSPHEPVLEGMTPDSHQLTEPADRHP
FT                   NRKARGQLRTKIESGEGTIPVRSNASIQTWDGVLQGERLLTMSCSDKIARWNVVGIQGS
FT                   LLSIFVEPIYFSSIILGSLYHGDHLSRAMYQRISNIEDLPPLYTLNKPLLSGISNAEAR
FT                   QPGKAPNFSVNWTVGDATIEVINATTGKDELGRPSRLCKHALYCRWMRVHGKVPPHLLR
FT                   TKITKPTTYHESKLAAREYQAAKARLFTAFIKAGLGAWVEKPTEQDQFSFTP"
FT   gene            complement(18772464..18802229)
FT                   /gene="1810008A18Rik"
FT                   /locus_tag="mCG_3376"
FT                   /note="gene_id=mCG3376.2"
FT   mRNA            complement(join(18772464..18774273,18775798..18775863,
FT                   18783163..18783313,18789646..18789714,18800106..18800214,
FT                   18801403..18802229))
FT                   /gene="1810008A18Rik"
FT                   /locus_tag="mCG_3376"
FT                   /product="RIKEN cDNA 1810008A18, transcript variant
FT                   mCT177513"
FT                   /note="gene_id=mCG3376.2 transcript_id=mCT177513.0 created
FT                   on 17-DEC-2002"
FT   mRNA            complement(join(18772464..18774273,18775798..18775866,
FT                   18783163..18783313,18789646..18789714,18800106..18800214,
FT                   18801403..18802229))
FT                   /gene="1810008A18Rik"
FT                   /locus_tag="mCG_3376"
FT                   /product="RIKEN cDNA 1810008A18, transcript variant
FT                   mCT2277"
FT                   /note="gene_id=mCG3376.2 transcript_id=mCT2277.2 created on
FT                   17-DEC-2002"
FT   CDS             complement(join(18774150..18774273,18775798..18775863,
FT                   18783163..18783313,18789646..18789714,18800106..18800214,
FT                   18801403..18801540))
FT                   /codon_start=1
FT                   /gene="1810008A18Rik"
FT                   /locus_tag="mCG_3376"
FT                   /product="RIKEN cDNA 1810008A18, isoform CRA_a"
FT                   /note="gene_id=mCG3376.2 transcript_id=mCT177513.0
FT                   protein_id=mCP100435.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8C660"
FT                   /db_xref="MGI:MGI:1916334"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C660"
FT                   /protein_id="EDL31808.1"
FT                   /translation="MGKVRALRARVHRAAVRPDGDSAPGPVPRAVEPALPQSPAGGAGA
FT                   KDWTFVHNDIFARTQIDPSALVQRLELDQRSVVSLKRGAEPKAILPKKEKLKLRRERWL
FT                   QKIEAIKLAEQKLREERKRKAMVVVGDLHPLRDALPELQELEAGRQRQQARRVTSKPRP
FT                   VELSRMTTVQRQQLLEEERTRFQKLLASPTYRASPLLAIGQQLAHQMQLEGGKQL"
FT   CDS             complement(join(18774150..18774273,18775798..18775866,
FT                   18783163..18783313,18789646..18789714,18800106..18800214,
FT                   18801403..18801540))
FT                   /codon_start=1
FT                   /gene="1810008A18Rik"
FT                   /locus_tag="mCG_3376"
FT                   /product="RIKEN cDNA 1810008A18, isoform CRA_b"
FT                   /note="gene_id=mCG3376.2 transcript_id=mCT2277.2
FT                   protein_id=mCP9288.2 isoform=CRA_b"
FT                   /protein_id="EDL31809.1"
FT                   /translation="MGKVRALRARVHRAAVRPDGDSAPGPVPRAVEPALPQSPAGGAGA
FT                   KDWTFVHNDIFARTQIDPSALVQRLELDQRSVVSLKRGAEPKAILPKKEKLKLRRERWL
FT                   QKIEAIKLAEQKLREERKRKAMVVVGDLHPLRDALPELQELEAGRQRQQARRRVTSKPR
FT                   PVELSRMTTVQRQQLLEEERTRFQKLLASPTYRASPLLAIGQQLAHQMQLEGGKQL"
FT   gene            18816134..18852060
FT                   /gene="Itgb2"
FT                   /locus_tag="mCG_3383"
FT                   /note="gene_id=mCG3383.2"
FT   mRNA            join(18816134..18816236,18828342..18828402,
FT                   18828774..18828862,18832383..18832563,18833495..18833665,
FT                   18834915..18835156,18836315..18836470,18837342..18837437,
FT                   18842464..18842553,18843766..18843906,18844328..18844515,
FT                   18845855..18846099,18846526..18846748,18847389..18847591,
FT                   18851014..18851180,18851554..18852060)
FT                   /gene="Itgb2"
FT                   /locus_tag="mCG_3383"
FT                   /product="integrin beta 2, transcript variant mCT2270"
FT                   /note="gene_id=mCG3383.2 transcript_id=mCT2270.1 created on
FT                   20-SEP-2002"
FT   mRNA            join(18816160..18816236,18828342..18828402,
FT                   18832383..18832563,18833495..18833665,18834915..18835156,
FT                   18836315..18836470,18837342..18837437,18842464..18842553,
FT                   18843766..18843906,18844328..18844515,18845855..18846099,
FT                   18846526..18846748,18847389..18847591,18851014..18851180,
FT                   18851554..18852060)
FT                   /gene="Itgb2"
FT                   /locus_tag="mCG_3383"
FT                   /product="integrin beta 2, transcript variant mCT173311"
FT                   /note="gene_id=mCG3383.2 transcript_id=mCT173311.0 created
FT                   on 20-SEP-2002"
FT   CDS             join(18828345..18828402,18828774..18828862,
FT                   18832383..18832563,18833495..18833665,18834915..18835156,
FT                   18836315..18836470,18837342..18837437,18842464..18842553,
FT                   18843766..18843906,18844328..18844515,18845855..18846099,
FT                   18846526..18846748,18847389..18847591,18851014..18851180,
FT                   18851554..18851616)
FT                   /codon_start=1
FT                   /gene="Itgb2"
FT                   /locus_tag="mCG_3383"
FT                   /product="integrin beta 2, isoform CRA_b"
FT                   /note="gene_id=mCG3383.2 transcript_id=mCT2270.1
FT                   protein_id=mCP9289.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q542I8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002369"
FT                   /db_xref="InterPro:IPR012896"
FT                   /db_xref="InterPro:IPR014836"
FT                   /db_xref="InterPro:IPR015439"
FT                   /db_xref="InterPro:IPR015812"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="MGI:MGI:96611"
FT                   /db_xref="UniProtKB/TrEMBL:Q542I8"
FT                   /protein_id="EDL31807.1"
FT                   /translation="MLGPHSLLLALAGLFFLGSAVSQECTKYKVSSCRDCIQSGPGCSW
FT                   CQKLNFTGPGEPDSLRCDTRAQLLLKGCPADDIMDPRSIANPEFDQRGQRKQLSPQKVT
FT                   LYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITES
FT                   GRIGFGSFVDKTVLPFVNTHPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVG
FT                   KQLISGNLDAPEGGLDAIMQVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTP
FT                   NDGRCHLEDNMYKRSNEFDYPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKS
FT                   AVGELSDDSSNVVQLIKNAYYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGD
FT                   CDGVQINNPVTFQVKVMASECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSL
FT                   CGGKGVMECGICRCESGYIGKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQC
FT                   VCHTSDVPNKEIFGQYCECDNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQ
FT                   RSTTGCLNARLVECSGRGHCQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKF
FT                   DKGPFEKNCSVQCAGMTLQTIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSL
FT                   ECVKGPNVAAIVGGTVVGVVLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNP
FT                   LFKSATTTVMNPKFAES"
FT   CDS             join(18832470..18832563,18833495..18833665,
FT                   18834915..18835156,18836315..18836470,18837342..18837437,
FT                   18842464..18842553,18843766..18843906,18844328..18844515,
FT                   18845855..18846099,18846526..18846748,18847389..18847591,
FT                   18851014..18851180,18851554..18851616)
FT                   /codon_start=1
FT                   /gene="Itgb2"
FT                   /locus_tag="mCG_3383"
FT                   /product="integrin beta 2, isoform CRA_a"
FT                   /note="gene_id=mCG3383.2 transcript_id=mCT173311.0
FT                   protein_id=mCP96230.0 isoform=CRA_a"
FT                   /protein_id="EDL31806.1"
FT                   /translation="MDPRSIANPEFDQRGQRKQLSPQKVTLYLRPGQAAAFNVTFRRAK
FT                   GYPIDLYYLMDLSYSMLDDLNNVKKLGGDLLQALNEITESGRIGFGSFVDKTVLPFVNT
FT                   HPEKLRNPCPNKEKACQPPFAFRHVLKLTDNSNQFQTEVGKQLISGNLDAPEGGLDAIM
FT                   QVAACPEEIGWRNVTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNMYKRSNEFD
FT                   YPSVGQLAHKLSESNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSDDSSNVVQLIKNA
FT                   YYKLSSRVFLDHSTLPDTLKVTYDSFCSNGASSIGKSRGDCDGVQINNPVTFQVKVMAS
FT                   ECIQEQSFVIRALGFTDTVTVQVRPQCECQCRDQSREQSLCGGKGVMECGICRCESGYI
FT                   GKNCECQTQGRSSQELERNCRKDNSSIVCSGLGDCICGQCVCHTSDVPNKEIFGQYCEC
FT                   DNVNCERYNSQVCGGSDRGSCNCGKCSCKPGYEGSACQCQRSTTGCLNARLVECSGRGH
FT                   CQCNRCICDEGYQPPMCEDCPSCGSHCRDNHTSCAECLKFDKGPFEKNCSVQCAGMTLQ
FT                   TIPLKKKPCKERDSEGCWITYTLQQKDGRNIYNIHVEDSLECVKGPNVAAIVGGTVVGV
FT                   VLIGVLLLVIWKALTHLTDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES"
FT   gene            18868089..18885314
FT                   /gene="Pttg1ip"
FT                   /locus_tag="mCG_3380"
FT                   /note="gene_id=mCG3380.2"
FT   mRNA            join(18868089..18868322,18873834..18873886,
FT                   18876217..18876325,18879429..18879600,18880447..18880493,
FT                   18883611..18885314)
FT                   /gene="Pttg1ip"
FT                   /locus_tag="mCG_3380"
FT                   /product="pituitary tumor-transforming 1 interacting
FT                   protein, transcript variant mCT2271"
FT                   /note="gene_id=mCG3380.2 transcript_id=mCT2271.2 created on
FT                   17-DEC-2002"
FT   mRNA            join(18868089..18868322,18873834..18873886,
FT                   18879429..18879600,18880447..18880493,18883611..18885314)
FT                   /gene="Pttg1ip"
FT                   /locus_tag="mCG_3380"
FT                   /product="pituitary tumor-transforming 1 interacting
FT                   protein, transcript variant mCT174817"
FT                   /note="gene_id=mCG3380.2 transcript_id=mCT174817.0 created
FT                   on 17-DEC-2002"
FT   mRNA            join(18868089..18868318,18873834..18873886,
FT                   18876217..18876325,18879429..18879600,18880447..18880493,
FT                   18883611..18885314)
FT                   /gene="Pttg1ip"
FT                   /locus_tag="mCG_3380"
FT                   /product="pituitary tumor-transforming 1 interacting
FT                   protein, transcript variant mCT177515"
FT                   /note="gene_id=mCG3380.2 transcript_id=mCT177515.0 created
FT                   on 17-DEC-2002"
FT   CDS             join(18868217..18868322,18873834..18873886,
FT                   18876217..18876325,18879429..18879600,18880447..18880493,
FT                   18883611..18883648)
FT                   /codon_start=1
FT                   /gene="Pttg1ip"
FT                   /locus_tag="mCG_3380"
FT                   /product="pituitary tumor-transforming 1 interacting
FT                   protein, isoform CRA_c"
FT                   /note="gene_id=mCG3380.2 transcript_id=mCT2271.2
FT                   protein_id=mCP9232.1 isoform=CRA_c"
FT                   /protein_id="EDL31805.1"
FT                   /translation="MAPANLGLTPHWVMLLGAVLLLLLSGASAQEPPRVGCSEYTNRSC
FT                   EECLRNVSCLWCNENKACMDYPVRKILPPASLCKLSSARWGVCWVNFEALIITMSVLGG
FT                   SVLLGITVCCCYCCRRKKSRKPDKSDERAMREQEERRVRQEERRAEMKSRHDEIRKKYG
FT                   LFKEQNPYEKF"
FT   CDS             join(18868217..18868322,18873834..18873886,
FT                   18879429..18879431)
FT                   /codon_start=1
FT                   /gene="Pttg1ip"
FT                   /locus_tag="mCG_3380"
FT                   /product="pituitary tumor-transforming 1 interacting
FT                   protein, isoform CRA_a"
FT                   /note="gene_id=mCG3380.2 transcript_id=mCT174817.0
FT                   protein_id=mCP97736.0 isoform=CRA_a"
FT                   /protein_id="EDL31803.1"
FT                   /translation="MAPANLGLTPHWVMLLGAVLLLLLSGASAQEPPRVGCSEYTNRSC
FT                   EECLRNVS"
FT   CDS             join(18876247..18876325,18879429..18879600,
FT                   18880447..18880493,18883611..18883648)
FT                   /codon_start=1
FT                   /gene="Pttg1ip"
FT                   /locus_tag="mCG_3380"
FT                   /product="pituitary tumor-transforming 1 interacting
FT                   protein, isoform CRA_b"
FT                   /note="gene_id=mCG3380.2 transcript_id=mCT177515.0
FT                   protein_id=mCP100437.0 isoform=CRA_b"
FT                   /protein_id="EDL31804.1"
FT                   /translation="MDYPVRKILPPASLCKLSSARWGVCWVNFEALIITMSVLGGSVLL
FT                   GITVCCCYCCRRKKSRKPDKSDERAMREQEERRVRQEERRAEMKSRHDEIRKKYGLFKE
FT                   QNPYEKF"
FT   gene            18892765..18904009
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /note="gene_id=mCG3381.2"
FT   mRNA            join(18892765..18892924,18896395..18896523,
FT                   18900561..18900632,18902508..18902615,18902729..18904009)
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /product="SMT3 suppressor of mif two 3 homolog 3 (yeast),
FT                   transcript variant mCT177516"
FT                   /note="gene_id=mCG3381.2 transcript_id=mCT177516.0 created
FT                   on 17-DEC-2002"
FT   mRNA            join(18892765..18892924,18896395..18896523,
FT                   18900561..18900632,18902729..18904009)
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /product="SMT3 suppressor of mif two 3 homolog 3 (yeast),
FT                   transcript variant mCT2272"
FT                   /note="gene_id=mCG3381.2 transcript_id=mCT2272.1 created on
FT                   17-DEC-2002"
FT   mRNA            join(18892765..18892924,18896395..18896523,
FT                   18900561..18900632,18902771..18904009)
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /product="SMT3 suppressor of mif two 3 homolog 3 (yeast),
FT                   transcript variant mCT173310"
FT                   /note="gene_id=mCG3381.2 transcript_id=mCT173310.0 created
FT                   on 17-DEC-2002"
FT   CDS             join(18892904..18892924,18896395..18896523,
FT                   18900561..18900632,18902729..18902839)
FT                   /codon_start=1
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /product="SMT3 suppressor of mif two 3 homolog 3 (yeast),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG3381.2 transcript_id=mCT2272.1
FT                   protein_id=mCP9276.1 isoform=CRA_d"
FT                   /protein_id="EDL31802.1"
FT                   /translation="MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKA
FT                   YCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSASRGSVPTPNR
FT                   CPDLCY"
FT   CDS             join(18892904..18892924,18896395..18896523,
FT                   18900561..18900632,18902771..18902839)
FT                   /codon_start=1
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /product="SMT3 suppressor of mif two 3 homolog 3 (yeast),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3381.2 transcript_id=mCT173310.0
FT                   protein_id=mCP96228.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWX9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR027218"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1336201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWX9"
FT                   /protein_id="EDL31800.1"
FT                   /translation="MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKA
FT                   YCERQGLSMRQIRFRFDGQPINETDTPAQQTGGSASRGSVPTPNRCPDLCY"
FT   CDS             join(18892904..18892924,18896395..18896523,
FT                   18900561..18900632,18902508..18902534)
FT                   /codon_start=1
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /product="SMT3 suppressor of mif two 3 homolog 3 (yeast),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG3381.2 transcript_id=mCT177516.0
FT                   protein_id=mCP100438.0 isoform=CRA_c"
FT                   /db_xref="GOA:G3UWI9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR027218"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1336201"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWI9"
FT                   /protein_id="EDL31801.1"
FT                   /translation="MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKA
FT                   YCERQGLSMRQIRFRFDGQPINETDTPAQFLALTILL"
FT   mRNA            join(18893290..18893551,18896395..18896523,
FT                   18900561..18900632,18902729..18904009)
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /product="SMT3 suppressor of mif two 3 homolog 3 (yeast),
FT                   transcript variant mCT173309"
FT                   /note="gene_id=mCG3381.2 transcript_id=mCT173309.0 created
FT                   on 17-DEC-2002"
FT   CDS             join(18893531..18893551,18896395..18896523,
FT                   18900561..18900632,18902729..18902839)
FT                   /codon_start=1
FT                   /gene="Sumo3"
FT                   /locus_tag="mCG_3381"
FT                   /product="SMT3 suppressor of mif two 3 homolog 3 (yeast),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3381.2 transcript_id=mCT173309.0
FT                   protein_id=mCP96229.0 isoform=CRA_a"
FT                   /protein_id="EDL31799.1"
FT                   /translation="MTTVLAQEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKA
FT                   YCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSASRGSVPTPNR
FT                   CPDLCY"
FT   gene            18908883..18932572
FT                   /gene="Ube2g2"
FT                   /locus_tag="mCG_3379"
FT                   /note="gene_id=mCG3379.3"
FT   mRNA            join(18908883..18908997,18917307..18917342,
FT                   18917430..18917475,18928042..18928160,18930051..18930191,
FT                   18931029..18932572)
FT                   /gene="Ube2g2"
FT                   /locus_tag="mCG_3379"
FT                   /product="ubiquitin-conjugating enzyme E2G 2, transcript
FT                   variant mCT2280"
FT                   /note="gene_id=mCG3379.3 transcript_id=mCT2280.2 created on
FT                   17-DEC-2002"
FT   mRNA            join(18908883..18908952,18917307..18917342,
FT                   18917430..18917475,18928042..18928160,18930051..18930191,
FT                   18931029..18932572)
FT                   /gene="Ube2g2"
FT                   /locus_tag="mCG_3379"
FT                   /product="ubiquitin-conjugating enzyme E2G 2, transcript
FT                   variant mCT177514"
FT                   /note="gene_id=mCG3379.3 transcript_id=mCT177514.0 created
FT                   on 17-DEC-2002"
FT   CDS             join(18908955..18908997,18917307..18917342,
FT                   18917430..18917475,18928042..18928160,18930051..18930191,
FT                   18931029..18931141)
FT                   /codon_start=1
FT                   /gene="Ube2g2"
FT                   /locus_tag="mCG_3379"
FT                   /product="ubiquitin-conjugating enzyme E2G 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3379.3 transcript_id=mCT2280.2
FT                   protein_id=mCP9267.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U431"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:1343188"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U431"
FT                   /protein_id="EDL31798.1"
FT                   /translation="MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPE
FT                   DTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFHPNIYPDGRVCISILHAPGDDPMGYE
FT                   SSAERWSPVQSVEKILLSVVSMLAEPNDESGANVDASKMWRDDREQFYKIAKQIVQKSL
FT                   GL"
FT   CDS             join(18917435..18917475,18928042..18928160,
FT                   18930051..18930191,18931029..18931141)
FT                   /codon_start=1
FT                   /gene="Ube2g2"
FT                   /locus_tag="mCG_3379"
FT                   /product="ubiquitin-conjugating enzyme E2G 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3379.3 transcript_id=mCT177514.0
FT                   protein_id=mCP100436.0 isoform=CRA_a"
FT                   /protein_id="EDL31797.1"
FT                   /translation="MNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRF
FT                   TCEMFHPNIYPDGRVCISILHAPGDDPMGYESSAERWSPVQSVEKILLSVVSMLAEPND
FT                   ESGANVDASKMWRDDREQFYKIAKQIVQKSLGL"
FT   gene            complement(18939276..18939966)
FT                   /pseudo
FT                   /locus_tag="mCG_3377"
FT                   /note="gene_id=mCG3377.0"
FT   mRNA            complement(18939276..18939966)
FT                   /pseudo
FT                   /locus_tag="mCG_3377"
FT                   /note="gene_id=mCG3377.0 transcript_id=mCT2278.0 created on
FT                   23-OCT-2002"
FT   gene            complement(<18977333..>18978133)
FT                   /locus_tag="mCG_61404"
FT                   /note="gene_id=mCG61404.2"
FT   mRNA            complement(<18977333..>18978133)
FT                   /locus_tag="mCG_61404"
FT                   /product="mCG61404"
FT                   /note="gene_id=mCG61404.2 transcript_id=mCT61587.2 created
FT                   on 23-OCT-2002"
FT   CDS             complement(18977333..18978133)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61404"
FT                   /product="mCG61404"
FT                   /note="gene_id=mCG61404.2 transcript_id=mCT61587.2
FT                   protein_id=mCP31407.2"
FT                   /db_xref="GOA:J3QJV4"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="MGI:MGI:5011587"
FT                   /db_xref="UniProtKB/TrEMBL:J3QJV4"
FT                   /protein_id="EDL31796.1"
FT                   /translation="MATSTMSVCSSDLSYDRRVCLPGSCDSCTDSSWQVDDCPESCCEP
FT                   CCCAPSSCQPSCCVPSCCQSSCCIPSCCQPSCCQSSCCVPSCCAPAPCLTLICTPVSCM
FT                   SSPCCQSSCCTPSCCQQSSCQPACCTCSPCQQPCCMTLCCKPVCCTPICSGPCCQQSSC
FT                   QSSCCQSPCCVPVCCKPVCCTPICSGSSSSCCQPSCCAPVCCKPCSSLSLLCRPVCRPA
FT                   CCVPTSSCCASSCQPSCCRPTSSVSLLCRPACSRQACCGQKSSC"
FT   gene            complement(18983651..>18984609)
FT                   /locus_tag="mCG_54359"
FT                   /note="gene_id=mCG54359.2"
FT   mRNA            complement(18983651..>18984609)
FT                   /locus_tag="mCG_54359"
FT                   /product="mCG54359"
FT                   /note="gene_id=mCG54359.2 transcript_id=mCT54542.2 created
FT                   on 23-OCT-2002"
FT   CDS             complement(18983917..18984609)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54359"
FT                   /product="mCG54359"
FT                   /note="gene_id=mCG54359.2 transcript_id=mCT54542.2
FT                   protein_id=mCP31414.2"
FT                   /protein_id="EDL31795.1"
FT                   /translation="MAASTMSVCSEACTESSWQVEDCPESCCEPSCCAPTCCQSSCCQP
FT                   SCCVPSCCAPAPCLTLVCTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQPSCC
FT                   VTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPCCVPVCCKPVCCTPICSGSSSCCQPSC
FT                   CAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCCRPNSSVSLLCHPACSRQA
FT                   SCGQKSSC"
FT   gene            <18993996..18994345
FT                   /locus_tag="mCG_141380"
FT                   /note="gene_id=mCG141380.0"
FT   mRNA            <18993996..18994345
FT                   /locus_tag="mCG_141380"
FT                   /product="mCG141380"
FT                   /note="gene_id=mCG141380.0 transcript_id=mCT175054.0
FT                   created on 29-OCT-2002"
FT   CDS             18993996..18994328
FT                   /codon_start=1
FT                   /locus_tag="mCG_141380"
FT                   /product="mCG141380"
FT                   /note="gene_id=mCG141380.0 transcript_id=mCT175054.0
FT                   protein_id=mCP97973.0"
FT                   /db_xref="GOA:F7CZ33"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="MGI:MGI:3642183"
FT                   /db_xref="UniProtKB/TrEMBL:F7CZ33"
FT                   /protein_id="EDL31794.1"
FT                   /translation="MCHTSCSSGCQPSCCVSSPCQPSCCVSSPCQSACCRPAICIPVRY
FT                   QVTCCVPVSYRPTVCMAPSCQSSVCMPVSCRPICVTSSCQSSGCCQPSCPTLVCRPVTC
FT                   STPSCC"
FT   gene            18998816..>18999186
FT                   /locus_tag="mCG_141349"
FT                   /note="gene_id=mCG141349.0"
FT   mRNA            18998816..>18999186
FT                   /locus_tag="mCG_141349"
FT                   /product="mCG141349"
FT                   /note="gene_id=mCG141349.0 transcript_id=mCT174816.0
FT                   created on 23-OCT-2002"
FT   CDS             18998827..18999186
FT                   /codon_start=1
FT                   /locus_tag="mCG_141349"
FT                   /product="mCG141349"
FT                   /note="gene_id=mCG141349.0 transcript_id=mCT174816.0
FT                   protein_id=mCP97735.0"
FT                   /protein_id="EDL31793.1"
FT                   /translation="MCHTSCSSGCQPSCCVSSPCQPSCCVSNPCQSSCCVSSSCQSACC
FT                   RPAICIPVRYQVACCVPVSCRPTVCMAPSCQSSVCMPVSCRPVCVTSSCQSSGGCQPSC
FT                   PTVVCRPVTCNPSCC"
FT   gene            <19003177..>19003539
FT                   /locus_tag="mCG_141348"
FT                   /note="gene_id=mCG141348.0"
FT   mRNA            <19003177..>19003539
FT                   /locus_tag="mCG_141348"
FT                   /product="mCG141348"
FT                   /note="gene_id=mCG141348.0 transcript_id=mCT174815.0
FT                   created on 23-OCT-2002"
FT   CDS             19003177..19003539
FT                   /codon_start=1
FT                   /locus_tag="mCG_141348"
FT                   /product="mCG141348"
FT                   /note="gene_id=mCG141348.0 transcript_id=mCT174815.0
FT                   protein_id=mCP97734.0"
FT                   /db_xref="GOA:J3KMP7"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="MGI:MGI:3641725"
FT                   /db_xref="UniProtKB/TrEMBL:J3KMP7"
FT                   /protein_id="EDL31792.1"
FT                   /translation="MCHTSCSSGCQPSCCVSSPCQPSCCMSSSCQPSCCVSSSCQSACC
FT                   RPAICIPVRYQVACCVPVSCRPTVCVAPSCQSSVCMPVSCRPVCVTSSCQSSGCCQPSC
FT                   PTLVCRPVTCSNPSCC"
FT   gene            19007956..19008626
FT                   /locus_tag="mCG_3373"
FT                   /note="gene_id=mCG3373.0"
FT   mRNA            19007956..19008626
FT                   /locus_tag="mCG_3373"
FT                   /product="mCG3373"
FT                   /note="gene_id=mCG3373.0 transcript_id=mCT2286.0 created on
FT                   20-SEP-2002"
FT   CDS             19007995..19008387
FT                   /codon_start=1
FT                   /locus_tag="mCG_3373"
FT                   /product="mCG3373"
FT                   /note="gene_id=mCG3373.0 transcript_id=mCT2286.0
FT                   protein_id=mCP9260.1"
FT                   /db_xref="GOA:Q9Z287"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="MGI:MGI:1328315"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z287"
FT                   /protein_id="EDL31791.1"
FT                   /translation="MCHTSCSSGCQPSCCVSSSCQPSCCVSSPCQASCFVSSPCQPSCC
FT                   VSSSCQSACCRPAICIPVRYQVACCVPVSCGPTVCMAPSCQSSVCVPVSCRPVCVTSSC
FT                   QSSGCCQPSCPTLVCKPVTCSNPSCC"
FT   gene            <19013856..>19014218
FT                   /locus_tag="mCG_141347"
FT                   /note="gene_id=mCG141347.0"
FT   mRNA            <19013856..>19014218
FT                   /locus_tag="mCG_141347"
FT                   /product="mCG141347"
FT                   /note="gene_id=mCG141347.0 transcript_id=mCT174814.0
FT                   created on 23-OCT-2002"
FT   CDS             19013856..19014218
FT                   /codon_start=1
FT                   /locus_tag="mCG_141347"
FT                   /product="mCG141347"
FT                   /note="gene_id=mCG141347.0 transcript_id=mCT174814.0
FT                   protein_id=mCP97733.0"
FT                   /db_xref="GOA:J3QK64"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="MGI:MGI:3642388"
FT                   /db_xref="UniProtKB/TrEMBL:J3QK64"
FT                   /protein_id="EDL31790.1"
FT                   /translation="MCHTSCSSGCQPSCCVSSPCQPSCCVSSPCQPSCCVSSPCQSACC
FT                   RPAICIPVRYQVACCVPVSCRPTVCMAPSCQSSVCVPVSCRPVCVTSSCQSSGGCQPSC
FT                   PTLVCRPVTCSNPSCC"
FT   gene            complement(<19022283..>19022597)
FT                   /locus_tag="mCG_141345"
FT                   /note="gene_id=mCG141345.0"
FT   mRNA            complement(<19022283..>19022597)
FT                   /locus_tag="mCG_141345"
FT                   /product="mCG141345"
FT                   /note="gene_id=mCG141345.0 transcript_id=mCT174808.0
FT                   created on 23-OCT-2002"
FT   CDS             complement(19022283..19022597)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141345"
FT                   /product="mCG141345"
FT                   /note="gene_id=mCG141345.0 transcript_id=mCT174808.0
FT                   protein_id=mCP97727.0"
FT                   /protein_id="EDL31789.1"
FT                   /translation="MCHTSCSSGCQPACCVSSSCQPACVPLSCRPAICVPVRCQVTCCV
FT                   PVSCRPTVCMAPSCQSSVCVPVSCRPVCVTSSCQSSGCCQPSCPTLICRPVTCSTPSCC
FT                   "
FT   gene            complement(<19029237..>19030079)
FT                   /locus_tag="mCG_1044199"
FT                   /note="gene_id=mCG1044199.1"
FT   mRNA            complement(<19029237..>19030079)
FT                   /locus_tag="mCG_1044199"
FT                   /product="mCG1044199"
FT                   /note="gene_id=mCG1044199.1 transcript_id=mCT161903.1
FT                   created on 23-OCT-2002"
FT   CDS             complement(19029237..19030079)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044199"
FT                   /product="mCG1044199"
FT                   /note="gene_id=mCG1044199.1 transcript_id=mCT161903.1
FT                   protein_id=mCP55089.1"
FT                   /protein_id="EDL31788.1"
FT                   /translation="MATSTMSVCSSDLSYDSRVCLPGSCDSCTDSSWQVDDCPESCCEP
FT                   CCCAPSCCQPNCCVPSCCQPSCCQSSCCAPSCCQSSCCVPSCCVPSCPQSSCCVPSCCA
FT                   PAPCLTLICTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQQPCCVTLCCKPVC
FT                   CTPICSGSCCQQSSCQSSCCQSPCCVSVCCKPVCCTPICSGSSSCCQPSCCAPVCCKPC
FT                   SSLSLLCRPVCRPACCVPTSSCCASSCQPSCCRPTSSVSLLCRPACSRQACCGQKSSC"
FT   gene            complement(19038313..>19039235)
FT                   /locus_tag="mCG_66967"
FT                   /note="gene_id=mCG66967.1"
FT   mRNA            complement(19038313..>19039235)
FT                   /locus_tag="mCG_66967"
FT                   /product="mCG66967"
FT                   /note="gene_id=mCG66967.1 transcript_id=mCT67150.1 created
FT                   on 23-OCT-2002"
FT   CDS             complement(19038402..19039235)
FT                   /codon_start=1
FT                   /locus_tag="mCG_66967"
FT                   /product="mCG66967"
FT                   /note="gene_id=mCG66967.1 transcript_id=mCT67150.1
FT                   protein_id=mCP31430.1"
FT                   /protein_id="EDL31787.1"
FT                   /translation="MATSTMSVCSDACTNSSWQVDDCPESCCEPCCCAPSCCQSSCCQP
FT                   SCCVPSCCAPAPCLTLVCTPVSCVSSPCCQFSCCTPSCCQQSSCQPACCTCSPCQQPCC
FT                   VTLCCKPVCCVPVCCGASSSCCQQSSCESSCCTSSPCQQPCCEPICCEPLCCEPVCCTP
FT                   ICPGPCCQQSSCQSSCCQSPCCVPVCCKPVCCTPICSGSSSCCQPSCCAPVCCKPCSSV
FT                   SLLCRPVCRPACCVPTSSCCASSCQPSCCCPTSSVSLLCRPACSRQACCGQKSSC"
FT   gene            complement(19046596..>19047561)
FT                   /locus_tag="mCG_61405"
FT                   /note="gene_id=mCG61405.1"
FT   mRNA            complement(19046596..>19047561)
FT                   /locus_tag="mCG_61405"
FT                   /product="mCG61405"
FT                   /note="gene_id=mCG61405.1 transcript_id=mCT61588.1 created
FT                   on 23-OCT-2002"
FT   CDS             complement(19046869..19047561)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61405"
FT                   /product="mCG61405"
FT                   /note="gene_id=mCG61405.1 transcript_id=mCT61588.1
FT                   protein_id=mCP31409.1"
FT                   /protein_id="EDL31786.1"
FT                   /translation="MAASTMSVCSDALTNSSWQVDDCPESCCEPCCCTPSCCQTSCCQP
FT                   SCCQTSCCAPGPCLTLVCTPVSCVSSPCCQSSCCTPSCYQQSSCQPACCTCSPCQPSCC
FT                   VTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPCCVPLCCKPVCCTPICSGSSSCCQPSC
FT                   CAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCCRPTSSVSLLCRPACCRQA
FT                   CCGQKSSC"
FT   gene            complement(<19059084..>19059776)
FT                   /locus_tag="mCG_61407"
FT                   /note="gene_id=mCG61407.1"
FT   mRNA            complement(<19059084..>19059776)
FT                   /locus_tag="mCG_61407"
FT                   /product="mCG61407"
FT                   /note="gene_id=mCG61407.1 transcript_id=mCT61590.1 created
FT                   on 23-OCT-2002"
FT   CDS             complement(19059084..19059776)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61407"
FT                   /product="mCG61407"
FT                   /note="gene_id=mCG61407.1 transcript_id=mCT61590.1
FT                   protein_id=mCP31415.1"
FT                   /db_xref="GOA:W4VSP7"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="MGI:MGI:3781416"
FT                   /db_xref="UniProtKB/TrEMBL:W4VSP7"
FT                   /protein_id="EDL31785.1"
FT                   /translation="MAASTMSVCSDALTNSSWQVDDCPESCCEPCCCAPSCCQTSCCQP
FT                   SCCQTSCCAPAPCLTLICTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQPSCC
FT                   VTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPCCVPLCCKPVCCTPICSGSPSCCQPSC
FT                   CAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSGCGPTSSVSLLCRPACCRQA
FT                   CCGQKSNC"
FT   gene            complement(19064970..19065672)
FT                   /locus_tag="mCG_141378"
FT                   /note="gene_id=mCG141378.0"
FT   mRNA            complement(19064970..19065672)
FT                   /locus_tag="mCG_141378"
FT                   /product="mCG141378"
FT                   /note="gene_id=mCG141378.0 transcript_id=mCT175041.0
FT                   created on 29-OCT-2002"
FT   CDS             complement(19065042..19065668)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141378"
FT                   /product="mCG141378"
FT                   /note="gene_id=mCG141378.0 transcript_id=mCT175041.0
FT                   protein_id=mCP97960.0"
FT                   /protein_id="EDL31784.1"
FT                   /translation="MAASTMSVCSDALTNSSWQVDDCPESCCEPCCCAPSCCQTSCCQP
FT                   SCCQTSCCAPAPCLTLICTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQPSCC
FT                   VTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPLLCASLLQACVLHTHLLWLLLLLPALL
FT                   LCSCVLQALLQPVPAVSPSVQTCLLCAHLLLLCLLLPAQLLWPNL"
FT   gene            complement(<19070616..>19071308)
FT                   /locus_tag="mCG_1044144"
FT                   /note="gene_id=mCG1044144.0"
FT   mRNA            complement(<19070616..>19071308)
FT                   /locus_tag="mCG_1044144"
FT                   /product="mCG1044144"
FT                   /note="gene_id=mCG1044144.0 transcript_id=mCT161848.0
FT                   created on 23-OCT-2002"
FT   CDS             complement(19070616..19071308)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044144"
FT                   /product="mCG1044144"
FT                   /note="gene_id=mCG1044144.0 transcript_id=mCT161848.0
FT                   protein_id=mCP55001.0"
FT                   /protein_id="EDL31783.1"
FT                   /translation="MAASTMSVCSDALTNSSWQVDDCPESCCEPCCCAPSCCQTSCCQP
FT                   SCCQTSCCAPAPCLTLICTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQPSCC
FT                   VTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPCCVPICCKPVCCTPICSGSSSCCQPSC
FT                   CAPVCCKPCSSLSLLCHPVCRPACCVPTSSCCASSCQPSCCGPTSSVSLLCRPACCRQA
FT                   CCGQKSSC"
FT   gene            complement(19076242..>19076969)
FT                   /locus_tag="mCG_1044197"
FT                   /note="gene_id=mCG1044197.1"
FT   mRNA            complement(19076242..>19076969)
FT                   /locus_tag="mCG_1044197"
FT                   /product="mCG1044197"
FT                   /note="gene_id=mCG1044197.1 transcript_id=mCT161901.1
FT                   created on 23-OCT-2002"
FT   CDS             complement(19076259..19076969)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1044197"
FT                   /product="mCG1044197"
FT                   /note="gene_id=mCG1044197.1 transcript_id=mCT161901.1
FT                   protein_id=mCP55072.1"
FT                   /db_xref="GOA:J3QMW1"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="MGI:MGI:3779677"
FT                   /db_xref="UniProtKB/TrEMBL:J3QMW1"
FT                   /protein_id="EDL31782.1"
FT                   /translation="MAASTMSVCSDALTNSSWQVDDCPESCCEPCCCCQTSCCQPSCCQ
FT                   TSCCQPSCCQPSCCAPAPCLTLVCTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSP
FT                   CQPSCCVTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPCCVPICCKPVCCTPICSGSSS
FT                   CCQPSCCAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCCGPTSSVSLLCRP
FT                   ACCRQACCGQKSSC"
FT   gene            complement(19083315..>19083997)
FT                   /locus_tag="mCG_61406"
FT                   /note="gene_id=mCG61406.2"
FT   mRNA            complement(19083315..>19083997)
FT                   /locus_tag="mCG_61406"
FT                   /product="mCG61406"
FT                   /note="gene_id=mCG61406.2 transcript_id=mCT61589.2 created
FT                   on 23-OCT-2002"
FT   CDS             complement(19083320..19083997)
FT                   /codon_start=1
FT                   /locus_tag="mCG_61406"
FT                   /product="mCG61406"
FT                   /note="gene_id=mCG61406.2 transcript_id=mCT61589.2
FT                   protein_id=mCP31413.2"
FT                   /protein_id="EDL31781.1"
FT                   /translation="MAASTMSVCSDTCTNSSWQVDDCPESCCEPCCCAPSCCQTSCCTP
FT                   SCCAPAPCLTLICTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQPSCCVTLCC
FT                   KPVCCTPICSGPCCQQSSCQSSCCQSPCCVPVCCKPVCCTPICSGSSSCCQPSCCAPVC
FT                   CKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCCGPTSSVSLLCRPACCRQACCGQK
FT                   SRR"
FT   gene            complement(19087305..>19088065)
FT                   /locus_tag="mCG_51881"
FT                   /note="gene_id=mCG51881.1"
FT   mRNA            complement(19087305..>19088065)
FT                   /locus_tag="mCG_51881"
FT                   /product="mCG51881"
FT                   /note="gene_id=mCG51881.1 transcript_id=mCT52064.1 created
FT                   on 23-OCT-2002"
FT   CDS             complement(19087319..19088065)
FT                   /codon_start=1
FT                   /locus_tag="mCG_51881"
FT                   /product="mCG51881"
FT                   /note="gene_id=mCG51881.1 transcript_id=mCT52064.1
FT                   protein_id=mCP31429.1"
FT                   /db_xref="GOA:J3QMD1"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="InterPro:IPR007951"
FT                   /db_xref="MGI:MGI:5011853"
FT                   /db_xref="UniProtKB/TrEMBL:J3QMD1"
FT                   /protein_id="EDL31780.1"
FT                   /translation="MADTCCTRTCVIAASTTSVCSSNLSCGNRICSPSTCLGASWQADN
FT                   CQESYCEPPCCAPSCCQSSYCQPSCCAPAPCLTLVCTPVSCVSSPCCQSSCCTPSCCQQ
FT                   SSCQPACCTCSPCQQPCCVTLCCKPVCCTPICSGSCCQQSSCQSSCCQSPCCVPVCCKP
FT                   VCCTPICSGSSPCCQPSCCAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCC
FT                   GPTSSVSLLCRPACSKQACCGQKSSC"
FT   gene            complement(19099684..>19100780)
FT                   /locus_tag="mCG_141381"
FT                   /note="gene_id=mCG141381.0"
FT   mRNA            complement(19099684..>19100780)
FT                   /locus_tag="mCG_141381"
FT                   /product="mCG141381"
FT                   /note="gene_id=mCG141381.0 transcript_id=mCT175057.0
FT                   created on 29-OCT-2002"
FT   CDS             complement(19100109..19100780)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141381"
FT                   /product="mCG141381"
FT                   /note="gene_id=mCG141381.0 transcript_id=mCT175057.0
FT                   protein_id=mCP97976.0"
FT                   /protein_id="EDL31779.1"
FT                   /translation="MAASTMSVCSDARTNSSWQVDDCPESCCEPCCCAPSCCQSSCCVP
FT                   SCCQSSCCAPAPSLTLICTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQQPCC
FT                   VTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPCCVPVCCKPVCCTPICSGSSSCCQPSC
FT                   CAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCCGPTSSVSLLCRPACSCST
FT                   C"
FT   gene            <19103615..>19104337
FT                   /locus_tag="mCG_66968"
FT                   /note="gene_id=mCG66968.2"
FT   mRNA            <19103615..>19104337
FT                   /locus_tag="mCG_66968"
FT                   /product="mCG66968"
FT                   /note="gene_id=mCG66968.2 transcript_id=mCT67151.2 created
FT                   on 23-OCT-2002"
FT   CDS             19103615..19104337
FT                   /codon_start=1
FT                   /locus_tag="mCG_66968"
FT                   /product="mCG66968"
FT                   /note="gene_id=mCG66968.2 transcript_id=mCT67151.2
FT                   protein_id=mCP31431.2"
FT                   /protein_id="EDL31778.1"
FT                   /translation="MAASTMSVCSDTRTNSSWQVDDCPESCCEPCCCAPSCCQSSCCVP
FT                   SCCQSSCCVPSCCQPSCCAPSPCLTLVCTPVSCVSSPCCQSSCCTPSCCQQSSCQPACC
FT                   TCSPCQQPCCVTLCCKPVCCTPICSGPCCQQSSCQSSCCQSPCCVPVCCKPVCCTPICS
FT                   GSSSCCQPSCCAPVCCKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCCGPTSSVSL
FT                   LCRPACCRQASCGQKSSC"
FT   gene            complement(19115074..19116055)
FT                   /locus_tag="mCG_141350"
FT                   /note="gene_id=mCG141350.0"
FT   mRNA            complement(19115074..19116055)
FT                   /locus_tag="mCG_141350"
FT                   /product="mCG141350"
FT                   /note="gene_id=mCG141350.0 transcript_id=mCT174819.0
FT                   created on 23-OCT-2002"
FT   CDS             complement(19115336..19116001)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141350"
FT                   /product="mCG141350"
FT                   /note="gene_id=mCG141350.0 transcript_id=mCT174819.0
FT                   protein_id=mCP97738.0"
FT                   /db_xref="GOA:Q08EG8"
FT                   /db_xref="InterPro:IPR002494"
FT                   /db_xref="MGI:MGI:1925013"
FT                   /db_xref="UniProtKB/TrEMBL:Q08EG8"
FT                   /protein_id="EDL31777.1"
FT                   /translation="MAASTMSVCSDARTNSSWQVDDCPESCCEPCCCAPSCCQPSCCQP
FT                   SCCVPSCCAPSCCVPSCCQPSCCAPAPCLTLICTPVSCVSSPCCQSSCCTPSCCQQSSC
FT                   QPACCTCSPCQPSCCVPVCCTPVCCTPVCCKPVCCTPICSGSSSCCQPSCCAPVCCKPC
FT                   SSLSLLCRPVCRPACCVPTSSCCASSCQPSCCGPTSSVSLLCRPACSRQACCGQKSSC"
FT   gene            19118426..>19175701
FT                   /gene="C330046G03Rik"
FT                   /locus_tag="mCG_50884"
FT                   /note="gene_id=mCG50884.2"
FT   mRNA            join(19118426..19118646,19153801..19154039,
FT                   19155437..19155527,19156829..19156985,19158720..19158851,
FT                   19159480..19159706,19162350..19162536,19164143..19164372,
FT                   19170320..19170507,19172699..19172800,19175685..>19175701)
FT                   /gene="C330046G03Rik"
FT                   /locus_tag="mCG_50884"
FT                   /product="RIKEN cDNA C330046G03, transcript variant
FT                   mCT51067"
FT                   /note="gene_id=mCG50884.2 transcript_id=mCT51067.2 created
FT                   on 22-OCT-2002"
FT   mRNA            join(19118426..19118646,19153801..19154039,
FT                   19155437..19155527,19156829..19156985,19158720..19158851,
FT                   19159480..19159706,19162350..19162536,19164143..19164372,
FT                   19170320..>19170544)
FT                   /gene="C330046G03Rik"
FT                   /locus_tag="mCG_50884"
FT                   /product="RIKEN cDNA C330046G03, transcript variant
FT                   mCT174818"
FT                   /note="gene_id=mCG50884.2 transcript_id=mCT174818.0 created
FT                   on 22-OCT-2002"
FT   CDS             join(19118491..19118646,19153801..19154039,
FT                   19155437..19155527,19156829..19156985,19158720..19158851,
FT                   19159480..19159706,19162350..19162536,19164143..19164372,
FT                   19170320..19170507,19172699..19172800,19175685..>19175701)
FT                   /codon_start=1
FT                   /gene="C330046G03Rik"
FT                   /locus_tag="mCG_50884"
FT                   /product="RIKEN cDNA C330046G03, isoform CRA_b"
FT                   /note="gene_id=mCG50884.2 transcript_id=mCT51067.2
FT                   protein_id=mCP31410.2 isoform=CRA_b"
FT                   /protein_id="EDL31772.1"
FT                   /translation="MVQVEGVRGLQFSATEPRTTSFPASRIFSSCDFFPEEFSIIVTLR
FT                   VPNLPPKKNEYLLSLLAEERDTLLLGLRYSPTQLHFLFLSEDLAGAWQTRVSFWSPGLM
FT                   DSRWHTLILAVSQGSFSLTTDCGLPVDIMADVSFPPTLSVRGARFFIGSRKRTKGLFTG
FT                   VIRQLVLLPGSDATPQLCPSRNARLAELSIPQVLKRLTGKPDDNEVLNYPYEADMKVTL
FT                   GSRPPCTKAEGAQFWFDAAQKGLYLCAGSEWVSVLAAKTKLDYVEEHQSLHTNSETLGI
FT                   EVFSIPGVGLFAAAANRKARSAIYKWTDGKFVSYQNIATHQAQSWRHFTIGKKIFLAVA
FT                   NFGPNERGQEFSVIYKWSPRKLKFTLYQRIATHSARDWEAFEVDGEHFLVVANHREGDN
FT                   HNIDSMVYRWNPSSQLFEANQSIATSGAYDWEFFTVGPYSFLVVANTFNGTSTQVHSHL
FT                   YIWLVGAFQLFQSFLTFGAADWEVFHIGERIFLAVANSHSYDVQMQAQNDSYVLSSVIY
FT                   ELNITAQTFVKFQDIPTCSALDWEFFSVGEDHFLVVANSFDGNTFSVNSIIYRWQGYE"
FT   CDS             join(19118491..19118646,19153801..19154039,
FT                   19155437..19155527,19156829..19156985,19158720..19158851,
FT                   19159480..19159706,19162350..19162536,19164143..19164372,
FT                   19170320..19170544)
FT                   /codon_start=1
FT                   /gene="C330046G03Rik"
FT                   /locus_tag="mCG_50884"
FT                   /product="RIKEN cDNA C330046G03, isoform CRA_a"
FT                   /note="gene_id=mCG50884.2 transcript_id=mCT174818.0
FT                   protein_id=mCP97737.0 isoform=CRA_a"
FT                   /protein_id="EDL31771.1"
FT                   /translation="MVQVEGVRGLQFSATEPRTTSFPASRIFSSCDFFPEEFSIIVTLR
FT                   VPNLPPKKNEYLLSLLAEERDTLLLGLRYSPTQLHFLFLSEDLAGAWQTRVSFWSPGLM
FT                   DSRWHTLILAVSQGSFSLTTDCGLPVDIMADVSFPPTLSVRGARFFIGSRKRTKGLFTG
FT                   VIRQLVLLPGSDATPQLCPSRNARLAELSIPQVLKRLTGKPDDNEVLNYPYEADMKVTL
FT                   GSRPPCTKAEGAQFWFDAAQKGLYLCAGSEWVSVLAAKTKLDYVEEHQSLHTNSETLGI
FT                   EVFSIPGVGLFAAAANRKARSAIYKWTDGKFVSYQNIATHQAQSWRHFTIGKKIFLAVA
FT                   NFGPNERGQEFSVIYKWSPRKLKFTLYQRIATHSARDWEAFEVDGEHFLVVANHREGDN
FT                   HNIDSMVYRWNPSSQLFEANQSIATSGAYDWEFFTVGPYSFLVVANTFNGTSTQVHSHL
FT                   YIWLVGAFQLFQSFLTFGAADWEVFHIGERIFLAVANSHSYDVQMQAQNDSYVLSSVIY
FT                   ELNITAQTFVKFQDIPTCRYQPGGCKGRVS"
FT   gene            19124908..19126209
FT                   /locus_tag="mCG_64639"
FT                   /note="gene_id=mCG64639.1"
FT   mRNA            19124908..19126209
FT                   /locus_tag="mCG_64639"
FT                   /product="mCG64639"
FT                   /note="gene_id=mCG64639.1 transcript_id=mCT64822.1 created
FT                   on 23-OCT-2002"
FT   CDS             19124958..19125611
FT                   /codon_start=1
FT                   /locus_tag="mCG_64639"
FT                   /product="mCG64639"
FT                   /note="gene_id=mCG64639.1 transcript_id=mCT64822.1
FT                   protein_id=mCP31417.0"
FT                   /protein_id="EDL31776.1"
FT                   /translation="MAASTMSVCSDARTNSSWQVDDCPESCCEPCCCAPSCCQPSCCQP
FT                   SCCQPSCCQPSCCAPAPCLTLICTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPC
FT                   QPSCCVPVCCTPVCCTPVCCTPVCCKPVCCTPICSGSSSSCCQPSCCAPVCCKPCSSLS
FT                   LLCRPVCRPACCVPTSSCCASSCQPNCCRPASCVSLLCRPACSKQACCGQKSSC"
FT   gene            19136011..19136510
FT                   /locus_tag="mCG_54361"
FT                   /note="gene_id=mCG54361.1"
FT   mRNA            19136011..19136510
FT                   /locus_tag="mCG_54361"
FT                   /product="mCG54361"
FT                   /note="gene_id=mCG54361.1 transcript_id=mCT54544.1 created
FT                   on 23-OCT-2002"
FT   CDS             19136013..19136489
FT                   /codon_start=1
FT                   /locus_tag="mCG_54361"
FT                   /product="mCG54361"
FT                   /note="gene_id=mCG54361.1 transcript_id=mCT54544.1
FT                   protein_id=mCP31432.0"
FT                   /protein_id="EDL31775.1"
FT                   /translation="MAASTMSVCSDTRTNSSWQVDDCPESCCEPCCCAPSCCQPSCCVP
FT                   SCCAPAPCLTLICTPVSYVSSPCCQSSCCTPSCCQQSSCQSACCTCSPCQPSCCVPVCC
FT                   TPVCCKPVCCVSICSGGQPACCTSSPCQPSCCVPVCCKPVCCEAVCCGVSSSGC"
FT   gene            19142066..19142959
FT                   /locus_tag="mCG_141351"
FT                   /note="gene_id=mCG141351.0"
FT   mRNA            19142066..19142959
FT                   /locus_tag="mCG_141351"
FT                   /product="mCG141351"
FT                   /note="gene_id=mCG141351.0 transcript_id=mCT174820.0
FT                   created on 23-OCT-2002"
FT   CDS             19142069..19142746
FT                   /codon_start=1
FT                   /locus_tag="mCG_141351"
FT                   /product="mCG141351"
FT                   /note="gene_id=mCG141351.0 transcript_id=mCT174820.0
FT                   protein_id=mCP97739.0"
FT                   /protein_id="EDL31774.1"
FT                   /translation="MAASTMSVCSDARTNSSWQVDDCPESCCEPCCCAPSCCQPCCCAP
FT                   SCCQPCCCAPSPCLTLLCTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQPSCC
FT                   VTLCCKPVCCTPICSGSCCQSSCCQSPCCVPVCCKPVCCTPICSGSSSCCQPSCCAPVC
FT                   CKPCSSLSLLCRPVCRPACCVPTSSCCASSCQPSCCRPTSSVSLLCRPACCRQACCGQK
FT                   SSC"
FT   gene            19151132..19151795
FT                   /locus_tag="mCG_141352"
FT                   /note="gene_id=mCG141352.0"
FT   mRNA            19151132..19151795
FT                   /locus_tag="mCG_141352"
FT                   /product="mCG141352"
FT                   /note="gene_id=mCG141352.0 transcript_id=mCT174821.0
FT                   created on 23-OCT-2002"
FT   CDS             19151176..19151781
FT                   /codon_start=1
FT                   /locus_tag="mCG_141352"
FT                   /product="mCG141352"
FT                   /note="gene_id=mCG141352.0 transcript_id=mCT174821.0
FT                   protein_id=mCP97740.0"
FT                   /protein_id="EDL31773.1"
FT                   /translation="MAASTMSVCSDARTNSSWQVDDCPESCCEPCCCAPSCCQPCCCAP
FT                   APCLTLLCTPVSCVSSPCCQSSCCTPSCCQQSSCQPACCTCSPCQQPCCVPVCCTPVCC
FT                   TPVCCKPVCCKPVCCTPICSGSSSCCQPSCCAPVCCKPCSSLSLLCRPVCRPACCVPTS
FT                   SCCASSCQPSCCGPTSSVSLLCRPACSRQACCGQKSSC"
FT   gene            19182722..19185416
FT                   /locus_tag="mCG_142353"
FT                   /note="gene_id=mCG142353.0"
FT   mRNA            join(19182722..19183368,19185147..19185416)
FT                   /locus_tag="mCG_142353"
FT                   /product="mCG142353"
FT                   /note="gene_id=mCG142353.0 transcript_id=mCT180024.0
FT                   created on 13-FEB-2003"
FT   CDS             19182964..19183224
FT                   /codon_start=1
FT                   /locus_tag="mCG_142353"
FT                   /product="mCG142353"
FT                   /note="gene_id=mCG142353.0 transcript_id=mCT180024.0
FT                   protein_id=mCP102946.0"
FT                   /protein_id="EDL31770.1"
FT                   /translation="MTTVGKGRKISVGHDHKTTVTKGHRISLGNDHRTIVTNGVRTTVG
FT                   NDHRNKVTKGHMTSVGNDHRTIVTDGLRTTVGNDYMAIVPR"
FT   gene            complement(19189067..19191967)
FT                   /gene="Lrrc3"
FT                   /locus_tag="mCG_5983"
FT                   /note="gene_id=mCG5983.2"
FT   mRNA            complement(join(19189067..19191037,19191704..19191967))
FT                   /gene="Lrrc3"
FT                   /locus_tag="mCG_5983"
FT                   /product="leucine rich repeat containing 3"
FT                   /note="gene_id=mCG5983.2 transcript_id=mCT4112.2 created on
FT                   22-OCT-2002"
FT   CDS             complement(19190132..19190905)
FT                   /codon_start=1
FT                   /gene="Lrrc3"
FT                   /locus_tag="mCG_5983"
FT                   /product="leucine rich repeat containing 3"
FT                   /note="gene_id=mCG5983.2 transcript_id=mCT4112.2
FT                   protein_id=mCP9282.1"
FT                   /db_xref="GOA:Q543Z4"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:2447899"
FT                   /db_xref="UniProtKB/TrEMBL:Q