Dbfetch

ID   CH466553; SV 2; linear; genomic DNA; CON; MUS; 23075134 BP.
XX
AC   CH466553;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009814720 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-23075134
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-23075134
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-23075134
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 79aad2f48a2e2d6bb027896271d72af2.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000218.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000290; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000730; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000731; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000732; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000901; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000902; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000903; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001150; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001436; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001663; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001665; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001666; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003072; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003341; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003345; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003923; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004665; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004667; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004929; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004931; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004933; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004934; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004937; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005357; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006344; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006345; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006498; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009070; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009092; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009114; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009115; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009292; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009293; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000009646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000013833; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000014329; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019927; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019933; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019945; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020069; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020070; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020075; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020081; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020088; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020091; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020092; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020100; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020101; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020107; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020108; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020109; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020135; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020178; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020196; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020211; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020226; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020230; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020232; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020235; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020262; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020265; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020277; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020284; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020308; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020310; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020325; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020327; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000020329; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023175; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032714; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033208; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033318; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033416; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033427; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033444; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034758; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034781; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034881; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034917; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034974; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035011; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035027; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035262; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035370; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035397; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035486; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035595; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035773; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035781; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035835; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035863; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036764; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037031; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037171; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037202; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037868; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042774; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043259; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043822; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045193; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046493; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048240; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049422; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049764; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051190; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051652; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052151; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053603; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054206; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054452; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055515; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057337; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000057729; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059901; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060205; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061780; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069565; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069582; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069584; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000069622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000071185; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074862; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078439; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078442; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090439; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091468; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094146; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094913; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095721; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095817; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000095970; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096380; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096421; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017256; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017261; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017262; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017263; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017266; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017267; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017269; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017270; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017271; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017275; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017276; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017277; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017278; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017279; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017280; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017285; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017293; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017294; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017295; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017302; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017310; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017319; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017324; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017330; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017332; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017333; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017336; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017338; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017341; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017342; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017343; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017348; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017349; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017352; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017353; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017354; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017355; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017358; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017359; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017361; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017362; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017364; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017365; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017367; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017368; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017369; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017370; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017371; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017372; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017373; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017375; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017376; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017377; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017378; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017379; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017382; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017384; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017386; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017392; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017395; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017396; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017398; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017400; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017401; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017402; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017403; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017404; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017405; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017406; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017407; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017408; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017410; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017411; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017412; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017413; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017414; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017416; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017420; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017426; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017427; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017428; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017429; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017430; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017431; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017435; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017436; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017437; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017438; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017439; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017441; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017450; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017451; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017453; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017454; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017459; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017461; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017464; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017467; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017468; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017469; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017471; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017476; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017478; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017486; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017487; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017492; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017494; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017499; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017507; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017510; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017511; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017515; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017519; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017520; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017521; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017530; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017534; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017536; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017537; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017538; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017540; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017541; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017545; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017547; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017548; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017551; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017553; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017556; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017558; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017564; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017565; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017233; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017239; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017240; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017241; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017244; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017245; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017247; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017248; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017249; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017253; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017254; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017255; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017256; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017257; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017258; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017263; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017268; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017270; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017271; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017272; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017273; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017280; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017288; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017296; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017301; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017307; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017309; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017310; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017315; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017318; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017319; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017320; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017325; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017326; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017329; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017330; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017331; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017332; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017335; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017336; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017338; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017339; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017341; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017342; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017344; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017345; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017346; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017347; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017348; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017349; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017350; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017352; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017353; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017354; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017355; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017356; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017359; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017361; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017363; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017369; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017372; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017373; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017375; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017377; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017378; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017379; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017380; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017382; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017383; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017386; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017388; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017390; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017391; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017392; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017394; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017398; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017404; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017405; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017406; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017407; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017408; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017409; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017413; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017414; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017415; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017416; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017417; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017428; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017429; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017431; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017432; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017437; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017439; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017441; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017442; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017445; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017446; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017447; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017449; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017454; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017456; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017464; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017465; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017470; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017472; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017477; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017485; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017488; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017489; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017493; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017497; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017498; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017499; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017508; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017512; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017514; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017515; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017516; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017518; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017519; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017523; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017525; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017526; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017529; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017531; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017534; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017536; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017542; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0017543; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017192; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017197; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017200; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017201; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017204; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017205; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017208; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017213; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017214; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017215; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017216; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017217; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017218; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017223; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017230; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017231; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017232; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017233; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017240; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017248; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017257; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017262; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017268; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017270; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017271; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017274; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017276; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017279; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017280; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017281; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017286; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017287; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017290; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017291; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017292; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017293; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017296; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017297; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017299; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017300; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017302; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017303; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017305; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017306; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017307; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017308; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017309; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017310; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017311; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017313; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017314; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017315; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017316; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017317; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017320; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017324; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017330; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017333; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017334; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017336; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017338; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017339; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017340; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017341; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017342; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017343; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017344; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017345; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017346; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017349; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017352; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017353; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017354; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017355; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017357; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017361; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017367; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017368; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017369; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017370; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017371; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017372; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017376; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017377; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017378; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017379; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017380; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017389; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017390; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017392; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017393; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017398; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017400; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017402; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017403; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017406; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017407; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017408; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017410; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017415; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017417; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017425; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017426; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017431; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017433; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017438; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017446; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017449; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017450; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017454; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017458; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017459; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017460; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017469; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017473; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017475; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017476; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017477; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017479; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017480; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017484; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017486; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017487; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017490; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017492; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017495; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017497; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017503; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017504; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0025532; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017194; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017199; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017200; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017201; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017204; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017205; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017207; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017208; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017209; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017213; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017214; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017215; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017216; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017217; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017218; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017223; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017230; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017231; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017232; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017233; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017240; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017248; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017256; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017261; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017267; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017269; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017270; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017273; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017275; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017278; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017279; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017280; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017285; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017286; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017289; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017290; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017291; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017292; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017295; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017296; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017298; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017299; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017301; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017302; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017304; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017305; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017306; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017307; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017308; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017309; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017310; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017312; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017313; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017314; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017315; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017316; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017319; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017321; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017323; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017329; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017332; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017333; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017335; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017337; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017338; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017339; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017340; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017341; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017342; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017343; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017344; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017348; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017350; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017351; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017352; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017353; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017354; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017356; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017360; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017366; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017367; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017368; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017369; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017370; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017371; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017375; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017376; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017377; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017378; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017379; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017390; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017391; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017393; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017394; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017399; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017401; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017403; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017404; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017407; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017408; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017409; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017411; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017416; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017418; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017426; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017427; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017432; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017434; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017439; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017447; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017450; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017451; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017455; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017459; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017460; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017461; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017470; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017474; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017476; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017477; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017478; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017480; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017481; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017485; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017487; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017488; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017491; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017493; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017496; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017498; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017504; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017505; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0021093; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017017; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017022; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017023; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017024; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017027; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017028; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017030; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017031; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017036; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017037; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017038; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017039; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017040; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017041; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017046; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017051; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017053; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017054; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017055; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017056; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017063; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017071; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017080; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017085; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017091; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017093; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017094; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017099; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017102; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017103; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017104; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017109; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017110; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017113; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017114; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017115; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017116; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017119; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017120; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017122; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017123; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017125; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017126; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017128; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017129; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017130; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017131; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017132; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017134; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017136; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017137; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017138; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017139; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017140; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017143; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017145; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017147; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017153; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017156; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017157; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017159; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017161; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017162; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017163; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017164; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017165; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017166; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017167; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017168; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017173; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017174; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017175; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017176; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017177; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017179; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017183; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017189; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017190; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017191; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017192; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017193; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017194; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017198; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017199; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017200; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017201; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017202; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017207; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017213; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017214; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017216; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017217; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017222; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017224; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017226; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017227; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017230; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017231; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017232; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017234; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017239; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017241; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017249; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017250; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017255; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017257; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017262; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017270; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017273; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017274; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017278; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017282; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017283; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017284; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017293; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017297; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017299; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017300; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017301; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017303; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017304; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017308; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017310; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017311; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017314; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017316; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017319; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017321; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017327; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017328; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017652; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017657; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017658; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017659; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017662; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017663; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017665; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017666; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017667; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017671; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017672; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017673; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017674; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017675; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017676; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017681; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017686; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017688; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017689; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017690; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017691; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017698; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017706; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017714; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017719; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017725; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017727; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017728; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017731; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017733; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017736; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017737; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017738; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017743; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017744; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017747; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017748; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017750; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017753; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017754; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017756; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017757; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017759; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017760; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017762; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017763; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017764; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017765; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017766; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017767; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017768; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017770; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017771; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017772; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017773; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017774; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017777; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017781; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017787; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017790; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017791; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017793; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017795; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017796; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017797; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017798; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017799; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017800; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017801; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017802; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017803; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017804; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017806; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017807; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017808; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017809; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017810; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017812; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017816; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017822; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017823; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017824; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017825; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017826; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017827; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017830; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017831; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017832; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017833; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017834; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017835; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017844; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017845; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017847; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017848; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017853; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017855; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017857; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017858; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017861; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017862; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017863; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017865; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017870; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017872; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017880; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017881; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017886; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017888; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017893; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017901; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017904; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017905; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017909; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017913; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017914; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017915; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017924; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017928; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017930; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017931; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017932; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017934; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017935; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017939; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017941; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017942; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017945; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017947; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017950; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017952; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017958; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017959; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0021525; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016588; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016593; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016594; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016595; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016598; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016599; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016601; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016602; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016607; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016608; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016609; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016610; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016611; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016612; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016617; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016622; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016624; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016625; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016626; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016627; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016634; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016642; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016661; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016663; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016664; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016667; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016669; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016672; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016674; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016679; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016680; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016683; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016684; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016685; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016687; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016690; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016691; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016693; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016694; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016696; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016697; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016699; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016700; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016701; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016702; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016703; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016704; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016705; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016707; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016708; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016709; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016710; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016713; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016715; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016717; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016723; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016726; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016727; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016729; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016731; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016732; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016733; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016734; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016735; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016736; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016737; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016738; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016739; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016741; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016743; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016744; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016745; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016746; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016747; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016749; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016753; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016759; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016760; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016761; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016762; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016763; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016764; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016768; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016769; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016770; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016771; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016772; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016780; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016781; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016783; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016784; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016789; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016791; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016794; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016797; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016798; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016799; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016801; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016806; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016808; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016816; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016817; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016824; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016829; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016837; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016840; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016841; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016845; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016849; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016850; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016851; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016860; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016864; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016866; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016867; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016868; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016870; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016871; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016875; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016877; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016878; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016881; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016883; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016886; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016888; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016894; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016895; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016897; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0016989; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0016994; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0016995; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0016996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0016999; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017000; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017002; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017003; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017008; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017009; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017010; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017011; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017012; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017013; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017018; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017023; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017025; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017026; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017027; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017028; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017035; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017043; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017052; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017057; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017063; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017065; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017066; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017069; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017071; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017074; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017075; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017076; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017081; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017082; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017085; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017086; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017087; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017088; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017091; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017092; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017094; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017095; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017097; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017098; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017100; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017101; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017102; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017103; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017104; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017105; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017106; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017108; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017109; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017111; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017112; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017115; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017117; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017119; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017125; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017128; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017129; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017131; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017133; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017134; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017135; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017136; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017137; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017138; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017139; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017140; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017144; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017145; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017146; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017147; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017148; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017149; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017151; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017155; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017161; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017162; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017163; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017164; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017165; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017166; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017170; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017171; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017172; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017173; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017174; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017177; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017185; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017186; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017188; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017189; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017194; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017196; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017198; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017199; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017202; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017203; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017204; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017206; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017211; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017213; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017221; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017222; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017227; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017229; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017234; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017242; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017245; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017246; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017250; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017254; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017255; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017256; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017265; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017269; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017271; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017272; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017273; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017275; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017276; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017280; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017282; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017283; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017286; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017288; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017291; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017293; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017299; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017300; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017094; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017099; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017100; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017101; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017104; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017105; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017107; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017108; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017113; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017114; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017115; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017116; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017117; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017123; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017128; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017130; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017131; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017132; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017133; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017140; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017148; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017157; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017162; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017168; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017170; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017171; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017174; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017176; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017179; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017180; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017181; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017186; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017187; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017190; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017191; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017192; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017193; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017196; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017197; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017199; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017200; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017202; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017203; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017205; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017206; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017207; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017208; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017209; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017210; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017211; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017213; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017214; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017215; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017216; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017217; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017220; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017222; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017224; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017233; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017234; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017236; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017238; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017239; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017241; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017242; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017243; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017244; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017245; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017251; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017253; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017254; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017255; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017256; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017257; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017259; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017263; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017269; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017270; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017271; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017272; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017273; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017274; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017278; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017279; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017280; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017281; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017282; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017291; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017292; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017294; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017295; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017300; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017302; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017304; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017305; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017308; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017309; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017310; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017312; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017317; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017319; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017327; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017328; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017333; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017335; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017340; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017348; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017351; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017352; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017356; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017360; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017361; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017362; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017371; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017375; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017377; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017378; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017379; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017381; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017382; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017386; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017388; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017389; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017392; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017394; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017397; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017399; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017405; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017406; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017088; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017093; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017094; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017095; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017098; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017099; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017101; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017102; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017103; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017107; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017108; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017109; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017110; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017111; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017112; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017117; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017124; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017125; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017126; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017127; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017134; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017142; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017150; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017155; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017161; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017163; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017164; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017167; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017169; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017172; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017173; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017174; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017179; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017183; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017184; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017185; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017186; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017190; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017192; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017193; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017195; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017196; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017198; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017199; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017200; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017201; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017202; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017203; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017204; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017206; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017207; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017208; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017209; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017212; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017214; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017216; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017222; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017225; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017226; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017228; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017230; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017231; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017233; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017234; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017235; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017236; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017237; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017241; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017242; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017243; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017245; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017246; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017247; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017248; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017249; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017251; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017255; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017261; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017262; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017263; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017264; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017265; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017266; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017270; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017271; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017272; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017273; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017274; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017277; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017279; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017285; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017286; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017288; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017289; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017294; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017296; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017299; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017302; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017303; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017304; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017306; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017311; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017313; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017321; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017322; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017327; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017329; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017334; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017342; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017345; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017346; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017350; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017354; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017355; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017356; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017365; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017369; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017371; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017372; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017373; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017375; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017376; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017380; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017382; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017383; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017386; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017388; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017391; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017393; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017399; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017400; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035256; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017169; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017174; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017175; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017176; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017179; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017180; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017182; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017183; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017184; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017188; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017189; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017190; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017191; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017192; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017193; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017198; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017204; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017205; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017206; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017207; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017214; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017222; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017235; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017241; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017243; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017244; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017247; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017249; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017252; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017254; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017259; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017260; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017263; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017264; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017265; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017266; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017269; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017270; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017272; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017273; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017275; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017276; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017278; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017279; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017280; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017281; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017282; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017283; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017284; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017286; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017287; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017288; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017289; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017290; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017293; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017295; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017297; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017303; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017306; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017307; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017309; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017311; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017312; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017313; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017314; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017315; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017316; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017317; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017318; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017321; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017324; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017325; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017326; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017328; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017330; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017334; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017340; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017341; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017342; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017343; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017344; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017345; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017347; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017348; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017349; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017350; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017351; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017352; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017362; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017363; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017365; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017366; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017371; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017373; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017375; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017376; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017379; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017380; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017381; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017383; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017388; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017390; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017398; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017399; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017404; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017406; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017411; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017419; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017422; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017423; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017427; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017431; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017432; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017433; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017442; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017446; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017448; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017449; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017450; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017452; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017453; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017457; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017459; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017460; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017463; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017465; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017468; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017470; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017476; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017477; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021034; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017116; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017121; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017122; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017123; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017126; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017127; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017129; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017130; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017131; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017135; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017136; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017137; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017138; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017139; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017140; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017145; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017152; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017153; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017154; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017155; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017162; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017170; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017178; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017183; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017189; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017192; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017195; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017197; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017200; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017201; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017202; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017207; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017208; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017212; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017213; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017214; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017217; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017218; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017220; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017221; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017223; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017224; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017226; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017227; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017228; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017229; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017230; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017231; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017232; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017234; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017235; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017236; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017237; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017238; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017241; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017243; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017245; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017251; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017254; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017255; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017257; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017259; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017260; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017262; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017263; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017264; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017265; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017266; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017270; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017272; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017273; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017274; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017275; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017276; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017278; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017282; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017288; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017289; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017290; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017291; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017292; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017293; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017297; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017298; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017299; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017300; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017301; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017311; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017312; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017314; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017315; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017320; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017322; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017325; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017328; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017329; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017330; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017332; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017337; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017339; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017347; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017348; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017353; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017355; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017368; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017371; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017372; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017376; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017380; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017381; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017382; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017391; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017395; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017397; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017398; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017399; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017401; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017402; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017406; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017408; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017409; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017412; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017414; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017417; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017419; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017425; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017426; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017689; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017695; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017696; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017700; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017701; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017703; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017704; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017709; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017710; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017711; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017712; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017713; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017714; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017719; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017724; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017726; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017727; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017728; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017729; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017736; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017744; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017753; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017758; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017764; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017766; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017767; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017770; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017772; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017775; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017776; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017777; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017782; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017783; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017786; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017788; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017789; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017792; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017795; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017796; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017798; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017799; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017801; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017802; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017803; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017804; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017805; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017806; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017807; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017809; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017810; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017811; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017812; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017813; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017816; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017818; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017820; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017826; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017829; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017830; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017832; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017834; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017835; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017836; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017837; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017838; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017839; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017840; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017841; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017844; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017846; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017848; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017849; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017850; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017851; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017852; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017854; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017858; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017864; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017865; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017866; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017867; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017868; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017869; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017870; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017872; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017873; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017874; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017875; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017877; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017879; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017885; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017886; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017888; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017889; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017894; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017896; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017898; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017899; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017902; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017903; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017904; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017906; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017911; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017913; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017921; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017922; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017927; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017929; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017934; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017942; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017945; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017946; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017950; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017954; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017955; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017956; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017965; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017969; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017971; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017972; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017973; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017975; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017976; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017980; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017982; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017983; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017986; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017988; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017991; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017993; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017999; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018000; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0021558; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016371; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016376; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016377; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016378; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016381; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016382; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016384; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016385; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016390; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016391; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016392; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016393; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016394; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016395; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016400; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016405; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016407; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016408; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016409; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016410; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016425; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016439; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016445; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016447; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016448; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016451; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016453; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016456; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016458; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016463; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016464; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016467; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016468; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016469; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016470; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016473; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016474; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016476; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016477; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016479; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016480; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016482; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016483; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016484; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016485; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016486; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016487; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016488; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016490; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016491; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016492; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016493; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016494; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016497; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016499; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016501; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016507; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016510; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016511; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016513; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016515; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016516; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016517; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016518; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016519; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016520; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016522; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016525; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016526; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016527; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016528; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016529; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016531; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016535; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016541; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016542; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016543; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016544; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016545; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016546; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016549; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016550; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016551; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016552; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016553; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016561; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016562; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016564; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016565; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016570; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016572; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016578; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016579; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016580; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016582; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016587; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016589; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016597; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016598; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016605; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016610; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016618; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016621; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016622; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016626; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016630; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016631; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016632; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016641; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016645; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016647; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016648; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016649; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016651; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016652; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016656; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016658; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016659; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016662; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016664; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016667; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016669; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016675; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016676; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016652; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016657; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016658; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016659; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016662; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016663; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016665; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016666; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016671; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016672; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016673; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016674; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016675; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016676; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016681; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016686; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016688; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016689; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016690; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016691; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016698; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016706; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016714; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016719; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016725; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016727; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016728; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016731; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016733; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016736; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016737; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016738; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016743; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016744; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016747; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016748; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016749; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016750; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016753; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016754; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016756; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016757; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016759; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016760; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016762; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016763; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016764; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016765; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016766; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016767; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016768; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016770; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016771; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016772; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016773; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016776; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016778; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016780; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016786; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016789; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016790; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016792; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016794; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016795; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016796; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016797; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016798; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016799; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016800; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016801; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016803; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016804; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016805; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016806; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016807; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016809; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016813; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016819; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016820; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016821; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016822; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016823; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016824; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016827; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016828; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016829; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016830; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016831; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016840; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016841; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016843; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016844; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016849; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016851; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016854; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016857; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016858; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016859; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016861; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016866; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016868; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016876; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016877; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016882; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016884; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016889; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016897; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016900; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016901; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016905; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016909; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016910; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016911; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016920; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016924; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016926; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016927; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016928; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016930; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016931; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016935; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016937; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016938; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016941; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016943; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016946; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016948; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016954; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016955; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000746; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000926; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001240; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001712; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001713; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001715; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002518; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003156; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004784; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000004786; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005057; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005064; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006508; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006679; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009214; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009236; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009259; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009790; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000013845; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000014473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000019257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020090; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020101; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020263; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020278; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020288; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020301; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020307; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020308; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020349; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020493; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020496; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020552; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020575; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000020580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036016; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038169; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038257; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038558; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039836; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039925; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040580; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041882; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043604; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045529; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045628; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045744; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045866; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047883; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048128; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049339; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054167; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054666; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056086; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057798; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058906; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061653; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062883; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072217; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075421; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079279; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079773; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079883; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000080730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082244; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092285; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092369; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092370; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092371; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092431; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092432; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092433; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092434; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092486; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095426; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095446; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095473; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095491; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099501; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105323; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105325; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105352; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105381; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105383; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105387; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105388; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105389; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105397; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105406; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105414; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105420; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000105465; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117488; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117956; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118936; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119492; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119547; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119567; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119606; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119753; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120265; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120281; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120757; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121138; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121205; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121685; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000128241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000129625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130422; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000135158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000137841; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138785; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000140901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000141228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143517; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000144234; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145890; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146590; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147545; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147914; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151928; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000154374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000159991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164034; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164428; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166360; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166804; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000167481; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170048; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170596; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170795; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171416; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172282; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000174510; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178422; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178581; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179238; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179726; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000179767; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180161; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000180350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181039; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181974; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182152; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182439; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182884; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182912; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000203906; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000204849; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000205100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217748; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000218208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219237; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219375; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219648; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219850; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000219981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000220312; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025276; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025298; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025303; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025304; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025317; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025320; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025335; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025344; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025348; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025364; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025375; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025377; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025378; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025379; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025380; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025388; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025416; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025418; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025419; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025420; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025465; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025495; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025525; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025543; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025563; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025566; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025568; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025631; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025637; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025650; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025653; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025657; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025715; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025720; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025734; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025736; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025737; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025738; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025752; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025772; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025778; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025779; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025782; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025787; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025792; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025793; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025794; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025795; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025801; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025806; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025807; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025811; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025812; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025813; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025814; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025821; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025833; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025835; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025844; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025866; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025881; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025882; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025896; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025910; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025918; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025922; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025923; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025924; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025925; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025926; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025927; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025928; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025932; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025933; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025941; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025949; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025953; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025977; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025981; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025997; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0025998; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026001; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026002; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026003; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026004; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026013; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026014; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026016; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026018; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026019; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026021; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026048; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026049; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026052; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026054; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026074; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026081; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026097; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026115; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026116; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026123; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026126; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026141; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026146; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026202; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026209; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026232; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026240; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026266; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026304; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026310; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026313; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026325; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026335; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026339; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026340; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026361; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026376; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026385; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026392; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026398; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026405; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026406; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026418; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026431; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026432; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026444; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026446; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026465; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026480; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026509; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026512; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0025250; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025273; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025278; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025279; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025293; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025296; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025311; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025320; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025324; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025340; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025350; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025352; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025353; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025354; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025355; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025363; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025380; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025391; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025393; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025394; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025395; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025440; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025472; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025501; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025518; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025539; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025542; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025544; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025613; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025626; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025630; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025634; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025692; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025697; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025711; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025713; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025714; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025715; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025729; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025749; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025755; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025756; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025759; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025764; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025769; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025770; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025771; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025772; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025778; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025783; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025784; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025788; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025790; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025791; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025798; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025809; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025811; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025820; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025843; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025858; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025859; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025873; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025887; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025895; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025899; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025900; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025901; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025902; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025903; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025906; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025910; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025919; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025927; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025931; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025955; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025959; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025975; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025976; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025979; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025980; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025981; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025982; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025987; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025990; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025992; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025994; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0025995; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026024; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026025; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026028; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026030; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026050; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026057; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026061; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026075; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026093; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026094; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026101; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026104; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026119; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026125; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026179; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026186; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026209; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026217; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026242; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026281; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026287; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026290; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026302; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026312; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026316; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026317; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026333; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026348; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026357; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026364; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026370; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026377; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026378; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026390; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026403; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026404; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026416; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026418; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026437; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026452; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026478; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0026481; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0025206; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025228; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025235; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025236; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025250; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025253; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025267; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025276; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025296; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025306; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025308; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025309; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025310; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025311; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025319; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025349; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025351; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025352; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025353; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025398; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025431; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025461; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025480; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025500; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025503; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025505; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025569; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025576; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025593; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025597; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025655; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025660; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025674; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025676; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025677; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025678; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025692; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025712; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025718; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025719; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025722; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025727; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025732; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025733; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025734; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025735; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025741; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025746; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025747; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025751; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025752; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025753; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025754; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025761; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025772; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025774; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025783; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025804; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025819; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025820; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025834; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025848; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025856; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025860; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025861; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025862; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025863; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025864; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025865; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025866; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025869; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025873; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025874; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025882; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025890; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025894; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025918; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025922; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025938; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025939; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025942; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025943; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025944; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025945; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025953; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025956; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025958; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025960; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025961; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025988; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025989; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025992; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0025994; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026014; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026021; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026025; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026039; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026058; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026059; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026069; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026084; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026089; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026143; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026150; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026173; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026181; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026206; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026245; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026251; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026254; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026266; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026276; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026280; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026281; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026301; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026316; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026325; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026332; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026338; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026347; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026348; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026360; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026373; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026374; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026386; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026388; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026407; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026422; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026448; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0026451; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0053937; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025214; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025236; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025241; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025242; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025256; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025259; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025274; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025283; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025287; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025303; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025313; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025315; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025316; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025317; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025318; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025326; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025356; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025358; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025359; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025360; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025405; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025436; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025466; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025484; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025504; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025507; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025509; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025572; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025578; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025591; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025595; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025599; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025657; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025662; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025676; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025678; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025679; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025680; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025694; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025714; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025720; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025721; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025724; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025729; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025734; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025735; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025736; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025737; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025743; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025748; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025749; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025753; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025754; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025755; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025756; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025763; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025774; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025776; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025785; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025807; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025822; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025823; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025837; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025851; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025859; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025863; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025864; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025865; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025866; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025867; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025868; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025872; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025876; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025877; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025885; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025893; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025897; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025921; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025925; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025941; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025942; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025945; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025946; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025947; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025948; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025956; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025959; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025961; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025963; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025964; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025993; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025994; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025997; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025999; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026019; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026026; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026030; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026044; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026063; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026064; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026071; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026074; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026089; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026094; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026149; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026156; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026179; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026187; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026212; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026251; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026257; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026260; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026272; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026282; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026286; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026287; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026307; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026322; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026331; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026338; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026344; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026352; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026353; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026366; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026379; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026380; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026392; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026394; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026413; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026428; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026456; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0026459; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0038825; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025024; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025046; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025051; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025052; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025066; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025069; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025084; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025093; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025112; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025122; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025124; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025125; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025126; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025127; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025135; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025154; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025165; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025167; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025168; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025169; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025214; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025244; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025275; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025294; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025314; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025317; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025319; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025388; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025401; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025405; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025409; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025467; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025472; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025486; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025488; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025490; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025504; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025524; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025530; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025531; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025534; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025539; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025544; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025545; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025546; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025547; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025553; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025558; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025559; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025563; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025564; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025565; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025566; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025573; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025584; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025586; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025595; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025616; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025631; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025632; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025646; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025660; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025668; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025672; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025673; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025674; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025675; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025676; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025677; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025684; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025685; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025693; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025701; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025705; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025729; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025733; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025749; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025750; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025753; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025754; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025755; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025756; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025762; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025765; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025767; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025769; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025770; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025797; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025798; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025801; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025803; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025823; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025830; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025834; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025848; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025867; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025868; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025875; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025878; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025893; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025898; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025953; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025960; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025983; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025991; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026016; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026055; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026061; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026064; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026076; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026086; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026090; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026091; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026110; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026125; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026134; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026141; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026147; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026155; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026156; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026168; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026181; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026182; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026196; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026215; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026230; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026258; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0026261; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025719; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025741; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025746; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025747; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025756; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025759; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025773; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025782; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025786; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025812; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025814; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025815; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025816; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025817; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025825; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025842; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025853; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025855; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025856; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025857; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025902; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025934; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025963; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0025980; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026000; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026003; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026005; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026068; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026074; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026086; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026089; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026094; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026152; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026157; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026171; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026173; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026174; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026175; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026189; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026209; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026215; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026217; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026220; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026225; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026230; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026231; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026232; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026233; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026239; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026244; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026245; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026249; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026250; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026251; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026252; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026259; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026270; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026272; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026281; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026303; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026318; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026319; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026333; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026348; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026356; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026360; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026361; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026362; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026363; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026364; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026365; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026366; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026367; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026371; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026372; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026380; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026388; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026392; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026415; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026419; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026435; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026436; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026439; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026440; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026441; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026442; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026446; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026450; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026452; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026454; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026455; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026456; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026483; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026484; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026487; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026489; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026509; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026516; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026520; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026534; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026553; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026554; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026561; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026564; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026579; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026584; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026640; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026647; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026670; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026679; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026704; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026743; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026749; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026752; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026764; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026775; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026779; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026780; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026802; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026817; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026826; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026833; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026839; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026846; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026847; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026859; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026872; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026873; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026886; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026888; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026907; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026922; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026948; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026951; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0039278; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024574; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024596; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024601; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024602; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024616; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024619; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024635; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024645; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024666; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024677; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024679; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024680; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024681; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024682; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024690; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024708; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024719; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024721; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024722; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024723; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024769; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024802; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024874; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024877; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024879; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024943; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024949; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024962; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0024970; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025030; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025035; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025050; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025052; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025053; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025055; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025068; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025088; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025094; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025095; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025098; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025103; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025108; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025109; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025110; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025111; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025117; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025122; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025123; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025127; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025128; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025129; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025136; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025148; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025150; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025159; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025181; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025196; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025198; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025212; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025226; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025234; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025238; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025239; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025240; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025241; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025242; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025243; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025244; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025246; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025250; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025251; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025259; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025267; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025271; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025295; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025299; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025315; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025316; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025319; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025320; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025321; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025322; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025329; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025332; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025334; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025335; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025336; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025363; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025364; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025367; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025369; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025390; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025396; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025413; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025431; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025432; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025439; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025441; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025457; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025462; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025518; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025525; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025557; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025582; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025621; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025627; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025630; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025644; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025654; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025658; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025659; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025681; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025696; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025712; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025718; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025726; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025727; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025739; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025752; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025753; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025765; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025768; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025787; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025802; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025829; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025832; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025849; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0024959; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0024981; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0024986; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0024987; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025001; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025004; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025020; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025029; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025049; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025059; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025061; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025062; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025063; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025064; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025072; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025091; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025102; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025104; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025105; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025106; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025151; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025181; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025208; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025227; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025247; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025250; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025252; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025315; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025321; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025334; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025338; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025342; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025400; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025405; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025420; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025422; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025423; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025424; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025438; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025458; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025464; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025465; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025468; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025473; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025480; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025481; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025482; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025488; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025493; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025494; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025498; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025499; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025501; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025508; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025519; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025521; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025530; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025551; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025566; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025567; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025581; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025595; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025606; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025607; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025608; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025609; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025610; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025611; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025616; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025618; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025619; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025627; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025635; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025639; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025653; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025657; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025673; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025674; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025677; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025678; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025679; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025680; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025686; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025689; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025691; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025693; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025694; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025697; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025723; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025724; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025727; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025729; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025749; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025756; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025760; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025775; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025794; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025795; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025802; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025805; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025820; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025825; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025880; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025887; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025910; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025919; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025944; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025983; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025989; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0025992; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026004; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026014; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026018; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026019; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026038; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026053; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026062; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026069; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026075; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026083; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026084; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026096; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026109; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026110; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026122; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026124; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026143; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026158; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026186; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0026189; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0025075; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025097; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025102; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025103; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025117; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025120; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025135; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025144; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025164; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025174; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025176; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025177; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025178; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025179; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025187; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025206; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025217; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025219; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025220; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025221; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025266; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025295; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025325; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025343; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025363; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025366; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025368; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025431; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025437; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025450; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025454; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025458; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025516; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025521; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025535; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025537; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025538; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025539; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025553; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025573; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025579; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025580; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025583; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025588; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025593; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025594; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025595; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025596; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025602; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025607; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025608; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025612; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025613; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025614; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025615; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025622; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025633; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025635; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025644; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025665; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025680; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025681; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025695; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025709; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025717; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025722; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025723; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025724; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025725; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025726; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025732; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025736; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025737; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025745; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025753; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025757; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025781; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025785; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025801; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025802; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025805; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025806; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025807; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025808; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025815; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025818; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025820; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025822; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025823; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025850; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025851; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025854; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025856; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025876; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025883; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025887; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025901; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025920; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025921; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025928; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025931; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025946; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0025951; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026005; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026012; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026035; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026044; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026069; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026108; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026114; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026117; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026129; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026139; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026143; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026144; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026178; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026187; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026194; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026200; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026208; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026209; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026221; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026234; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026235; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026247; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026249; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026268; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026283; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026312; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0026315; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0025068; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025090; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025095; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025096; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025110; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025113; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025128; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025137; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025141; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025157; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025167; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025169; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025170; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025171; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025172; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025180; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025208; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025210; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025211; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025212; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025257; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025289; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025318; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025336; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025356; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025359; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025361; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025425; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025431; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025444; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025447; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025451; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025509; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025514; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025528; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025530; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025531; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025532; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025565; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025572; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025573; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025576; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025581; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025586; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025587; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025588; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025589; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025595; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025600; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025601; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025605; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025606; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025607; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025614; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025625; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025627; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025636; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025658; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025674; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025675; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025689; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025703; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025711; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025716; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025717; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025718; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025719; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025720; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025724; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025725; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025726; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025730; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025731; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025739; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025747; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025751; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025775; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025779; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025795; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025796; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025799; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025800; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025801; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025802; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025811; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025814; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025816; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025818; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025819; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025822; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025824; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025849; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025850; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025853; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025855; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025875; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025882; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025898; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025916; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025917; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025924; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025927; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025942; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0025947; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026002; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026009; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026031; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026039; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026064; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026101; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026107; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026110; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026122; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026132; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026136; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026137; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026158; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026173; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026182; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026189; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026195; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026202; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026203; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026215; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026228; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026229; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026242; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026244; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026263; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026278; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026303; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0026306; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0094972; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0025192; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025214; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025219; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025220; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025233; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025236; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025250; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025259; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025263; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025279; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025290; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025292; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025293; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025294; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025295; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025304; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025331; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025333; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025334; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025335; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025380; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025410; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025456; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025476; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025479; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025481; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025544; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025550; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025563; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025571; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025629; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025634; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025648; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025650; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025651; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025652; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025666; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025686; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025692; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025693; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025696; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025701; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025707; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025708; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025709; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025715; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025720; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025721; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025725; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025726; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025727; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025728; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025735; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025747; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025749; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025780; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025795; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025796; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025810; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025824; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025832; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025836; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025837; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025838; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025839; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025840; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025841; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025844; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025849; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025850; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025858; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025866; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025870; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025894; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025898; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025914; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025915; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025918; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025919; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025920; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025921; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025925; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025928; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025930; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025932; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025933; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025934; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025962; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025963; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025966; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025968; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025988; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025995; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0025999; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026013; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026032; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026033; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026040; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026042; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026057; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026062; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026114; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026121; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026144; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026153; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026178; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026216; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026222; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026225; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026238; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026248; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026252; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026253; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026273; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026288; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026297; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026304; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026310; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026318; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026319; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026331; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026344; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026345; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026357; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026359; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026378; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026393; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026419; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0026422; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0038716; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025070; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025092; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025097; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025098; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025111; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025114; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025129; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025138; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025142; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025159; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025169; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025171; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025172; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025173; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025174; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025182; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025210; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025212; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025213; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025214; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025259; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025290; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025319; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025338; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025358; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025361; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025363; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025426; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025432; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025445; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025448; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025452; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025510; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025515; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025529; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025531; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025532; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025533; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025547; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025567; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025573; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025574; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025577; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025582; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025587; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025589; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025590; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025591; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025597; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025602; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025603; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025607; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025609; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025610; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025617; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025628; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025630; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025639; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025661; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025676; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025677; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025691; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025705; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025713; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025718; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025719; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025720; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025721; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025722; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025726; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025730; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025731; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025739; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025747; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025751; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025774; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025778; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025794; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025795; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025798; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025799; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025800; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025801; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025807; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025810; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025812; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025814; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025815; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025843; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025844; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025847; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025849; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025870; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025877; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025894; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025912; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025913; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025920; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025923; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025938; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025943; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025999; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026006; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026029; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026037; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026100; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026106; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026109; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026121; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026131; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026135; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026136; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026155; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026170; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026179; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026186; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026192; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026199; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026200; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026212; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026225; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026226; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026238; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026240; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026259; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026274; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026299; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0026302; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025761; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025784; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025789; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025800; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025803; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025818; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025827; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025847; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025857; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025859; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025860; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025861; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025862; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025870; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025887; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025898; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025900; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025901; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025902; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025947; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0025978; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026010; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026027; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026047; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026050; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026052; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026115; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026121; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026134; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026137; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026141; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026199; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026204; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026218; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026220; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026221; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026222; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026236; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026256; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026262; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026263; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026266; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026271; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026276; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026277; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026278; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026279; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026290; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026291; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026295; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026296; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026297; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026298; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026305; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026316; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026318; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026327; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026349; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026364; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026365; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026379; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026393; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026401; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026405; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026406; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026407; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026408; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026409; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026410; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026413; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026416; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026420; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026421; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026429; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026437; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026441; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026465; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026470; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026486; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026487; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026490; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026491; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026492; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026493; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026495; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026498; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026500; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026502; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026503; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026504; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026506; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026508; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026532; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026533; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026536; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026538; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026558; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026569; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026583; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026602; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026603; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026610; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026613; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026628; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026633; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026688; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026695; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026718; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026726; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026751; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026790; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026796; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026799; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026811; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026821; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026825; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026826; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026841; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026856; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026865; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026872; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026878; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026885; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026886; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026898; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026911; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026912; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026924; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026926; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026945; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026960; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026986; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026989; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0039325; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024288; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024310; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024315; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024316; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024329; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024332; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024347; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024357; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024377; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024388; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024390; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024391; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024392; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024393; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024401; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024418; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024429; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024431; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024432; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024433; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024509; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024561; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024582; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024585; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024587; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024652; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024658; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024671; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024680; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024741; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024747; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024762; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024764; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024765; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024766; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024779; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024799; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024805; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024806; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024809; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024814; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024819; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024820; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024821; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024822; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024828; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024833; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024834; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024838; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024839; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024840; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024841; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024848; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024860; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024862; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024871; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024893; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024908; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024910; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024925; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024939; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024947; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024951; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024952; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024953; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024954; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024956; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024961; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024962; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024970; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024978; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0024982; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025005; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025009; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025027; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025028; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025031; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025032; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025033; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025034; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025038; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025041; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025043; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025044; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025045; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025072; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025073; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025077; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025079; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025100; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025107; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025123; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025141; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025142; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025149; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025152; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025168; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025173; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025228; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025235; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025267; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025292; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025331; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025337; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025340; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025353; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025363; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025367; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025368; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025389; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025404; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025413; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025420; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025426; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025435; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025436; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025448; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025461; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025462; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025475; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025478; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025497; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025510; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025536; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025539; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024564; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024586; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024591; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024592; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024605; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024608; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024623; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024632; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024652; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024663; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024665; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024666; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024667; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024668; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024676; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024693; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024704; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024706; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024707; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024708; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024753; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024786; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024816; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024834; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024855; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024858; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024860; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024923; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024929; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024942; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024945; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0024949; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025007; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025012; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025026; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025028; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025029; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025030; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025044; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025064; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025070; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025071; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025074; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025079; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025084; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025085; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025086; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025087; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025093; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025098; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025099; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025103; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025104; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025105; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025112; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025124; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025126; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025135; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025157; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025172; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025173; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025187; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025201; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025209; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025213; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025214; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025215; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025216; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025217; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025218; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025222; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025223; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025231; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025239; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025243; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025267; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025271; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025287; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025288; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025291; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025292; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025293; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025294; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025299; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025302; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025304; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025306; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025307; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025334; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025335; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025338; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025340; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025360; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025367; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025383; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025401; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025402; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025409; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025411; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025426; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025431; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025486; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025493; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025516; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025524; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025549; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025588; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025594; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025597; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025609; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025619; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025623; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025624; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025639; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025654; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025663; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025670; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025676; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025683; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025684; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025696; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025709; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025710; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025722; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025724; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025743; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025758; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025783; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025786; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980136.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23075134
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    10702..10772
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    19197..19216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    24759..24778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    32606..32642
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    37637..37661
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    46757..46808
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    66887..66906
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    68292..68521
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    81313..81332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    93835..93854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    100276..100295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    108145..111195
FT                   /estimated_length=3051
FT                   /gap_type="unknown"
FT   assembly_gap    112911..112930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    114623..114642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    120679..121011
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   assembly_gap    123665..123739
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    153634..154119
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   gene            156932..480713
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /note="gene_id=mCG19013.2"
FT   mRNA            join(156932..157699,327721..327996,350894..350989,
FT                   392665..393024,393067..393137,426904..427039,
FT                   474439..474773,479288..480713)
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /product="RIKEN cDNA 4831416G18, transcript variant
FT                   mCT16903"
FT                   /note="gene_id=mCG19013.2 transcript_id=mCT16903.2 created
FT                   on 19-NOV-2002"
FT   mRNA            join(<157031..157699,327721..327996,350894..350989,
FT                   392665..393024,415392..415492,426904..427074,
FT                   430116..430372,447629..447948,474439..474773,
FT                   479288..480221)
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /product="RIKEN cDNA 4831416G18, transcript variant
FT                   mCT192947"
FT                   /note="gene_id=mCG19013.2 transcript_id=mCT192947.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<157115..157699,327721..327996,350894..350989,
FT                   392665..393024,415392..415492,426904..427074,
FT                   430116..430372,447629..447948,474439..474773,
FT                   479288..479456)
FT                   /codon_start=1
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /product="RIKEN cDNA 4831416G18, isoform CRA_b"
FT                   /note="gene_id=mCG19013.2 transcript_id=mCT192947.0
FT                   protein_id=mCP113918.0 isoform=CRA_b"
FT                   /protein_id="EDL32211.1"
FT                   /translation="AARWARAGASPMLLGASWLCASKAAATAARGEGEDRQGEQQRGAQ
FT                   ARTEEDMDESSLLDLLECSVCLERLDTTAKVLPCQHTFCRRCLESIVCSRHELRCPECR
FT                   ILVGCGVDELPANILLVRLLDGIRQRPRTGASPGSSPPARPGPGTFSALAGGAGGATGS
FT                   PPCSPVFLSAAAGSSTSSLCDVATNRSVPVAKTLSQLPYAKALYSYEGKEPGDLKFNKG
FT                   DIIILRRKVDENWYHGELQGMHGFLPASYIQCVRPLPQALPQGKALYDFEMKDRDQDKD
FT                   CLTFTKDEVLTVIRRVDDNWAEGMLGDKIGIFPLLYVELNDSAKQLIEMDKLCPAATTA
FT                   YNYDALLSSDPSTVASVAPGPTLSSSGAVSAFQRRVDSKKNAKKRHSFTALSVTHKSSQ
FT                   AASHRHSMEISAPVLISSSDPRAAARIGELAHLSCTVPTQDSSSAGPVPTALPRAAAVA
FT                   GEQGMSPKVQLPLNVYLALYAYKPQKNDELELRKGEMYRVLEKCQDGWFKGASLKTGVS
FT                   GVFPGNYVTPVSRVPGGGAGLPWNNVLGGSPLAKGMATIMHPGGGSLSSPATAARSALP
FT                   LTTLQDHMQHPATSLPTGSCLRHSAQPTASQAGDTTIPTATHASAQALDRPTATVSPLR
FT                   TQTSPSRLPSTGLRPRSVASPQHGQQSPAQMCPRPAIPFTSAASAITPPNVSAANLSGE
FT                   VGGTPISGLSTPSLINTGFKPDDKKNEKKEKKSGLLKLLAGASTKKKSRSPPSVSPTHD
FT                   PQSAMDTSLQGAMGPEVSPLTVHGRAGSCPIESEMQGAIGLEPLHRKAGSLDLNFSLSP
FT                   SRQATLSMASIRPEPKPLPRERYRVVVSYPPQSEAEIELKEGDIVFVHKKHEDGWFKGT
FT                   LQRNGRTGLFPGSFVESF"
FT   CDS             join(157148..157699,327721..327996,350894..350989,
FT                   392665..393024,393067..393137,426904..427039,
FT                   474439..474773,479288..479456)
FT                   /codon_start=1
FT                   /gene="4831416G18Rik"
FT                   /locus_tag="mCG_19013"
FT                   /product="RIKEN cDNA 4831416G18, isoform CRA_a"
FT                   /note="gene_id=mCG19013.2 transcript_id=mCT16903.2
FT                   protein_id=mCP1515.2 isoform=CRA_a"
FT                   /protein_id="EDL32210.1"
FT                   /translation="MLLGASWLCASKAAATAARGEGEDRQGEQQRGAQARTEEDMDESS
FT                   LLDLLECSVCLERLDTTAKVLPCQHTFCRRCLESIVCSRHELRCPECRILVGCGVDELP
FT                   ANILLVRLLDGIRQRPRTGASPGSSPPARPGPGTFSALAGGAGGATGSPPCSPVFLSAA
FT                   AGSSTSSLCDVATNRSVPVAKTLSQLPYAKALYSYEGKEPGDLKFNKGDIIILRRKVDE
FT                   NWYHGELQGMHGFLPASYIQCVRPLPQALPQGKALYDFEMKDRDQDKDCLTFTKDEVLT
FT                   VIRRVDDNWAEGMLGDKIGIFPLLYVELNDSAKQLIEMDKLCPAATTAYNYDALLSSDP
FT                   STVASVAPGPTLSSSGAVSAFQRRVDSKKNAKKRHSFTALSVTHKSSQAASHRHSMEIS
FT                   APVLISSSDPRAAARIGELAHLSCTVPTQFLFYLYTLSPGFLSYPEGSYTRTRYLALYA
FT                   YKPQKNDELELRKGEMYRVLEKCQDGWFKGASLKTGVSGKEKKSGLLKLLAGASTKKKS
FT                   RSPPSVSPTHDPQSAMDTSLQGAMGPEVSPLTVHGRAGSCPIESEMQGAIGLEPLHRKA
FT                   GSLDLNFSLSPSRQATLSMASIRPEPKPLPRERYRVVVSYPPQSEAEIELKEGDIVFVH
FT                   KKHEDGWFKGTLQRNGRTGLFPGSFVESF"
FT   assembly_gap    171205..171480
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    205385..205983
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   assembly_gap    206903..207000
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    249797..249916
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    306761..308096
FT                   /estimated_length=1336
FT                   /gap_type="unknown"
FT   assembly_gap    329832..329851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    331858..332044
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    361638..361657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    371227..375555
FT                   /estimated_length=4329
FT                   /gap_type="unknown"
FT   assembly_gap    450283..450326
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            complement(485095..565494)
FT                   /gene="Sept10"
FT                   /locus_tag="mCG_19014"
FT                   /note="gene_id=mCG19014.2"
FT   mRNA            complement(join(485095..485208,510148..510335,
FT                   514458..514590,520492..520660,522405..522501,
FT                   524664..524825,527169..527355,535810..536005,
FT                   536342..536459,565040..565494))
FT                   /gene="Sept10"
FT                   /locus_tag="mCG_19014"
FT                   /product="septin 10"
FT                   /note="gene_id=mCG19014.2 transcript_id=mCT16904.2 created
FT                   on 19-NOV-2002"
FT   CDS             complement(join(485118..485208,510148..510335,
FT                   514458..514590,520492..520660,522405..522501,
FT                   524664..524825,527169..527355,535810..536005,
FT                   536342..536459,565040..565057))
FT                   /codon_start=1
FT                   /gene="Sept10"
FT                   /locus_tag="mCG_19014"
FT                   /product="septin 10"
FT                   /note="gene_id=mCG19014.2 transcript_id=mCT16904.2
FT                   protein_id=mCP1444.2"
FT                   /db_xref="MGI:MGI:1918110"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1W2P6J7"
FT                   /protein_id="EDL32209.1"
FT                   /translation="MASCDEIKEHPRSLSMCGHVGFESLPDQLVDRSIEQGFCFNILCV
FT                   GETGIGKSTLINTLFNTNFEELESSHFCPCVRLRAQTYELQESNVRLKLTIVNTVGFGD
FT                   QINKEDSYQPIVDYIDDQFEAYLQEELKIKRALFNYHDSRIHVCLYFIAPTGHSLRTLD
FT                   LLTMKSLDNKVNIIPLIAKADTISKSELQKFKMKLMNELVINGVQIYQFPTDDDTTSKI
FT                   NGAMNGHLPFAVVGSMDEIKVGNKMVKGRQYPWGIVQVENENHCDFVKLREMLICTNME
FT                   DLREQTHMRHYELYRRCKLQEMGFVDMGPENKPLSLQETYEAKRHEFYGERQRKEEQMK
FT                   QMFVQRVKEKEAILKEAERELQAKFEHLKRIHQEERMKLEEKRRMLEEESVAFAKKKAT
FT                   CELFPNQSFLASGSSIRKDKDRKKADGASAFCDCLTAQESVRLCISSPRKDMD"
FT   assembly_gap    496840..497238
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    586288..586361
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    587069..587088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    605602..605643
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    610063..610399
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    625042..625061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    627710..628119
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   assembly_gap    631375..631872
FT                   /estimated_length=498
FT                   /gap_type="unknown"
FT   assembly_gap    643710..643729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            667057..717064
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /note="gene_id=mCG11297.2"
FT   mRNA            join(667057..667237,680815..680917,683057..683153,
FT                   686445..686596,687418..687555,691942..692181,
FT                   694165..694361,695844..696020,698101..698171,
FT                   705622..705721,709050..709103,711050..711115,
FT                   713002..713070,713348..713444,714765..717064)
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha 1 polypeptide, transcript
FT                   variant mCT11585"
FT                   /note="gene_id=mCG11297.2 transcript_id=mCT11585.2 created
FT                   on 19-NOV-2002"
FT   mRNA            join(667057..667237,680815..680917,683057..683153,
FT                   686445..686596,687418..687555,691942..692181,
FT                   694165..694361,695844..696020,699111..699181,
FT                   705622..705721,709050..709103,711050..711115,
FT                   713002..713070,713348..713444,714765..717064)
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha 1 polypeptide, transcript
FT                   variant mCT176004"
FT                   /note="gene_id=mCG11297.2 transcript_id=mCT176004.0 created
FT                   on 19-NOV-2002"
FT   CDS             join(680842..680917,683057..683153,686445..686596,
FT                   687418..687555,691942..692181,694165..694361,
FT                   695844..696020,698101..698171,705622..705721,
FT                   709050..709103,711050..711115,713002..713070,
FT                   713348..713444,714765..714835)
FT                   /codon_start=1
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha 1 polypeptide, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11297.2 transcript_id=mCT11585.2
FT                   protein_id=mCP1441.2 isoform=CRA_a"
FT                   /protein_id="EDL32207.1"
FT                   /translation="MIWVVLMMAILLPQSLAHPGFFTSIGQMTDLIHNEKDLVTSLKDY
FT                   IKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLILK
FT                   DMSDGFISNLTIQRQYFPNDEDQVGAAKALFRLQDTYNLDTNTISKGNLPGVQHKSFLT
FT                   AEDCFELGKVAYTEADYYHTELWMEQALTQLEEGELSTVDKVSVLDYLSYAVYQQGDLD
FT                   KALLLTKKLLELDPEHQRANGNLVYFEYIMSKEKDANKSASGDQSDQKTAPKKKGIAVD
FT                   YLPERQKYEMLCRGEGIKMTPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRF
FT                   HDIISDAEIEIVKDLAKPRLRRATISNPVTGALETVHYRISKSAWLSGYEDPVVSRINM
FT                   RIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMS
FT                   DVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWL
FT                   HERGQEFRRPCTLSELE"
FT   CDS             join(680842..680917,683057..683153,686445..686596,
FT                   687418..687555,691942..692181,694165..694361,
FT                   695844..696020,699111..699181,705622..705721,
FT                   709050..709103,711050..711115,713002..713070,
FT                   713348..713444,714765..714835)
FT                   /codon_start=1
FT                   /gene="P4ha1"
FT                   /locus_tag="mCG_11297"
FT                   /product="procollagen-proline, 2-oxoglutarate 4-dioxygenase
FT                   (proline 4-hydroxylase), alpha 1 polypeptide, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11297.2 transcript_id=mCT176004.0
FT                   protein_id=mCP98926.0 isoform=CRA_b"
FT                   /protein_id="EDL32208.1"
FT                   /translation="MIWVVLMMAILLPQSLAHPGFFTSIGQMTDLIHNEKDLVTSLKDY
FT                   IKAEEDKLEQIKKWAEKLDRLTSTATKDPEGFVGHPVNAFKLMKRLNTEWSELENLILK
FT                   DMSDGFISNLTIQRQYFPNDEDQVGAAKALFRLQDTYNLDTNTISKGNLPGVQHKSFLT
FT                   AEDCFELGKVAYTEADYYHTELWMEQALTQLEEGELSTVDKVSVLDYLSYAVYQQGDLD
FT                   KALLLTKKLLELDPEHQRANGNLVYFEYIMSKEKDANKSASGDQSDQKTAPKKKGIAVD
FT                   YLPERQKYEMLCRGEGIKMTPRRQKRLFCRYHDGNRNPKFILAPAKQEDEWDKPRIIRF
FT                   HDIISDAEIEIVKDLAKPRLSRATVHDPETGKLTTAQYRVSKSAWLSGYEDPVVSRINM
FT                   RIQDLTGLDVSTAEELQVANYGVGGQYEPHFDFARKDEPDAFRELGTGNRIATWLFYMS
FT                   DVSAGGATVFPEVGASVWPKKGTAVFWYNLFASGEGDYSTRHAACPVLVGNKWVSNKWL
FT                   HERGQEFRRPCTLSELE"
FT   gene            739387..740530
FT                   /locus_tag="mCG_11298"
FT                   /note="gene_id=mCG11298.1"
FT   mRNA            739387..740530
FT                   /locus_tag="mCG_11298"
FT                   /product="mCG11298"
FT                   /note="gene_id=mCG11298.1 transcript_id=mCT11584.1 created
FT                   on 19-NOV-2002"
FT   CDS             739519..740148
FT                   /codon_start=1
FT                   /locus_tag="mCG_11298"
FT                   /product="mCG11298"
FT                   /note="gene_id=mCG11298.1 transcript_id=mCT11584.1
FT                   protein_id=mCP1481.1"
FT                   /db_xref="GOA:Q9CXU4"
FT                   /db_xref="InterPro:IPR003397"
FT                   /db_xref="InterPro:IPR005681"
FT                   /db_xref="MGI:MGI:1858317"
FT                   /db_xref="MGI:MGI:3704362"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CXU4"
FT                   /protein_id="EDL32206.1"
FT                   /translation="MEGGGGSSNKSTSGLAGFFGAGGAGYSNADLAGVPLTGMNPLSPY
FT                   LNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQ
FT                   SMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTM
FT                   TGMLYKCTGGLRGIARGGLAGLTLTSLYALYNNWEHMKGSLLQQSL"
FT   gene            747424..765732
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /note="gene_id=mCG11300.2"
FT   mRNA            join(747424..747746,754734..754822,760103..760268,
FT                   765127..765732)
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /product="phospholipase A2, group XIIB, transcript variant
FT                   mCT173950"
FT                   /note="gene_id=mCG11300.2 transcript_id=mCT173950.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(747424..747746,754734..754822,760103..760268,
FT                   765218..765732)
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /product="phospholipase A2, group XIIB, transcript variant
FT                   mCT11587"
FT                   /note="gene_id=mCG11300.2 transcript_id=mCT11587.1 created
FT                   on 02-OCT-2002"
FT   CDS             join(747536..747746,754734..754822,760103..760268,
FT                   765218..765339)
FT                   /codon_start=1
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /product="phospholipase A2, group XIIB, isoform CRA_a"
FT                   /note="gene_id=mCG11300.2 transcript_id=mCT11587.1
FT                   protein_id=mCP1496.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8VC81"
FT                   /db_xref="InterPro:IPR010711"
FT                   /db_xref="InterPro:IPR016090"
FT                   /db_xref="MGI:MGI:1917086"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VC81"
FT                   /protein_id="EDL32204.1"
FT                   /translation="MKLLCGFFLLWLGLVGNLAQSDPSPKEEESYSDWGLRQLRGSFES
FT                   VNSYVDSFMELLGGKNGVCQYRCRYGKAPMPRPGYKAQEPNGCSSYFLGIKVPGSMDLG
FT                   IPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEAACDSLAD
FT                   TVFNTVWTLGCRPFMNSQRAACICAEEEKEEL"
FT   CDS             join(747536..747746,754734..754822,760103..760268,
FT                   765127..765227)
FT                   /codon_start=1
FT                   /gene="Pla2g12b"
FT                   /locus_tag="mCG_11300"
FT                   /product="phospholipase A2, group XIIB, isoform CRA_b"
FT                   /note="gene_id=mCG11300.2 transcript_id=mCT173950.0
FT                   protein_id=mCP96869.0 isoform=CRA_b"
FT                   /protein_id="EDL32205.1"
FT                   /translation="MKLLCGFFLLWLGLVGNLAQSDPSPKEEESYSDWGLRQLRGSFES
FT                   VNSYVDSFMELLGGKNGVCQYRCRYGKAPMPRPGYKAQEPNGCSSYFLGIKVPGSMDLG
FT                   IPAMTKCCNQLDVCYDTCGANKYRCDAKFRWCLHSICSDLKRSLGFVSNVEALCSSPWK
FT                   YPASPAPGVVCAGSLRFYSSFSSSL"
FT   gene            complement(766713..785533)
FT                   /gene="Oit3"
FT                   /locus_tag="mCG_122796"
FT                   /note="gene_id=mCG122796.1"
FT   mRNA            complement(join(766713..767867,769132..769231,
FT                   771699..772114,773246..773406,774648..774770,
FT                   779622..779744,781465..781572,782296..782670,
FT                   785378..785533))
FT                   /gene="Oit3"
FT                   /locus_tag="mCG_122796"
FT                   /product="oncoprotein induced transcript 3"
FT                   /note="gene_id=mCG122796.1 transcript_id=mCT124024.1
FT                   created on 18-NOV-2002"
FT   CDS             complement(join(767694..767867,769132..769231,
FT                   771699..772114,773246..773406,774648..774770,
FT                   779622..779744,781465..781572,782296..782670,
FT                   785378..785438))
FT                   /codon_start=1
FT                   /gene="Oit3"
FT                   /locus_tag="mCG_122796"
FT                   /product="oncoprotein induced transcript 3"
FT                   /note="gene_id=mCG122796.1 transcript_id=mCT124024.1
FT                   protein_id=mCP54880.1"
FT                   /protein_id="EDL32203.1"
FT                   /translation="MPLSLLLTCLSTTVTLVSPAVLDPCSAYISLNEPWRNTDHQFDES
FT                   QNQPLCDNHMNGEWYRFTGMAGDAMPTFCIPENHCGTHAPVWLNGSHPLEEDGIVQRQA
FT                   CASFKGNCCLWNATVEVKACPRGYYVYRLARPSVCFHVYCGHFYDICDEDCHGNCLDTT
FT                   ECACSPGTSLGPDGQTCFDENECEHNNGGCSEICVNLKNSHRCACGVGRVLRSDGKTCE
FT                   DIEGCHNNNGGCSHSCLGSEEGYQCECPRGLVLSEDNHTCQVPVLCKSSAIEVSVPREL
FT                   VGGLELFLTNTSCRGVSNGTHVNIVFSLKTCGTVVDVVNDKIVASNIVTGLPKETPGSS
FT                   GDIIIRTSKLLIPVTCEFPRLYTISEGYVPNLRNAPLEIRSRNHGIFPFTLEIFKDHEF
FT                   EEPYRETLPTLKLRDSLYFGIEPLVHVNGLESLVESCFATPTAKMDEILKYYLIQDGCV
FT                   SDDSVKQYSSRDHLAKHFQAPVFKFVGKDHKEVFLHCRVLVCGVLDERSRCAQGCHRRV
FT                   RREVGEDEDSAGLQSQTLTGGPIAIDWED"
FT   gene            complement(792234..959892)
FT                   /locus_tag="mCG_11304"
FT                   /note="gene_id=mCG11304.2"
FT   mRNA            complement(join(792234..792611,794959..795075,
FT                   798699..798902,800402..800562,810208..810312,
FT                   811380..811550,834698..834767,959736..959892))
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, transcript variant mCT11591"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT11591.2 created
FT                   on 18-NOV-2002"
FT   CDS             complement(join(792534..792611,794959..795075,
FT                   798699..798902,800402..800562,810208..810312,
FT                   811380..811550,834698..834767,959736..959882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, isoform CRA_a"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT11591.2
FT                   protein_id=mCP1436.1 isoform=CRA_a"
FT                   /protein_id="EDL32200.1"
FT                   /translation="MAAAAGRSLLLLLCSRGGGGGAGGCGALTAGCFPGLGVSRHRPHQ
FT                   QHRTAHQRPASWQSVGAAYCSTVVPSDDVTVVYQNGLPVISVRLPSRRERCQFTLKPIS
FT                   DSVGVFLRQLQEEDRGIDRVAIYSPDGVRVAASTGIDLLLLDDFKLVINDLTYHVRPPK
FT                   RDLLSHEDAATLNDVKTLVQQLYTTLCIEQHQLNKERELVERLEDLKQQLAPLEKVRIE
FT                   ISRKAEKRTTLVLWGGLAYMATQFGILARLTWWEYSWDIMEPVTYFITYGSAMAMYAYF
FT                   VMTRQEYVYPEARDRQYLLFFHKGAKKSRFDLEKYNQLKDAIAQAEMDLKRLRDPLQVH
FT                   LPLRQIGEKE"
FT   assembly_gap    827516..827644
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    842496..842843
FT                   /estimated_length=348
FT                   /gap_type="unknown"
FT   assembly_gap    917461..917573
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    926386..926405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    928868..929256
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   mRNA            complement(join(945879..946305,959736..959892))
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, transcript variant mCT161890"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT161890.1 created
FT                   on 18-NOV-2002"
FT   mRNA            complement(join(945879..946305,949345..949389,
FT                   959736..959892))
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, transcript variant mCT176017"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT176017.0 created
FT                   on 18-NOV-2002"
FT   CDS             complement(join(946297..946305,959736..959882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, isoform CRA_b"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT161890.1
FT                   protein_id=mCP55349.1 isoform=CRA_b"
FT                   /protein_id="EDL32201.1"
FT                   /translation="MAAAAGRSLLLLLCSRGGGGGAGGCGALTAGCFPGLGVSRHRPHQ
FT                   QHRTTS"
FT   assembly_gap    949075..949330
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   CDS             complement(join(949363..949389,959736..959882))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11304"
FT                   /product="mCG11304, isoform CRA_c"
FT                   /note="gene_id=mCG11304.2 transcript_id=mCT176017.0
FT                   protein_id=mCP98939.0 isoform=CRA_c"
FT                   /protein_id="EDL32202.1"
FT                   /translation="MAAAAGRSLLLLLCSRGGGGGAGGCGALTAGCFPGLGVSRHRPHQ
FT                   QHRTLNVQVLSS"
FT   assembly_gap    960212..960245
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    986854..987652
FT                   /estimated_length=799
FT                   /gap_type="unknown"
FT   assembly_gap    988545..988564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1000766..1001519
FT                   /estimated_length=754
FT                   /gap_type="unknown"
FT   assembly_gap    1008261..1008284
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    1028066..1028085
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1029537..1029735
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    1035810..1035829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1045143..1205269
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /note="gene_id=mCG141510.0"
FT   mRNA            join(1045143..1045269,1045728..1045812,1048712..1048781,
FT                   1070539..1070700,1075565..1075739,1083242..1083404,
FT                   1093086..1093129,1110720..1110834,1130892..1130974,
FT                   1131830..1132027,1170390..1170527,1182873..1182981,
FT                   1202507..1202596,1204123..1205269)
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   transcript variant mCT175740"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT175740.0
FT                   created on 14-NOV-2002"
FT   mRNA            join(<1045179..1045269,1070539..1070700,1075565..1075739,
FT                   1083242..1083404,1093086..1093141,1110720..1110834,
FT                   1130892..1130974,1131830..1132027,1170390..1170527,
FT                   1182873..1182981,1202507..1202596,1204123..1205074)
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   transcript variant mCT192941"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT192941.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(<1045217..1045269,1070539..1070700,1075565..1075739,
FT                   1083242..1083404,1093086..1093129,1110720..1110834,
FT                   1130892..1130974,1131830..1132027,1170390..1170527,
FT                   1182873..1182981,1202507..1202596,1204123..1205064)
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   transcript variant mCT192940"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT192940.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<1045253..1045269,1070539..1070700,1075565..1075739,
FT                   1083242..1083404,1093086..1093141,1110720..1110834,
FT                   1130892..1130974,1131830..1132027,1170390..1170527,
FT                   1182873..1182981,1202507..1202596,1204123..1204280)
FT                   /codon_start=1
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT192941.0
FT                   protein_id=mCP113912.0 isoform=CRA_c"
FT                   /protein_id="EDL32199.1"
FT                   /translation="SWSADGMFRLNTLSALAELAVGSRWYHGASQPTQTKRRLMLVAFL
FT                   GASAVTASTGLLWKKAHAESPPCVNSKKPDTEDKERNKDSGEVSSREGRAADAAAEPYP
FT                   EDKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRS
FT                   ITPNEKQPEHLGLDQYIIKRFDGKVSRLKIAQEREKFADEGSIFYSLGECGLISFSDYI
FT                   FLTTVLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNT
FT                   LKSGLCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFG
FT                   GMLLAYSGVQSKKLTAMQRQLKKHFKDGKGLTFQEVENFFTFLKNINDVDTALSFYHMA
FT                   GASLDKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLE
FT                   KPKDMGFTRLMQAMWKCAQETAWDFALPK"
FT   CDS             join(<1045253..1045269,1070539..1070700,1075565..1075739,
FT                   1083242..1083404,1093086..1093129,1110720..1110834,
FT                   1130892..1130974,1131830..1132027,1170390..1170527,
FT                   1182873..1182981,1202507..1202596,1204123..1204280)
FT                   /codon_start=1
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT192940.0
FT                   protein_id=mCP113911.0 isoform=CRA_b"
FT                   /protein_id="EDL32198.1"
FT                   /translation="SWSADGMFRLNTLSALAELAVGSRWYHGASQPTQTKRRLMLVAFL
FT                   GASAVTASTGLLWKKAHAESPPCVNSKKPDTEDKERNKDSGEVSSREGRAADAAAEPYP
FT                   EDKKKKRSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRS
FT                   ITPNEKQPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTT
FT                   VLSTPQRNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSG
FT                   LCSALTTYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLL
FT                   AYSGVQSKKLTAMQRQLKKHFKDGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASL
FT                   DKVTMQQVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKD
FT                   MGFTRLMQAMWKCAQETAWDFALPK"
FT   CDS             join(1070540..1070700,1075565..1075739,1083242..1083404,
FT                   1093086..1093129,1110720..1110834,1130892..1130974,
FT                   1131830..1132027,1170390..1170527,1182873..1182981,
FT                   1202507..1202596,1204123..1204280)
FT                   /codon_start=1
FT                   /gene="Cbara1"
FT                   /locus_tag="mCG_141510"
FT                   /product="calcium binding atopy-related autoantigen 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG141510.0 transcript_id=mCT175740.0
FT                   protein_id=mCP98662.0 isoform=CRA_a"
FT                   /protein_id="EDL32197.1"
FT                   /translation="MFRLNTLSALAELAVGSRWYHGASQPTQTKRRLMLVAFLGASAVT
FT                   ASTGLLWKKAHAESPPCVNSKKPDTEDKERNKDSGEVSSREGRAADAAAEPYPEDKKKK
FT                   RSGFRDRKVMEYENRIRAYSTPDKIFRYFATLKVINEPGETEVFMTPQDFVRSITPNEK
FT                   QPEHLGLDQYIIKRFDGKKIAQEREKFADEGSIFYSLGECGLISFSDYIFLTTVLSTPQ
FT                   RNFEIAFKMFDLNGDGEVDMEEFEQVQSIIRSQTSMGMRHRDRPTTGNTLKSGLCSALT
FT                   TYFFGADLKGKLTIKNFLEFQRKLQHDVLKLEFERHDPVDGRISERQFGGMLLAYSGVQ
FT                   SKKLTAMQRQLKKHFKDGKGLTFQEVENFFTFLKNINDVDTALSFYHMAGASLDKVTMQ
FT                   QVARTVAKVELSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRL
FT                   MQAMWKCAQETAWDFALPK"
FT   assembly_gap    1112446..1112465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1142972..1142991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1153916..1155691
FT                   /estimated_length=1776
FT                   /gap_type="unknown"
FT   assembly_gap    1164838..1164885
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    1181959..1181978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1191062..1191142
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    1192592..1192791
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    1194915..1198591
FT                   /estimated_length=3677
FT                   /gap_type="unknown"
FT   assembly_gap    1208872..1209267
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   gene            complement(1212126..1212637)
FT                   /pseudo
FT                   /locus_tag="mCG_49680"
FT                   /note="gene_id=mCG49680.2"
FT   mRNA            complement(1212126..1212637)
FT                   /pseudo
FT                   /locus_tag="mCG_49680"
FT                   /note="gene_id=mCG49680.2 transcript_id=mCT49863.2 created
FT                   on 14-NOV-2002"
FT   gene            <1220503..1240137
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /note="gene_id=mCG11302.3"
FT   mRNA            join(<1220503..1220749,1230967..1231147,1233512..1233697,
FT                   1233778..1233857,1235072..1235181,1236429..1236601,
FT                   1237191..1237336,1238332..1238855)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT192990"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT192990.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(1220506..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237342,1238332..1240137)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT173954"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173954.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1220506..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237336,1238332..1240137)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT173952"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173952.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1220506..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237288,1238332..1240137)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT173953"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173953.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1220506..1220749,1230967..1231147,1233512..1233697,
FT                   1233778..1233857,1235072..1235181,1236429..1236601,
FT                   1237191..1237342,1238332..1240137)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT173951"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173951.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1220506..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237616)
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   transcript variant mCT11589"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT11589.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(1220617..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237288,1238332..1238361)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173953.0
FT                   protein_id=mCP96871.0 isoform=CRA_d"
FT                   /db_xref="GOA:Q8C4C9"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1931881"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C4C9"
FT                   /protein_id="EDL32196.1"
FT                   /translation="MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA
FT                   LIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVK
FT                   RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLS
FT                   NPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS
FT                   NGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
FT                   GHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGL
FT                   LYRARYFGDTDMYHRAQKMGTPSCNRLSETMKSLENFW"
FT   CDS             join(1220617..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173952.0
FT                   protein_id=mCP96873.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QYI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1931881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYI4"
FT                   /protein_id="EDL32192.1"
FT                   /translation="MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA
FT                   LIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVK
FT                   RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLS
FT                   NPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS
FT                   NGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
FT                   GHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGL
FT                   LYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASLHG"
FT   CDS             join(1220617..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173954.0
FT                   protein_id=mCP96872.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QYI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1931881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYI4"
FT                   /protein_id="EDL32193.1"
FT                   /translation="MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA
FT                   LIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVK
FT                   RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLS
FT                   NPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS
FT                   NGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
FT                   GHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGL
FT                   LYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASLHG"
FT   CDS             join(1220617..1220749,1230967..1231147,1231680..1231825,
FT                   1233512..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT11589.2
FT                   protein_id=mCP1501.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q9QYI4"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR015399"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="MGI:MGI:1931881"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QYI4"
FT                   /protein_id="EDL32195.1"
FT                   /translation="MESNKDEAERCISIALKAIQSNQPERALRFLEKAQRLYPTPRVSA
FT                   LIESLNQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQVAAVK
FT                   RVKQCKDYYEILGVSRSASDEDLKKAYRKLALKFHPDKNHAPGATEAFKAIGTAYAVLS
FT                   NPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEADISPEDLFNMFFGGGFPSSNVHVYS
FT                   NGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILILILVSALSQLMVSSPPYSLSPRPSV
FT                   GHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVERNVEDDYIANLRNNCWKEKQQKEGL
FT                   LYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASLHG"
FT   CDS             join(<1231144..1231147,1233512..1233697,1233778..1233857,
FT                   1235072..1235181,1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT192990.0
FT                   protein_id=mCP113964.0 isoform=CRA_c"
FT                   /protein_id="EDL32194.1"
FT                   /translation="KAIGTAYAVLSNPEKRKQYDQFGDDKSQAARHGHSHGDFHRGFEA
FT                   DISPEDLFNMFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQLMPILI
FT                   LILVSALSQLMVSSPPYSLSPRPSVGHIHKRVTDHLNVAYYVADTFSEEYTGSSLKTVE
FT                   RNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCNRLSEVQASL
FT                   HG"
FT   assembly_gap    1231178..1231343
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   CDS             join(1233670..1233697,1233778..1233857,1235072..1235181,
FT                   1236429..1236601,1237191..1237312)
FT                   /codon_start=1
FT                   /gene="Dnajb12"
FT                   /locus_tag="mCG_11302"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 12,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11302.3 transcript_id=mCT173951.0
FT                   protein_id=mCP96870.0 isoform=CRA_a"
FT                   /protein_id="EDL32191.1"
FT                   /translation="MFFGGGFPSSNVHVYSNGRMRYTYQQRQDRRDNQGDGGLGVFVQL
FT                   MPILILILVSALSQLMVSSPPYSLSPRPSVGHIHKRVTDHLNVAYYVADTFSEEYTGSS
FT                   LKTVERNVEDDYIANLRNNCWKEKQQKEGLLYRARYFGDTDMYHRAQKMGTPSCNRLSE
FT                   VQASLHG"
FT   assembly_gap    1245201..1245220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1245976..1246023
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    1250723..1251087
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    1272457..1272622
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    1280293..1282318
FT                   /estimated_length=2026
FT                   /gap_type="unknown"
FT   assembly_gap    1285561..1285580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1290371..1292534)
FT                   /gene="Ddit4"
FT                   /locus_tag="mCG_11295"
FT                   /note="gene_id=mCG11295.2"
FT   mRNA            complement(join(1290371..1291731,1292019..1292274,
FT                   1292399..1292534))
FT                   /gene="Ddit4"
FT                   /locus_tag="mCG_11295"
FT                   /product="DNA-damage-inducible transcript 4"
FT                   /note="gene_id=mCG11295.2 transcript_id=mCT11582.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(1291238..1291731,1292019..1292214))
FT                   /codon_start=1
FT                   /gene="Ddit4"
FT                   /locus_tag="mCG_11295"
FT                   /product="DNA-damage-inducible transcript 4"
FT                   /note="gene_id=mCG11295.2 transcript_id=mCT11582.2
FT                   protein_id=mCP1508.1"
FT                   /db_xref="GOA:B7ZNP9"
FT                   /db_xref="InterPro:IPR012918"
FT                   /db_xref="MGI:MGI:1921997"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZNP9"
FT                   /protein_id="EDL32190.1"
FT                   /translation="MPSLWDRFSSSSSSSSSSRTPAADRPPRSAWGSAAREEGLDRCAS
FT                   LESSDCESLDSSNSGFGPEEDSSYLDGVSLPDFELLSDPEDEHLCANLMQLLQESLSQA
FT                   RLGSRRPARLLMPSQLVSQVGKELLRLAYSEPCGLRGALLDVCVEQGKSCHSVAQLALD
FT                   PSLVPTFQLTLVLRLDSRLWPKIQGLLSSANSSLVPGYSQSLTLSTGFRVIKKKLYSSE
FT                   QLLIEEC"
FT   assembly_gap    1302064..1302235
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    1317069..1317491
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    1317857..1318167
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   gene            complement(1328092..1343888)
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /note="gene_id=mCG11305.2"
FT   mRNA            complement(join(1328092..1329509,1331504..1331578,
FT                   1343732..1343888))
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   transcript variant mCT173955"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT173955.0 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1328092..1329509,1331504..1331578,
FT                   1337119..1337285,1343732..1343888))
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   transcript variant mCT11592"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT11592.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1328092..1329509,1331504..1331578,
FT                   1337119..1337285,1343194..1343243,1343732..1343888))
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   transcript variant mCT173956"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT173956.0 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1329394..1329509,1331504..1331578,
FT                   1337119..1337285,1343194..1343225))
FT                   /codon_start=1
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT173956.0
FT                   protein_id=mCP96875.0 isoform=CRA_b"
FT                   /db_xref="GOA:S4R2B6"
FT                   /db_xref="InterPro:IPR029641"
FT                   /db_xref="MGI:MGI:1289325"
FT                   /db_xref="UniProtKB/TrEMBL:S4R2B6"
FT                   /protein_id="EDL32188.1"
FT                   /translation="MSARSSLSYTNEERLLLEGMAASSSSSSAGGVSGSSVTGSGFSVS
FT                   DLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGL
FT                   VEELEADEWRFKPIEQLLGFTPSSG"
FT   CDS             complement(join(1329394..1329509,1331504..1331578,
FT                   1337119..1337260))
FT                   /codon_start=1
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT11592.1
FT                   protein_id=mCP1435.1 isoform=CRA_c"
FT                   /protein_id="EDL32189.1"
FT                   /translation="MAASSSSSSAGGVSGSSVTGSGFSVSDLAPPRKALFTYPKGAGEM
FT                   LEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLG
FT                   FTPSSG"
FT   CDS             complement(1329394..1329492)
FT                   /codon_start=1
FT                   /gene="D10Ertd641e"
FT                   /locus_tag="mCG_11305"
FT                   /product="DNA segment, Chr 10, ERATO Doi 641, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG11305.2 transcript_id=mCT173955.0
FT                   protein_id=mCP96874.0 isoform=CRA_a"
FT                   /db_xref="GOA:S4R1V1"
FT                   /db_xref="InterPro:IPR029641"
FT                   /db_xref="MGI:MGI:1289325"
FT                   /db_xref="UniProtKB/TrEMBL:S4R1V1"
FT                   /protein_id="EDL32187.1"
FT                   /translation="MEKLAGLVEELEADEWRFKPIEQLLGFTPSSG"
FT   assembly_gap    1339365..1339633
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   gene            1343580..1441151
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /note="gene_id=mCG11294.2"
FT   mRNA            join(1343580..1343683,1345571..1345703,1348531..1348630,
FT                   1353232..1353329,1354366..1354544,1382930..1383066,
FT                   1390563..1390682,1403372..1403496,1405235..1405320,
FT                   1439254..1439375,1440867..1441151)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT11581"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT11581.2 created
FT                   on 14-NOV-2002"
FT   mRNA            join(1343580..1343683,1345571..1345703,1348531..1348630,
FT                   1354366..1354544,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439375,
FT                   1440867..1441151)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT175721"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175721.0 created
FT                   on 14-NOV-2002"
FT   mRNA            join(1343580..1343683,1345571..1345703,1348531..1348630,
FT                   1353232..1353329,1354366..1354544,1372282..1372468)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT175722"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175722.0 created
FT                   on 14-NOV-2002"
FT   mRNA            join(1344106..1344192,1345571..1345703,1348531..1348630,
FT                   1353232..1353329,1354366..1354544,1382930..1383066,
FT                   1390563..1390682,1403372..1403496,1405235..1405320,
FT                   1439254..1439375,1440867..1441151)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT175720"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175720.0 created
FT                   on 14-NOV-2002"
FT   CDS             join(1345595..1345703,1348531..1348630,1353232..1353329,
FT                   1354366..1354544,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439370)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT11581.2
FT                   protein_id=mCP1505.2 isoform=CRA_a"
FT                   /protein_id="EDL32182.1"
FT                   /translation="MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEP
FT                   CGAYEVAQTPHGFRATVSAPSLLYKHIVGKRGDTKKKIEVETKTSINIPKHGHEGEIVI
FT                   TGQHRNGVVSARTRIDVLLDTFRRRQPFTHFLSFFLNEVEVQERFLMFQEEVLRKCSKD
FT                   RGVDSTIFQNPKKLHLTIGMLVLLSEQEIQQTCEILQRCKEEFINDISGGRPLEVEMAG
FT                   IEYMNDDPAMVDVLYAKVHMKDGSNRLQELVDRVLERFQSLGLIVKEWTSVKLHATVMN
FT                   TLLRKDPNAEGRYNLYTADGKYIFKERESFDGRNILKTFENFYFGSLRLNSIHISQRFT
FT                   VDSFGNYASCGHVDFS"
FT   CDS             join(1345595..1345703,1348531..1348630,1353232..1353329,
FT                   1354366..1354544,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439370)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175720.0
FT                   protein_id=mCP98642.0 isoform=CRA_a"
FT                   /protein_id="EDL32185.1"
FT                   /translation="MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEP
FT                   CGAYEVAQTPHGFRATVSAPSLLYKHIVGKRGDTKKKIEVETKTSINIPKHGHEGEIVI
FT                   TGQHRNGVVSARTRIDVLLDTFRRRQPFTHFLSFFLNEVEVQERFLMFQEEVLRKCSKD
FT                   RGVDSTIFQNPKKLHLTIGMLVLLSEQEIQQTCEILQRCKEEFINDISGGRPLEVEMAG
FT                   IEYMNDDPAMVDVLYAKVHMKDGSNRLQELVDRVLERFQSLGLIVKEWTSVKLHATVMN
FT                   TLLRKDPNAEGRYNLYTADGKYIFKERESFDGRNILKTFENFYFGSLRLNSIHISQRFT
FT                   VDSFGNYASCGHVDFS"
FT   CDS             join(1345595..1345703,1348531..1348630,1353232..1353329,
FT                   1354366..1354544,1372282..1372287)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175722.0
FT                   protein_id=mCP98643.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UMX8"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009210"
FT                   /db_xref="MGI:MGI:1916340"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UMX8"
FT                   /protein_id="EDL32184.1"
FT                   /translation="MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEP
FT                   CGAYEVAQTPHGFRATVSAPSLLYKHIVGKRGDTKKKIEVETKTSINIPKHGHEGEIVI
FT                   TGQHRNGVVSARTRIDVLLDTFRRRQPFTHFLSFFLNEVEVQERFLMFQEEVLRKCSKF
FT                   "
FT   CDS             join(1345595..1345703,1348531..1348630,1354366..1354483)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175721.0
FT                   protein_id=mCP98645.0 isoform=CRA_b"
FT                   /protein_id="EDL32183.1"
FT                   /translation="MDVLRPQIVTFDGRNYRKNPIQEKQYQHEEDEDFYPDSMEYSDEP
FT                   CGAYEVAQTPHGFRATVSAPSLLYNDHWSASKWRGLSANTDRRAPGHVQEEAAFYPLPF
FT                   LLPQ"
FT   assembly_gap    1347500..1347835
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    1349934..1349953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1359482..1359665
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    1371021..1371040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<1372331..1372411,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439375,
FT                   1440867..1441151)
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, transcript variant mCT175723"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175723.0 created
FT                   on 14-NOV-2002"
FT   CDS             join(<1372331..1372411,1382930..1383066,1390563..1390682,
FT                   1403372..1403496,1405235..1405320,1439254..1439370)
FT                   /codon_start=1
FT                   /gene="Ascc1"
FT                   /locus_tag="mCG_11294"
FT                   /product="activating signal cointegrator 1 complex subunit
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG11294.2 transcript_id=mCT175723.0
FT                   protein_id=mCP98644.0 isoform=CRA_d"
FT                   /protein_id="EDL32186.1"
FT                   /translation="PIETSCWMTDDFSLCPHGHRNSCCVLLDRGVDSTIFQNPKKLHLT
FT                   IGMLVLLSEQEIQQTCEILQRCKEEFINDISGGRPLEVEMAGIEYMNDDPAMVDVLYAK
FT                   VHMKDGSNRLQELVDRVLERFQSLGLIVKEWTSVKLHATVMNTLLRKDPNAEGRYNLYT
FT                   ADGKYIFKERESFDGRNILKTFENFYFGSLRLNSIHISQRFTVDSFGNYASCGHVDFS"
FT   assembly_gap    1375478..1375532
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    1391163..1391597
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    1420151..1420913
FT                   /estimated_length=763
FT                   /gap_type="unknown"
FT   assembly_gap    1431314..1431547
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   gene            1447332..1476396
FT                   /gene="Spock2"
FT                   /locus_tag="mCG_11290"
FT                   /note="gene_id=mCG11290.2"
FT   mRNA            join(1447332..1447817,1462491..1462499,1462737..1462782,
FT                   1462943..1463057,1465069..1465183,1466909..1467023,
FT                   1467352..1467468,1468032..1468250,1470879..1470941,
FT                   1472282..1472419,1472534..1476396)
FT                   /gene="Spock2"
FT                   /locus_tag="mCG_11290"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 2"
FT                   /note="gene_id=mCG11290.2 transcript_id=mCT11577.2 created
FT                   on 02-OCT-2002"
FT   CDS             join(1447629..1447817,1462491..1462499,1462737..1462782,
FT                   1462943..1463057,1465069..1465183,1466909..1467023,
FT                   1467352..1467468,1468032..1468250,1470879..1470941,
FT                   1472282..1472419,1472534..1472679)
FT                   /codon_start=1
FT                   /gene="Spock2"
FT                   /locus_tag="mCG_11290"
FT                   /product="sparc/osteonectin, cwcv and kazal-like domains
FT                   proteoglycan 2"
FT                   /note="gene_id=mCG11290.2 transcript_id=mCT11577.2
FT                   protein_id=mCP1458.2"
FT                   /protein_id="EDL32181.1"
FT                   /translation="MRAPGSGRLALPLLLLAVVALAEGDAKGLKEGETPGNFMEDEQWL
FT                   SSISQYSGKIKHWNRFRDEVEDDYIKSWEDNQQGDEALDTTKDPCQKVKCSRHKVCVAQ
FT                   GYQRAMCISRKKLEHRIKQPSLKLHGGKDSVCKPCHMAQLASVCGSDGHTYSSVCKLEQ
FT                   QACLSSKQLAVRCEGPCPCPTEQYTASTTDSKSETCTGQDLADLGDRLRDWFQLLRENS
FT                   KQNGSANSATNPAGLDKSLGASCKDSIGWMFSKLDTSGDLFLDQTELAAINLDKYEVCI
FT                   RPFFNSCDTYKDGRVSTAEWCFCFWREKPPCLAELERTQIQEAAKKKPGVFIPSCDEDG
FT                   YYRKMQCDQSRGDCWCVDQLGLELTGTRMHGTPDCDDIVGFSGDFGSGVGWEDEEEKET
FT                   EEAGEEAEEEEGEAGEADDGGYIW"
FT   assembly_gap    1448183..1448336
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    1454632..1454651
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1460611..1460860
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    1465202..1465221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1477022..1477101
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1482768..1482787
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1483873..1484116
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    1485654..1485673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1524870..1534063)
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /note="gene_id=mCG11291.2"
FT   mRNA            complement(join(1524870..1526656,1527846..1528091,
FT                   1533917..1534063))
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /product="carbohydrate (chondroitin 6/keratan)
FT                   sulfotransferase 3, transcript variant mCT11578"
FT                   /note="gene_id=mCG11291.2 transcript_id=mCT11578.1 created
FT                   on 02-OCT-2002"
FT   mRNA            complement(join(1524870..1526656,1527846..1528479))
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /product="carbohydrate (chondroitin 6/keratan)
FT                   sulfotransferase 3, transcript variant mCT173949"
FT                   /note="gene_id=mCG11291.2 transcript_id=mCT173949.0 created
FT                   on 02-OCT-2002"
FT   CDS             complement(join(1525378..1526656,1527846..1528003))
FT                   /codon_start=1
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /product="carbohydrate (chondroitin 6/keratan)
FT                   sulfotransferase 3, isoform CRA_a"
FT                   /note="gene_id=mCG11291.2 transcript_id=mCT173949.0
FT                   protein_id=mCP96868.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8X5"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR016469"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858224"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8X5"
FT                   /protein_id="EDL32179.1"
FT                   /translation="MAPPLPMEKGLALPQDFRDLVHSLKIRGRYVLFLAFVVIVFIFIE
FT                   KENKIISRVSDKLKQIPHFVADANSTDPALLLSENASLLSLSELDSTFSHLRSRLHNLS
FT                   LQLGVEPAMESQEAGAEKPSQQAGAGTRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFE
FT                   PLWHIERTVFFQQRGASAAGSALVYRDVLKQLLLCDLYVLEPFISPPPEDHLTQFLFRR
FT                   GSSRSLCEDPVCTPFVKKVFEKYHCRNRRCGPLNVTLAGEACRRKDHVALKAVRIRQLE
FT                   FLQPLVEDPRLDLRVIQLVRDPRAVLASRIVAFAGKYENWKKWLSEGQDQLSEDEVQRL
FT                   RGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARRPLQKAREMYSFAGIPLTPQVEDW
FT                   IQKNTQATRDSSDVYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPTMHLFGYKLARDA
FT                   ASLTNRSISLLEERGTFWVT"
FT   CDS             complement(join(1525378..1526656,1527846..1528003))
FT                   /codon_start=1
FT                   /gene="Chst3"
FT                   /locus_tag="mCG_11291"
FT                   /product="carbohydrate (chondroitin 6/keratan)
FT                   sulfotransferase 3, isoform CRA_a"
FT                   /note="gene_id=mCG11291.2 transcript_id=mCT11578.1
FT                   protein_id=mCP1456.1 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8X5"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR016469"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858224"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8X5"
FT                   /protein_id="EDL32180.1"
FT                   /translation="MAPPLPMEKGLALPQDFRDLVHSLKIRGRYVLFLAFVVIVFIFIE
FT                   KENKIISRVSDKLKQIPHFVADANSTDPALLLSENASLLSLSELDSTFSHLRSRLHNLS
FT                   LQLGVEPAMESQEAGAEKPSQQAGAGTRRHVLLMATTRTGSSFVGEFFNQQGNIFYLFE
FT                   PLWHIERTVFFQQRGASAAGSALVYRDVLKQLLLCDLYVLEPFISPPPEDHLTQFLFRR
FT                   GSSRSLCEDPVCTPFVKKVFEKYHCRNRRCGPLNVTLAGEACRRKDHVALKAVRIRQLE
FT                   FLQPLVEDPRLDLRVIQLVRDPRAVLASRIVAFAGKYENWKKWLSEGQDQLSEDEVQRL
FT                   RGNCESIRLSAELGLRQPAWLRGRYMLVRYEDVARRPLQKAREMYSFAGIPLTPQVEDW
FT                   IQKNTQATRDSSDVYSTQKNSSEQFEKWRFSMPFKLAQVVQAACGPTMHLFGYKLARDA
FT                   ASLTNRSISLLEERGTFWVT"
FT   assembly_gap    1530154..1530173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1534510..1534529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1540909..1541029
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    1549271..1549310
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    1550658..1550797
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            1617999..1642945
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /note="gene_id=mCG61290.2"
FT   mRNA            join(1617999..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1637880..1637888,1639441..1639572,
FT                   1639807..1639902,1640122..1640401,1640491..1640648,
FT                   1640881..1640961,1641117..1641224,1642037..1642945)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT61473"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT61473.2 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1617999..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642945)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT173975"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173975.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(1617999..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1635308..1635451,1636289..1636345,
FT                   1637880..1637888,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642945)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT173977"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173977.0 created
FT                   on 02-OCT-2002"
FT   mRNA            join(<1618062..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636349,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642334)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT192951"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT192951.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(1618087..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1637880..1637888,1639441..1639572,
FT                   1639807..1639902,1640122..1640401,1640491..1640648,
FT                   1640881..1640961,1641117..1641224,1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_e"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT61473.2
FT                   protein_id=mCP24329.2 isoform=CRA_e"
FT                   /db_xref="GOA:Q3UFE8"
FT                   /db_xref="InterPro:IPR003119"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR008373"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR021165"
FT                   /db_xref="MGI:MGI:97783"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UFE8"
FT                   /protein_id="EDL32178.1"
FT                   /translation="MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAV
FT                   KHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSA
FT                   SCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDM
FT                   ARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKTNSSFIQGFV
FT                   DHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQDQQPKEICVLAGFCNEVKRVPM
FT                   KTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELL
FT                   VKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEA
FT                   LEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEK
FT                   NSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPS
FT                   AYKLLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN"
FT   CDS             join(1618087..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_a"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173975.0
FT                   protein_id=mCP96895.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BFQ1"
FT                   /db_xref="InterPro:IPR003119"
FT                   /db_xref="InterPro:IPR007856"
FT                   /db_xref="InterPro:IPR008138"
FT                   /db_xref="InterPro:IPR008139"
FT                   /db_xref="InterPro:IPR008373"
FT                   /db_xref="InterPro:IPR011001"
FT                   /db_xref="InterPro:IPR021165"
FT                   /db_xref="MGI:MGI:97783"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BFQ1"
FT                   /protein_id="EDL32174.1"
FT                   /translation="MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAV
FT                   KHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSA
FT                   SCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDM
FT                   ARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKTNSSFIQGFV
FT                   DHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQPKEICVLAGFCNEVKRVPMKTL
FT                   VPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKG
FT                   LSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQ
FT                   PAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNST
FT                   KEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYK
FT                   LLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN"
FT   CDS             join(1618087..1618126,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1635308..1635451,1636289..1636345,
FT                   1637880..1637888,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_b"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173977.0
FT                   protein_id=mCP96894.0 isoform=CRA_b"
FT                   /protein_id="EDL32175.1"
FT                   /translation="MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAV
FT                   KHCQQMVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSA
FT                   SCKEVVDSYLPVILDMIKGEMANEDVCQDCMKLVSDVQTAVKTNSSFIQGFVDHVKEDC
FT                   DRLGPGVSDICKNYVDQYSEVCVQMLMHMQDQQPKEICVLAGFCNEVKRVPMKTLVPAT
FT                   ETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNA
FT                   CALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPA
FT                   IVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEI
FT                   LAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLG
FT                   TEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN"
FT   mRNA            join(1626255..1626305,1631982..1632115,1632848..1632922,
FT                   1633692..1633817,1634876..1635073,1635308..1635451,
FT                   1636289..1636345,1637880..1637888,1639441..1639572,
FT                   1639807..1639902,1640122..1640401,1640491..1640648,
FT                   1640881..1640961,1641117..1641224,1642037..1642945)
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, transcript variant mCT173976"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173976.0 created
FT                   on 02-OCT-2002"
FT   CDS             join(1632092..1632115,1632848..1632922,1633692..1633817,
FT                   1634876..1635073,1635308..1635451,1636289..1636345,
FT                   1637880..1637888,1639441..1639572,1639807..1639902,
FT                   1640122..1640401,1640491..1640648,1640881..1640961,
FT                   1641117..1641224,1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_d"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT173976.0
FT                   protein_id=mCP96896.0 isoform=CRA_d"
FT                   /protein_id="EDL32177.1"
FT                   /translation="MVWSKPTAKSLPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCE
FT                   WIHDSSLSASCKEVVDSYLPVILDMIKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLE
FT                   SNKIPEVDMARVVAPFMSNIPLLLYPQDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKT
FT                   NSSFIQGFVDHVKEDCDRLGPGVSDICKNYVDQYSEVCVQMLMHMQDQQPKEICVLAGF
FT                   CNEVKRVPMKTLVPATETIKNILPALEMMDPYEQNLVQAHNVILCQTCQFVMNKFSELI
FT                   VNNATEELLVKGLSNACALLPDPARTKCQEVVGTFGPSLLDIFIHEVNPSSLCGVIGLC
FT                   AARPELVEALEQPAPAIVSALLKEPTPPKQPAQPKQSALPAHVPPQKNGGFCEVCKKLV
FT                   LYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQCDDFVAEYEPLLLEILVEVMDPGFV
FT                   CSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETAARCNAVDHCKRHVWN"
FT   CDS             join(<1639441..1639572,1639807..1639902,1640122..1640401,
FT                   1640491..1640648,1640881..1640961,1641117..1641224,
FT                   1642037..1642072)
FT                   /codon_start=1
FT                   /gene="Psap"
FT                   /locus_tag="mCG_61290"
FT                   /product="prosaposin, isoform CRA_c"
FT                   /note="gene_id=mCG61290.2 transcript_id=mCT192951.0
FT                   protein_id=mCP113932.0 isoform=CRA_c"
FT                   /protein_id="EDL32176.1"
FT                   /translation="QPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEMMDPYEQ
FT                   NLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQEVVGT
FT                   FGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQPAQP
FT                   KQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPYQKQ
FT                   CDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNMETA
FT                   ARCNAVDHCKRHVWN"
FT   gene            complement(1643091..2040116)
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /note="gene_id=mCG1819.2"
FT   mRNA            complement(join(1643091..1644054,1645179..1645301,
FT                   1645412..1645541,1645932..1645992,1646085..1646125,
FT                   1646294..1646373,1646463..1646583,1647817..1647914,
FT                   1648199..1648455,1651030..1651191,1651269..1651520,
FT                   1651613..1651742,1652623..1652736,1652876..1653067,
FT                   1654546..1654757,1654889..1655066,1655976..1656095,
FT                   1656956..1657093,1657372..1657541,1658109..1658333,
FT                   1659920..1660036,1663642..1664100,1665286..1665489,
FT                   1666376..1666501,1667724..1667826,1670159..1670266,
FT                   1671507..1671716,1672061..1672194,1676387..1676567,
FT                   1677571..1677690,1677994..1678215,1717385..1717612,
FT                   1718290..1718418,1719343..1719471,1719793..1719942,
FT                   1723092..1723094,1723250..1723351,1725998..1726386,
FT                   1728066..1728201,1732812..1732960,1734062..1734122,
FT                   1747374..1747522,1748464..1748577,1750104..1750256,
FT                   1751794..1752013,1754152..1754297,1754631..1754820,
FT                   1761209..1761316,1762550..1762662,1768108..1768224,
FT                   1769809..1769881,1775254..1775381,1776007..1776112,
FT                   1778143..1778380,1780296..1780360,1807209..1807367,
FT                   1807767..1807916,1809799..1809804,1829772..1829960,
FT                   1831317..1831429,1866239..1866317,1873700..1873828,
FT                   1877144..1877338,1939616..1939708,1939836..1939883,
FT                   1940517..1940659,1993648..1993725,2000825..2000896,
FT                   2030518..2030728,2039925..2040116))
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), transcript variant
FT                   mCT174089"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT174089.0 created
FT                   on 10-OCT-2002"
FT   mRNA            complement(join(1643091..1644054,1644778..1644882,
FT                   1645179..1645301,1645412..1645541,1645932..1645992,
FT                   1646085..1646125,1646294..1646373,1646463..1646583,
FT                   1647817..1647914,1648199..1648455,1651030..1651191,
FT                   1651269..1651520,1651613..1651742,1652623..1652736,
FT                   1652876..1653067,1654546..1654757,1654889..1655066,
FT                   1655976..1656095,1656956..1657093,1657372..1657541,
FT                   1658109..1658333,1659920..1660036,1663642..1664100,
FT                   1665286..1665489,1666376..1666501,1667724..1667826,
FT                   1670159..1670266,1671507..1671716,1672061..1672194,
FT                   1676387..1676567,1677571..1677690,1677994..1678215,
FT                   1717385..1717612,1718290..1718418,1719343..1719471,
FT                   1719793..1719942,1723092..1723094,1723250..1723351,
FT                   1725998..1726386,1728066..1728201,1732812..1732960,
FT                   1734062..1734122,1747374..1747522,1748464..1748577,
FT                   1750104..1750256,1751794..1752013,1754152..1754297,
FT                   1754631..1754820,1761209..1761316,1762550..1762662,
FT                   1768108..1768224,1769809..1769881,1775254..1775381,
FT                   1776007..1776112,1778143..1778380,1780296..1780360,
FT                   1807209..1807367,1807767..1807916,1809799..1809804,
FT                   1829772..1829960,1831317..1831429,1866239..1866317,
FT                   1873700..1873828,1877144..1877338,1939616..1939708,
FT                   1939836..1939883,1940517..1940659,1993648..1993725,
FT                   2000825..2000896,2030518..2030728,2039925..2040116))
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), transcript variant
FT                   mCT8177"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT8177.2 created on
FT                   10-OCT-2002"
FT   mRNA            complement(join(<1643728..1644054,1644778..1644882,
FT                   1645179..1645301,1645412..1645541,1645932..1645992,
FT                   1646085..1646125,1646294..1646373,1646463..1646583,
FT                   1647817..1647914,1648199..1648455,1651030..1651191,
FT                   1651269..1651520,1651613..1651742,1652623..1652736,
FT                   1652876..1653067,1654546..1654757,1654889..1655066,
FT                   1655976..1656095,1656956..1657093,1657372..1657541,
FT                   1658109..1658333,1659920..1660036,1663642..1664100,
FT                   1665286..1665489,1666376..1666501,1667724..1667826,
FT                   1670159..1670266,1671507..1671716,1672061..1672194,
FT                   1676387..1676567,1677571..1677690,1677994..1678215,
FT                   1717385..1717612,1718290..1718418,1719343..1719471,
FT                   1719793..1719942,1723246..1723351,1725998..1726386,
FT                   1728066..1728201,1732812..1732960,1734062..1734122,
FT                   1747374..1747522,1748464..1748577,1750104..1750256,
FT                   1751794..1752013,1754152..1754297,1754631..1754820,
FT                   1761209..1761316,1762550..1762662,1768108..1768224,
FT                   1769809..1769881,1775254..1775381,1776007..1776112,
FT                   1778143..1778380,1780296..1780360,1807209..1807367,
FT                   1807767..1807916,1829768..1829960,1831317..1831429,
FT                   1866239..1866317,1873700..1873828,1877144..1877338,
FT                   1939616..1939708,1939836..1939883,1940517..1940659,
FT                   1993648..1993725,2000825..>2000891))
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), transcript variant
FT                   mCT192963"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT192963.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(1643728..1644054,1645179..1645301,
FT                   1645412..1645541,1645932..1645992,1646085..1646125,
FT                   1646294..1646373,1646463..1646583,1647817..1647914,
FT                   1648199..1648455,1651030..1651191,1651269..1651520,
FT                   1651613..1651742,1652623..1652736,1652876..1653067,
FT                   1654546..1654757,1654889..1655066,1655976..1656095,
FT                   1656956..1657093,1657372..1657541,1658109..1658333,
FT                   1659920..1660036,1663642..1664100,1665286..1665489,
FT                   1666376..1666501,1667724..1667826,1670159..1670266,
FT                   1671507..1671716,1672061..1672194,1676387..1676567,
FT                   1677571..1677690,1677994..1678215,1717385..1717612,
FT                   1718290..1718418,1719343..1719471,1719793..1719942,
FT                   1723092..1723094,1723250..1723351,1725998..1726386,
FT                   1728066..1728201,1732812..1732960,1734062..1734122,
FT                   1747374..1747522,1748464..1748577,1750104..1750256,
FT                   1751794..1752013,1754152..1754297,1754631..1754820,
FT                   1761209..1761316,1762550..1762662,1768108..1768224,
FT                   1769809..1769881,1775254..1775381,1776007..1776112,
FT                   1778143..1778380,1780296..1780360,1807209..1807367,
FT                   1807767..1807916,1809799..1809804,1829772..1829960,
FT                   1831317..1831429,1866239..1866317,1873700..1873828,
FT                   1877144..1877338,1939616..1939708,1939836..1939883,
FT                   1940517..1940659,1993648..1993725,2000825..2000891))
FT                   /codon_start=1
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), isoform CRA_a"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT174089.0
FT                   protein_id=mCP97008.0 isoform=CRA_a"
FT                   /protein_id="EDL32167.1"
FT                   /translation="MRYSLVTCYAVLWLLMLVPGSWGQVNRLPFFTNHFFDTYLLISED
FT                   TPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVE
FT                   FSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGA
FT                   GGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANL
FT                   AIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTN
FT                   SIFALDYISGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVID
FT                   INDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFI
FT                   ISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRP
FT                   IFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIML
FT                   IARLDYELIQRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPS
FT                   VTQLVRLRATDEDSPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNG
FT                   LIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLN
FT                   ATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGV
FT                   GHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGT
FT                   LVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKAT
FT                   SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQ
FT                   VGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVN
FT                   DETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYR
FT                   DAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSY
FT                   EASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPL
FT                   DRERNSSHVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG
FT                   TSVIVVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVS
FT                   ATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNL
FT                   NQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGGPKVDSTV
FT                   KVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDAGSNGQVVFSLASG
FT                   NIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHILQVTILDV
FT                   NDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMD
FT                   RISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPH
FT                   YEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFRINKHTGVITAAKE
FT                   LDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTE
FT                   GQPGPRVWTFLAHDRDSGPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETIA
FT                   FYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVL
FT                   ASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPE
FT                   NPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADE
FT                   DVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNG
FT                   TAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEA
FT                   GAQDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDIND
FT                   SRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQE
FT                   DAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVN
FT                   DNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQL
FT                   EDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQP
FT                   SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLD
FT                   REKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEP
FT                   AGTSVITMLATDQDEGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNLTVV
FT                   ATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDND
FT                   EGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPV
FT                   PYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEG
FT                   PNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPS
FT                   PALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGN
FT                   NSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARD
FT                   LAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFH
FT                   VDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAI
FT                   SVQLPDDMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFID
FT                   IMDMPNTNKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGT
FT                   FGREPAAVKPDDDRYLRAAIQEYDNIAKLGQIIREGPIKLIHTDLEEEPGDHSPGQGSL
FT                   RFRHKPPMELKGQDGIHMVHGSTGTLLATDLNSLPEDDQKGLDRSLETLTASEATAFER
FT                   NARTESAKSTPLHKLRDVIMESPLEITEL"
FT   CDS             complement(join(1643728..1644054,1644778..1644882,
FT                   1645179..1645301,1645412..1645541,1645932..1645992,
FT                   1646085..1646125,1646294..1646373,1646463..1646583,
FT                   1647817..1647914,1648199..1648455,1651030..1651191,
FT                   1651269..1651520,1651613..1651742,1652623..1652736,
FT                   1652876..1653067,1654546..1654757,1654889..1655066,
FT                   1655976..1656095,1656956..1657093,1657372..1657541,
FT                   1658109..1658333,1659920..1660036,1663642..1664100,
FT                   1665286..1665489,1666376..1666501,1667724..1667826,
FT                   1670159..1670266,1671507..1671716,1672061..1672194,
FT                   1676387..1676567,1677571..1677690,1677994..1678215,
FT                   1717385..1717612,1718290..1718418,1719343..1719471,
FT                   1719793..1719942,1723092..1723094,1723250..1723351,
FT                   1725998..1726386,1728066..1728201,1732812..1732960,
FT                   1734062..1734122,1747374..1747522,1748464..1748577,
FT                   1750104..1750256,1751794..1752013,1754152..1754297,
FT                   1754631..1754820,1761209..1761316,1762550..1762662,
FT                   1768108..1768224,1769809..1769881,1775254..1775381,
FT                   1776007..1776112,1778143..1778380,1780296..1780360,
FT                   1807209..1807367,1807767..1807916,1809799..1809804,
FT                   1829772..1829960,1831317..1831429,1866239..1866317,
FT                   1873700..1873828,1877144..1877338,1939616..1939708,
FT                   1939836..1939883,1940517..1940659,1993648..1993725,
FT                   2000825..2000891))
FT                   /codon_start=1
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), isoform CRA_c"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT8177.2
FT                   protein_id=mCP1495.2 isoform=CRA_c"
FT                   /protein_id="EDL32169.1"
FT                   /translation="MRYSLVTCYAVLWLLMLVPGSWGQVNRLPFFTNHFFDTYLLISED
FT                   TPVGSSVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRETKSEFTVE
FT                   FSVSDHQGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPDLGA
FT                   GGSVLYSFQPPSPFFAIDSARGIVTVIQELDYEVTQAYQLTVNATDQDKTRPLSTLANL
FT                   AIIITDMQDMDPIFINLPYSTNIYEHSPPGTTVRVITAVDQDKGRPRGIGYTIVSGNTN
FT                   SIFALDYISGALTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNILVID
FT                   INDNAPEFNSSEYSVAITELAQVGFALPLFIQVVDKDENLGLNSMFEVYLVGNNSHHFI
FT                   ISPTSVQGKADIRIRVAIPLDYETVDRYDFDLFANESVPDHVGYAKVKITLINENDNRP
FT                   IFSQPLYNVSLYENITVGTSVLTVLATDNDVGTFGEVNYFFSDDPDRFSLDKDTGLIML
FT                   IARLDYELIQRFTLTVIARDGGGEETTGRVRINVLDVNDNVPTFQKDAYVGALRENEPS
FT                   VTQLVRLRATDEDSPPNNLITYSIVNASAFGSYFDISIYEGYGVISVSRPLDYEQIPNG
FT                   LIYLTVMAKDAGNPPLYSTVPVTIEVFDENDNPPTFSKPAYFVSVLENIMAGATVLFLN
FT                   ATDLDRSREYGQESIIYSLEGSSQFRINARSGEITTTSLLDRETKSEYILIVRAVDGGV
FT                   GHNQKTGIATVNVTLLDINDNHPTWKDAPYYINLVEMTPPDSDVTTVVAVDPDLGENGT
FT                   LVYSIHPPNKFYSLNSTTGKIRTTHVMLDRENPDPVEAELMRKIIVSVTDCGRPPLKAT
FT                   SSATVFVNLLDLNDNDPTFRNLPFVAEILEGTPAGVSVYQVVAIDLDEGLNGLVSYRMQ
FT                   VGMPRMDFVINSTSGVVTTTAELDRERIAEYQLRVVASDAGTPTKSSTSTLTVRVLDVN
FT                   DETPTFFPAVYNVSVSEDVPREFRVVWLNCTDNDVGLNAELSYFITAGNVDGKFSVGYR
FT                   DAVVRTVVGLDRETTAAYTLVLEAIDNGPVGKRRTGTATVFVTVLDVNDNRPIFLQSSY
FT                   EASVPEDIPEGHSIVQLKATDADEGEFGRVWYRILHGNHGNNFRIHVGSGLLMRGPRPL
FT                   DRERNSSHVLMVEAYNHDLGPMRSSVRVIVYVEDVNDEAPVFTQQQYNRLGLRETAGIG
FT                   TSVIVVRATDKDTGDGGLVNYRILSGAEGKFEIDESTGLIVTVDYLDYETKTSYLMNVS
FT                   ATDGAPPFNQGFCSVYVTLLNELDEAVQFSNASYEAVIMENLALGTEIVRVQAYSIDNL
FT                   NQITYRFDAYTSAQAKALFKIDAITGVITVKGLVDREKGDFYTLTVVADDGGPKVDSTV
FT                   KVYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDAGSNGQVVFSLASG
FT                   NIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPRKKDHILQVTILDV
FT                   NDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYYITEGNEDMTFRMD
FT                   RISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIVDENDNAPVFQQPH
FT                   YEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFRINKHTGVITAAKE
FT                   LDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPTFPRDYEGPFDVTE
FT                   GQPGPRVWTFLAHDRDSGPNGQVEYSVVDGDPLGEFVISPVEGVLRVRKDVELDRETIA
FT                   FYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTISENSPVSSFVAHVL
FT                   ASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIPEYRLTVSVKDNPE
FT                   NPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLTVLNGPILALDADE
FT                   DVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLELLLLAEDIGQLNG
FT                   TAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDEDSGLNGELVYRIEA
FT                   GAQDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSGTAIVTILIDDIND
FT                   SRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIVAKDDTDRLVPDQE
FT                   DAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSVPNAKLTVNILDVN
FT                   DNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITYTLLDLTPPGYVQL
FT                   EDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEIVDINDNNPIFDQP
FT                   SYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAINPNTGDISVLSSLD
FT                   REKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFSKPQFSTSVYENEP
FT                   AGTSVITMLATDQDEGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQRPLQSYERFNLTVV
FT                   ATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPLRSNVYEVYATDND
FT                   EGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVYSLILVASDLGQPV
FT                   PYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTLVGNVTGAVDADEG
FT                   PNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKASSNRSWTPPRGPS
FT                   PALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSELIQVLALDADIGN
FT                   NSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAYSPGYFVVDIVARD
FT                   LAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNITGAIVNTDDVQFH
FT                   VDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNLFRNYNVLDVQPAI
FT                   SVQLPDDMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKAIVAGSAGNRGFID
FT                   IMDMPNTNKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEIADLWNSPTRTHGT
FT                   FGREPAAVKPDDDRYLRAAIQEYDNIAKLGQIIREGPIKGSLLKVVLEDYLRLKKLFAQ
FT                   RMVQKASSCHSSISELIHTDLEEEPGDHSPGQGSLRFRHKPPMELKGQDGIHMVHGSTG
FT                   TLLATDLNSLPEDDQKGLDRSLETLTASEATAFERNARTESAKSTPLHKLRDVIMESPL
FT                   EITEL"
FT   CDS             complement(join(1643728..1644054,1644778..1644882,
FT                   1645179..1645301,1645412..1645541,1645932..1645992,
FT                   1646085..1646125,1646294..1646373,1646463..1646583,
FT                   1647817..1647914,1648199..1648455,1651030..1651191,
FT                   1651269..1651520,1651613..1651742,1652623..1652736,
FT                   1652876..1653067,1654546..1654757,1654889..1655066,
FT                   1655976..1656095,1656956..1657093,1657372..1657541,
FT                   1658109..1658333,1659920..1660036,1663642..1664100,
FT                   1665286..1665489,1666376..1666501,1667724..1667826,
FT                   1670159..1670266,1671507..1671716,1672061..1672194,
FT                   1676387..1676567,1677571..1677690,1677994..1678215,
FT                   1717385..1717612,1718290..1718418,1719343..1719471,
FT                   1719793..>1719942))
FT                   /codon_start=1
FT                   /gene="Cdh23"
FT                   /locus_tag="mCG_1819"
FT                   /product="cadherin 23 (otocadherin), isoform CRA_b"
FT                   /note="gene_id=mCG1819.2 transcript_id=mCT192963.0
FT                   protein_id=mCP113914.0 isoform=CRA_b"
FT                   /protein_id="EDL32168.1"
FT                   /translation="VYITVLDENDNSPRFDFTSDSAISVPEDCPVGQRVATVKARDPDA
FT                   GSNGQVVFSLASGNIAGAFEIITSNDSIGEVFVAKPLDREELDHYILKVVASDRGTPPR
FT                   KKDHILQVTILDVNDNPPVIESPFGYNVSVNENVGGGTSVVQVRATDRDIGINSVLSYY
FT                   ITEGNEDMTFRMDRISGEIATRPAPPDRERQNFYHLVVTVEDEGTPTLSATTHVYVTIV
FT                   DENDNAPVFQQPHYEVVLDEGPDTINTSLITVQALDLDEGPNGTVTYAIVAGNIINTFR
FT                   INKHTGVITAAKELDYEISHGRYTLIVTATDQCPILSHRLTSTTTVLVNVNDINDNVPT
FT                   FPRDYEGPFDVTEGQPGPRVWTFLAHDRDSGPNGQVEYSVVDGDPLGEFVISPVEGVLR
FT                   VRKDVELDRETIAFYNLTICARDRGVPPLSSTMLVGIRVLDINDNDPVLLNLPMNVTIS
FT                   ENSPVSSFVAHVLASDADSGCNALLTFNITAGNRERAFFINATTGIVTVNRPLDRERIP
FT                   EYRLTVSVKDNPENPRIARKDFDLLLVSLADENDNHPLFTEGTYQAEVMENSPAGTPLT
FT                   VLNGPILALDADEDVYAVVTYQLLGTHSDLFVIDNSTGVVTVRSGIIIDREAFSPPFLE
FT                   LLLLAEDIGQLNGTAHLFITILDDNDNWPTFSPPTYTVHLLENCPPGFSVLQVTATDED
FT                   SGLNGELVYRIEAGAQDRFLIHPVTGVIRVGNATIDREEQESYRLTVVATDRGTVPLSG
FT                   TAIVTILIDDINDSRPEFLNPIQTVSVLESAEPGTIIANVTAIDLDLNPKLEYHIISIV
FT                   AKDDTDRLVPDQEDAFAVNINTGSVMVKSPLNRELVATYEVTLSVIDNASDLPEHSVSV
FT                   PNAKLTVNILDVNDNTPQFKPFGITYYTERVLEGATPGTTLIAVAAVDPDKGLNGLITY
FT                   TLLDLTPPGYVQLEDSSAGKVIANRTVDYEEVHWLNFTVRASDNGSPPRAAEIPVYLEI
FT                   VDINDNNPIFDQPSYQEAVFEDIAVGTVILRVTATDADSGNFALIEYSLVDGEGKFAIN
FT                   PNTGDISVLSSLDREKKDHYILTALAKDNPGDVASNRRENSVQVVIRVLDVNDCRPQFS
FT                   KPQFSTSVYENEPAGTSVITMLATDQDEGSNSQLTYSLEGPGMEAFSVDMDSGLVTTQR
FT                   PLQSYERFNLTVVATDGGEPPLWGTTMLLVEVIDVNDNRPVFVRPPNGTILHIKEEIPL
FT                   RSNVYEVYATDNDEGLNGAVRYSFLKTTGNRDWEYFTIDPISGLIQTAQRLDREKQAVY
FT                   SLILVASDLGQPVPYETMQPLQVALEDIDDNEPLFVRPPKGSPQYQLLTVPEHSPRGTL
FT                   VGNVTGAVDADEGPNAIVYYFIAAGDEDKNFHLQPDGRLLVLRDLDRETEATFSFIVKA
FT                   SSNRSWTPPRGPSPALDLLTDLTLQEVRVVLEDINDQPPRFTKAEYTAGVATDAKVGSE
FT                   LIQVLALDADIGNNSLVFYGILAIHYFRALANDSEDVGQVFTMGSVDGILRTFDLFMAY
FT                   SPGYFVVDIVARDLAGHNDTAIIGIYILRDDQRVKIVINEIPDRVRGFEEEFIRLLSNI
FT                   TGAIVNTDDVQFHVDMKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMIDENKEQLRNL
FT                   FRNYNVLDVQPAISVQLPDDMSALQMAIIVLAILLFLAAMLFVLMNWYYRTIHKRKLKA
FT                   IVAGSAGNRGFIDIMDMPNTNKYSFDGANPVWLDPFCRNLELAAQAEHEDDLPENLSEI
FT                   ADLWNSPTRTHGTFGREPAAVKPDDDRYLRAAIQEYDNIAKLGQIIREGPIKGSLLKVV
FT                   LEDYLRLKKLFAQRMVQKASSCHSSISELIHTDLEEEPGDHSPGQGSLRFRHKPPMELK
FT                   GQDGIHMVHGSTGTLLATDLNSLPEDDQKGLDRSLETLTASEATAFERNARTESAKSTP
FT                   LHKLRDVIMESPLEITEL"
FT   gene            1687254..1713280
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /note="gene_id=mCG1822.2"
FT   mRNA            join(1687254..1687454,1698193..1698618,1699558..1699608,
FT                   1704798..1704905,1708362..1708389,1709125..1709321,
FT                   1709498..1713280)
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /product="RIKEN cDNA 4632428N05, transcript variant
FT                   mCT8182"
FT                   /note="gene_id=mCG1822.2 transcript_id=mCT8182.2 created on
FT                   01-OCT-2002"
FT   mRNA            join(1687254..1687454,1698193..1698486,1704798..1704905,
FT                   1708362..1708389,1709125..1709321,1709498..1713280)
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /product="RIKEN cDNA 4632428N05, transcript variant
FT                   mCT173969"
FT                   /note="gene_id=mCG1822.2 transcript_id=mCT173969.0 created
FT                   on 01-OCT-2002"
FT   CDS             join(1687373..1687454,1698193..1698618,1699558..1699608,
FT                   1704798..1704905,1708362..1708389,1709125..1709321,
FT                   1709498..1709535)
FT                   /codon_start=1
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /product="RIKEN cDNA 4632428N05, isoform CRA_b"
FT                   /note="gene_id=mCG1822.2 transcript_id=mCT8182.2
FT                   protein_id=mCP1486.2 isoform=CRA_b"
FT                   /db_xref="GOA:A0A171EBK7"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:1921298"
FT                   /db_xref="UniProtKB/TrEMBL:A0A171EBK7"
FT                   /protein_id="EDL32173.1"
FT                   /translation="MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCP
FT                   EGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHL
FT                   KANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKNHHPEQRFYGSM
FT                   ELQVQAGKGSGSTCMASNEQDSDSITAAALATGACIVGILCLPLILLLVYKQRQVASHR
FT                   RAQELVRMDSSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPS
FT                   TPLSPPGPGDVFFPSLDPVPDSPNSEAI"
FT   CDS             join(1687373..1687454,1698193..1698486,1704798..1704905,
FT                   1708362..1708389,1709125..1709321,1709498..1709535)
FT                   /codon_start=1
FT                   /gene="4632428N05Rik"
FT                   /locus_tag="mCG_1822"
FT                   /product="RIKEN cDNA 4632428N05, isoform CRA_a"
FT                   /note="gene_id=mCG1822.2 transcript_id=mCT173969.0
FT                   protein_id=mCP96888.0 isoform=CRA_a"
FT                   /protein_id="EDL32172.1"
FT                   /translation="MGVPAVPEASSPRWGTLLLAIFLAASRGLVAAFKVTTPYSLYVCP
FT                   EGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNFTLQHLQHHGSHL
FT                   KANASHDQPQKHGLELASDHHGITAAALATGACIVGILCLPLILLLVYKQRQVASHRRA
FT                   QELVRMDSSNTQGIENPGFETTPPFQGMPEAKTRPPLSYVAQRQPSESGRYLLSDPSTP
FT                   LSPPGPGDVFFPSLDPVPDSPNSEAI"
FT   assembly_gap    1699011..1699319
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    1725565..1725584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1729799..1729926
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   gene            1740816..1744631
FT                   /locus_tag="mCG_55969"
FT                   /note="gene_id=mCG55969.0"
FT   mRNA            join(1740816..1741109,1744042..1744631)
FT                   /locus_tag="mCG_55969"
FT                   /product="mCG55969"
FT                   /note="gene_id=mCG55969.0 transcript_id=mCT175756.0 created
FT                   on 19-JUN-2003"
FT   CDS             1744047..1744433
FT                   /codon_start=1
FT                   /locus_tag="mCG_55969"
FT                   /product="mCG55969"
FT                   /note="gene_id=mCG55969.0 transcript_id=mCT175756.0
FT                   protein_id=mCP98678.0"
FT                   /db_xref="GOA:G3UW87"
FT                   /db_xref="MGI:MGI:4937089"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW87"
FT                   /protein_id="EDL32171.1"
FT                   /translation="MNTEGSSLLSPPTFLTTPAASGTSTQAADPVPILIALACIFLLLA
FT                   SCLLFMMLCKPTALDPGRRGARECMPHHPVSPSEPRLRLWKRLGSLRRSLHSFRRGRPA
FT                   IQRCPLPDSDDHRGDYDWTEATMM"
FT   assembly_gap    1760070..1760089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1787326..1787622
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    1810686..1810705
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1817840..1817859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1819409..1819428
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1853445..1853464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1899847..1899866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1921767..1921960
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   mRNA            complement(join(1925980..1926195,1939616..1939708,
FT                   1939836..1939883,1940517..1940659,199364