Dbfetch

ID   CH466551; SV 1; linear; genomic DNA; CON; MUS; 23686256 BP.
XX
AC   CH466551;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009748833 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-23686256
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-23686256
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; de5818382f7e1e9abf10421917071bff.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000210.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001403; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007659; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016024; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016252; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016256; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016921; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016933; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017000; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017002; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017004; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017299; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017667; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017733; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017740; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017754; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017760; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017929; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017969; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017999; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018326; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019188; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027460; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027463; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027472; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027478; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027479; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027481; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027489; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027490; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027496; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027510; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027519; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027524; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027540; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027546; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027547; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027551; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027593; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027596; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027597; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027611; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027613; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027618; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027620; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027624; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027628; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027650; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027655; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027656; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027661; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032680; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035268; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035877; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037754; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038180; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038259; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038324; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038369; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038537; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038567; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039463; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039501; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039536; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039725; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039849; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040132; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040154; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040164; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042821; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048087; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050556; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052056; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054455; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056824; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062175; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067578; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067786; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074582; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074656; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074681; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000076434; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078935; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000101523; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016396; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016399; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017443; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017841; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018143; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028969; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029024; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029030; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029179; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029196; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038532; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039007; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040833; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045196; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047815; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048988; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054607; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059524; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063710; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064703; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073873; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075044; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088484; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088976; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099069; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103084; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103135; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103136; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109139; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109175; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109235; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109529; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109577; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109670; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109697; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109701; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109772; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109825; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109859; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109861; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109869; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125366; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164120; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164399; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176066; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190422; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23686256
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(364..>6981)
FT                   /locus_tag="mCG_140679"
FT                   /note="gene_id=mCG140679.0"
FT   mRNA            complement(join(364..519,6897..>6981))
FT                   /locus_tag="mCG_140679"
FT                   /product="mCG140679"
FT                   /note="gene_id=mCG140679.0 transcript_id=mCT170651.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(494..519,6897..>6981))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140679"
FT                   /product="mCG140679"
FT                   /note="gene_id=mCG140679.0 transcript_id=mCT170651.0
FT                   protein_id=mCP93569.0"
FT                   /protein_id="EDL05907.1"
FT                   /translation="VGSAAACSWRTPLDPGAVSSSGLLFQMKSNIECDRI"
FT   assembly_gap    13001..13020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25521..25540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            31204..32563
FT                   /pseudo
FT                   /locus_tag="mCG_118794"
FT                   /note="gene_id=mCG118794.0"
FT   mRNA            31204..32563
FT                   /pseudo
FT                   /locus_tag="mCG_118794"
FT                   /note="gene_id=mCG118794.0 transcript_id=mCT119955.0
FT                   created on 16-JUL-2002"
FT   assembly_gap    35044..40203
FT                   /estimated_length=5160
FT                   /gap_type="unknown"
FT   assembly_gap    41838..42789
FT                   /estimated_length=952
FT                   /gap_type="unknown"
FT   gene            complement(42850..>66583)
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /note="gene_id=mCG118798.0"
FT   mRNA            complement(join(42850..43072,44812..46106,66124..>66583))
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /product="RIKEN cDNA 4921509C19, transcript variant
FT                   mCT119959"
FT                   /note="gene_id=mCG118798.0 transcript_id=mCT119959.0
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(42992..43072,44812..46106,48295..48457))
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /product="RIKEN cDNA 4921509C19, transcript variant
FT                   mCT170652"
FT                   /note="gene_id=mCG118798.0 transcript_id=mCT170652.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(42995..43072,44812..46106,66124..66583))
FT                   /codon_start=1
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /product="RIKEN cDNA 4921509C19, isoform CRA_a"
FT                   /note="gene_id=mCG118798.0 transcript_id=mCT119959.0
FT                   protein_id=mCP73239.0 isoform=CRA_a"
FT                   /protein_id="EDL05908.1"
FT                   /translation="MRPGPGRAQPRRDDCALRPRRDRRADAALRIPQPVRSGPPRGATC
FT                   RSQPADSRKKRALSSSVPVTATNSLNASCRSSAIFAPCTSQTAPADTATARTPGLRSAR
FT                   RSTASSRWAPARRLRPMRCHRKSPPCGKPSRLAPSGGPYVSLTLMAEVEGVVAIDHKPT
FT                   DLSVKMKRWQACQDLRSNTFEDAALTEHYEILTTLGQGTFGEVKLASHLVTQTKVAIKI
FT                   LPKSRKNSLVQPEIEIMKSLDHPHIIKLLHIIDTTRNIFIVLEHAVGGELMSRIEEFGY
FT                   LAEVECHRLFKQLVYALQYCHEKGIVHRDLKPENILLDHRGNVKLTDFGLGTKIIMGQK
FT                   LVTFCGTLPYCAPELFEDRGYDGRATDVWSLGVVLYFMATGCLPFNGYSYEAIKQKIIA
FT                   GKYPRSFSLSPELWEVIAKLLTVNPGERPTVHDIARFKWLKPDNEASPASLGENIESHP
FT                   DPSIMVLMGVMGYNPGEIRESLREKKFDQVMATYLMLKQQSAWENKTTKKPDPRLCDRM
FT                   LRSTEPTIKNQTAVRRASSVPTHSTFSLPNESESLEKGKRTTMSHSMPPTRNCFNEETT
FT                   PLHSICPQLPETEQGECRECPSCAHKQDRVGMNS"
FT   CDS             complement(join(42995..43072,44812..46062))
FT                   /codon_start=1
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /product="RIKEN cDNA 4921509C19, isoform CRA_b"
FT                   /note="gene_id=mCG118798.0 transcript_id=mCT170652.0
FT                   protein_id=mCP93570.0 isoform=CRA_b"
FT                   /protein_id="EDL05909.1"
FT                   /translation="MKRWQACQDLRSNTFEDAALTEHYEILTTLGQGTFGEVKLASHLV
FT                   TQTKVAIKILPKSRKNSLVQPEIEIMKSLDHPHIIKLLHIIDTTRNIFIVLEHAVGGEL
FT                   MSRIEEFGYLAEVECHRLFKQLVYALQYCHEKGIVHRDLKPENILLDHRGNVKLTDFGL
FT                   GTKIIMGQKLVTFCGTLPYCAPELFEDRGYDGRATDVWSLGVVLYFMATGCLPFNGYSY
FT                   EAIKQKIIAGKYPRSFSLSPELWEVIAKLLTVNPGERPTVHDIARFKWLKPDNEASPAS
FT                   LGENIESHPDPSIMVLMGVMGYNPGEIRESLREKKFDQVMATYLMLKQQSAWENKTTKK
FT                   PDPRLCDRMLRSTEPTIKNQTAVRRASSVPTHSTFSLPNESESLEKGKRTTMSHSMPPT
FT                   RNCFNEETTPLHSICPQLPETEQGECRECPSCAHKQDRVGMNS"
FT   assembly_gap    64620..65097
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   gene            <66226..83345
FT                   /locus_tag="mCG_13192"
FT                   /note="gene_id=mCG13192.2"
FT   mRNA            join(<66226..66452,68624..68721,72755..72829,75054..75219,
FT                   76151..76243,77393..77502,78287..78424,81549..81713,
FT                   82947..83344)
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, transcript variant mCT14102"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT14102.1 created
FT                   on 16-JUL-2002"
FT   CDS             join(<66228..66452,68624..68721,72755..72829,75054..75219,
FT                   76151..76243,77393..77502,78287..78424,81549..81713,
FT                   82947..83109)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, isoform CRA_a"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT14102.1
FT                   protein_id=mCP9958.1 isoform=CRA_a"
FT                   /protein_id="EDL05910.1"
FT                   /translation="RSLRAGAQRLDAVERRAERRPGVRAVAVSAGAVWEVHGAKMAEER
FT                   QDALREFVAVTGTEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRG
FT                   TAPSDNRVTSFRDLIHDQDEEEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLF
FT                   KGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGERRRHSGQDVHV
FT                   VLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDE
FT                   DFVKPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQI
FT                   RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEAN
FT                   LLNAVIVQRLT"
FT   mRNA            join(<66351..66452,68624..68721,72755..72829,75054..75463)
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, transcript variant mCT170671"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT170671.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(<66351..66452,68624..68721,72755..72829,75054..75360)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, isoform CRA_c"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT170671.0
FT                   protein_id=mCP93588.0 isoform=CRA_c"
FT                   /protein_id="EDL05912.1"
FT                   /translation="AEERQDALREFVAVTGTEEDRARFFLESAGWDLQIALASFYEDGG
FT                   DEDIVTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDEEEEEEEGQRFYAGGSERSGQQ
FT                   IVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRVSIRVVVAKRIEFHSG
FT                   EGSLLLSSRDWLLCFFTWLFVLLCRRLMCL"
FT   mRNA            join(<74364..74500,75054..75219,76151..76243,77393..77502,
FT                   78287..78424,81549..81713,82947..83345)
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, transcript variant mCT170670"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT170670.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(<74391..74500,75054..75219,76151..76243,77393..77502,
FT                   78287..78424,81549..81713,82947..83109)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, isoform CRA_b"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT170670.0
FT                   protein_id=mCP93589.0 isoform=CRA_b"
FT                   /protein_id="EDL05911.1"
FT                   /translation="VLGELWCGVSQPHTYIALLALLHTSADLNLDSDLRSRFYAGGSER
FT                   SGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAA
FT                   PEEESAYVAGERRRHSGQDVHVVLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVP
FT                   AELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAE
FT                   NEAKASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSF
FT                   VLMTTFPNKELADENQTLKEANLLNAVIVQRLT"
FT   assembly_gap    104455..104504
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    108291..108409
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   gene            114635..133744
FT                   /locus_tag="mCG_13187"
FT                   /note="gene_id=mCG13187.2"
FT   mRNA            join(114635..114816,114890..114937,129499..129611,
FT                   131511..131673,132675..133744)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT14097"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT14097.2 created
FT                   on 16-JUL-2002"
FT   mRNA            join(114670..114816,114890..114937,129499..129611,
FT                   131511..131669,132675..132987)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT170666"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170666.0 created
FT                   on 16-JUL-2002"
FT   mRNA            join(114727..114816,114890..114937,129499..129611,
FT                   131511..131845)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT170663"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170663.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(114780..114816,114890..114937,129499..129611,
FT                   131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_a"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT14097.2
FT                   protein_id=mCP9969.1 isoform=CRA_a"
FT                   /protein_id="EDL05913.1"
FT                   /translation="MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNK
FT                   PFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVEL
FT                   LKLE"
FT   CDS             join(114780..114816,114890..114937,129499..129611,
FT                   131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_a"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170663.0
FT                   protein_id=mCP93583.0 isoform=CRA_a"
FT                   /protein_id="EDL05914.1"
FT                   /translation="MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNK
FT                   PFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVEL
FT                   LKLE"
FT   CDS             join(114780..114816,114890..114937,129499..129611,
FT                   131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_a"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170666.0
FT                   protein_id=mCP93584.0 isoform=CRA_a"
FT                   /protein_id="EDL05917.1"
FT                   /translation="MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNK
FT                   PFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVEL
FT                   LKLE"
FT   assembly_gap    115784..115883
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   mRNA            join(116225..116253,129499..129611,131511..131673,
FT                   132675..132881)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT170665"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170665.0 created
FT                   on 16-JUL-2002"
FT   mRNA            join(117561..117628,129499..129611,131511..131673,
FT                   132675..133235)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT170664"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170664.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(129501..129611,131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_b"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170665.0
FT                   protein_id=mCP93582.0 isoform=CRA_b"
FT                   /protein_id="EDL05915.1"
FT                   /translation="MLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAK
FT                   LIISSDYAYGATGHPGIIPPHATLVFDVELLKLE"
FT   CDS             join(129501..129611,131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_b"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170664.0
FT                   protein_id=mCP93581.0 isoform=CRA_b"
FT                   /protein_id="EDL05916.1"
FT                   /translation="MLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAK
FT                   LIISSDYAYGATGHPGIIPPHATLVFDVELLKLE"
FT   assembly_gap    131424..131443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    143270..143537
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   gene            <144632..161880
FT                   /gene="Sdcbp2"
FT                   /locus_tag="mCG_140682"
FT                   /note="gene_id=mCG140682.0"
FT   mRNA            join(<144632..144680,154607..154679,155848..155917,
FT                   156723..156823,158207..158365,158947..159122,
FT                   159202..159373,161085..161176,161413..161880)
FT                   /gene="Sdcbp2"
FT                   /locus_tag="mCG_140682"
FT                   /product="syndecan binding protein (syntenin) 2"
FT                   /note="gene_id=mCG140682.0 transcript_id=mCT170667.0
FT                   created on 16-JUL-2002"
FT   CDS             join(<144634..144680,154607..154679,155848..155917,
FT                   156723..156823,158207..158365,158947..159122,
FT                   159202..159373,161085..161176,161413..161467)
FT                   /codon_start=1
FT                   /gene="Sdcbp2"
FT                   /locus_tag="mCG_140682"
FT                   /product="syndecan binding protein (syntenin) 2"
FT                   /note="gene_id=mCG140682.0 transcript_id=mCT170667.0
FT                   protein_id=mCP93585.0"
FT                   /protein_id="EDL05918.1"
FT                   /translation="RRLQWLEKRTACGASSVFPEAAMSVLYPSLEDLKVGQVIQAQGRA
FT                   SPTMPTLPAPMASAPPLSELYPNLAELESYMGLSLSSQEVQKNLTQIPDSDNMVVTSPG
FT                   PGQVVAPVSGNNLGILRAEIKPGVREIHLCKDERGKTGLRLQAVDKGLFVQLVQANTPA
FT                   SLVGLRFGDQILQIDGCDCAGWNTHKAHKVLKKASAEKIVMVIRDRPFQRTVTMHKDSS
FT                   GQVGFSIKKGKIVSVVKGSSAARNGLLTNHYVCEVNGQNVIGLKDKKVTEILTTAGDVI
FT                   TLTIIPTVIYEHMIKRLSPLLLHHTMDHSIPDT"
FT   assembly_gap    151011..151179
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    157991..158010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(162437..>204357)
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /note="gene_id=mCG13188.3"
FT   mRNA            complement(join(162437..166479,168989..169138,
FT                   172858..172954,203931..204037,204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT170669"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT170669.1 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(162437..166479,168989..169138,
FT                   172137..172244,172858..172954,203931..204037,
FT                   204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT14098"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT14098.3 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(162437..166479,168989..169138,
FT                   172137..172343,172858..172954,203931..204037,
FT                   204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT178301"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT178301.1 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(162442..166479,168989..169138,
FT                   172137..172244,172858..172954,173478..173511,
FT                   174261..174288,203931..204037,204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT170668"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT170668.1 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(165300..166479,168989..169138,
FT                   172858..172954,203931..204037,204239..>204357))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_d"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT170669.1
FT                   protein_id=mCP93587.1 isoform=CRA_d"
FT                   /protein_id="EDL05922.1"
FT                   /translation="PLPPRSPSPSKHPLATFSWGSGEQSGCPPGGSPNHGSLRRLLITA
FT                   RRLLQRLQRRCAKRRGSRASRPDCGGRVDPAPGTPPIPPLTRTRSLMAMSLQGSRRASA
FT                   GSRRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEID
FT                   DLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIRQLKQVIDTVKNNLIDKDKGLQKYF
FT                   VDINIQNKKLETLLHSMEVAQNGVAKEEGTGESAGGSPARSLTRSSTYTKLSDPAVCGD
FT                   RQPGDPSNTSAEDGADSGYVAADDTLSRTDALEASSLLSSGVDCGLEEASLHSSFNLGP
FT                   RFPASNTYEKLLCGMEAGVQVSCMQERAIQTDFVQYQPDLNTILEKVGQAQVCGSVLKD
FT                   RHSELDPHPSGPRDPDSAVVVTVGDELEAPEPITCGPATHRPAVNSNPGLPVSVVCPVE
FT                   EEEEEAAAATTTEKEPKSYWSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSL
FT                   LRGCCTVALHSIRRISCRSLGQPSSSTAGGSQL"
FT   CDS             complement(join(165300..166479,168989..169138,
FT                   172137..172244,172858..172954,203931..204037,
FT                   204239..>204357))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_e"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT14098.3
FT                   protein_id=mCP9955.2 isoform=CRA_e"
FT                   /protein_id="EDL05923.1"
FT                   /translation="PLPPRSPSPSKHPLATFSWGSGEQSGCPPGGSPNHGSLRRLLITA
FT                   RRLLQRLQRRCAKRRGSRASRPDCGGRVDPAPGTPPIPPLTRTRSLMAMSLQGSRRASA
FT                   GSRRRTSPPVSVRDAYGTSSLSSSSNSGSCKGSDSSPTPRRSMKYTLCSDNHGIKPPTP
FT                   EQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEA
FT                   QLALKEARKEIRQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNG
FT                   VAKEEGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSNTSAEDGADSGYVAAD
FT                   DTLSRTDALEASSLLSSGVDCGLEEASLHSSFNLGPRFPASNTYEKLLCGMEAGVQVSC
FT                   MQERAIQTDFVQYQPDLNTILEKVGQAQVCGSVLKDRHSELDPHPSGPRDPDSAVVVTV
FT                   GDELEAPEPITCGPATHRPAVNSNPGLPVSVVCPVEEEEEEAAAATTTEKEPKSYWSRH
FT                   YIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVALHSIRRISCRSLGQP
FT                   SSSTAGGSQL"
FT   CDS             complement(join(165300..166479,168989..169138,
FT                   172137..172343,172858..172954,203931..204037,
FT                   204239..>204357))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_b"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT178301.1
FT                   protein_id=mCP101223.1 isoform=CRA_b"
FT                   /protein_id="EDL05920.1"
FT                   /translation="PLPPRSPSPSKHPLATFSWGSGEQSGCPPGGSPNHGSLRRLLITA
FT                   RRLLQRLQRRCAKRRGSRASRPDCGGRVDPAPGTPPIPPLTRTRSLMAMSLQGSRRASA
FT                   GSRSGGTLGRSGLAVFAQCPQVPASQNEQRPLLPASRRTSPPVSVRDAYGTSSLSSSSN
FT                   SGSCKGSDSSPTPRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQD
FT                   RLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIRQLKQVIDTVKNNLI
FT                   DKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGVAKEEGTGESAGGSPARSLTRSSTYT
FT                   KLSDPAVCGDRQPGDPSNTSAEDGADSGYVAADDTLSRTDALEASSLLSSGVDCGLEEA
FT                   SLHSSFNLGPRFPASNTYEKLLCGMEAGVQVSCMQERAIQTDFVQYQPDLNTILEKVGQ
FT                   AQVCGSVLKDRHSELDPHPSGPRDPDSAVVVTVGDELEAPEPITCGPATHRPAVNSNPG
FT                   LPVSVVCPVEEEEEEAAAATTTEKEPKSYWSRHYIVDLLAVVVPAVPTVAWLCRSQRRQ
FT                   GQPIYNISSLLRGCCTVALHSIRRISCRSLGQPSSSTAGGSQL"
FT   CDS             complement(join(165300..166479,168989..169138,
FT                   172137..172244,172858..172954,173478..173511,
FT                   174261..174288,203931..204037,204239..>204355))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_a"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT170668.1
FT                   protein_id=mCP93586.1 isoform=CRA_a"
FT                   /protein_id="EDL05919.1"
FT                   /translation="SPSPQPQPQQAPASHLQLGLGRAIRLPSWGQPKPWKPSQVADHRQ
FT                   AAAAATAEALRQAARESCEPAGLRRASGPRAVGRNQWRDPGSPEPRANWEAPGTPPIPP
FT                   LTRTRSLMAMSLQGSRRASAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSCKGSDSSPTP
FT                   RRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLK
FT                   TQLSRMQEDWIEEECHRVEAQLALKEARKEIRQLKQVIDTVKNNLIDKDKGLQKYFVDI
FT                   NIQNKKLETLLHSMEVAQNGVAKEEGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQP
FT                   GDPSNTSAEDGADSGYVAADDTLSRTDALEASSLLSSGVDCGLEEASLHSSFNLGPRFP
FT                   ASNTYEKLLCGMEAGVQVSCMQERAIQTDFVQYQPDLNTILEKVGQAQVCGSVLKDRHS
FT                   ELDPHPSGPRDPDSAVVVTVGDELEAPEPITCGPATHRPAVNSNPGLPVSVVCPVEEEE
FT                   EEAAAATTTEKEPKSYWSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRG
FT                   CCTVALHSIRRISCRSLGQPSSSTAGGSQL"
FT   assembly_gap    190372..190391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(193045..194792,203931..204037,
FT                   204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT185861"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT185861.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(194725..194792,203931..204037,
FT                   204239..>204357))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_c"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT185861.0
FT                   protein_id=mCP107119.0 isoform=CRA_c"
FT                   /protein_id="EDL05921.1"
FT                   /translation="PLPPRSPSPSKHPLATFSWGSGEQSGCPPGGSPNHGSLRRLLITA
FT                   RRLLQRLQRRCAKRRGSRASRPDCGGRVDPEETCAHPFFTPQLSPGLIKGSS"
FT   assembly_gap    212363..212634
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   gene            complement(<217186..>240352)
FT                   /locus_tag="mCG_13186"
FT                   /note="gene_id=mCG13186.2"
FT   mRNA            complement(join(<217186..217374,225250..225374,
FT                   226393..226489,226903..227129,239723..239854,
FT                   240209..>240352))
FT                   /locus_tag="mCG_13186"
FT                   /product="mCG13186"
FT                   /note="gene_id=mCG13186.2 transcript_id=mCT14096.2 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(217186..217374,225250..225374,
FT                   226393..226489,226903..227129,239723..>239747))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13186"
FT                   /product="mCG13186"
FT                   /note="gene_id=mCG13186.2 transcript_id=mCT14096.2
FT                   protein_id=mCP9952.2"
FT                   /protein_id="EDL05924.1"
FT                   /translation="DEDDISPRYIADRRRRKKRRLLVDPVKEISSKAMHRQLASFMDTL
FT                   MVLDLAPPTQRLMMWKKRGGVDMLLSTATQDLINDELKMLFTKCFLSSDYKLAKLTLKE
FT                   SVRKEVGNQQIAEPSVMGEPNSHSELDQPQDWKDVTDESVGSFQENVNMNVNSEEFNKM
FT                   GMQSFSLKKLCRNSDRKQAAAKFYTLLILKKHRAIELSQSVPYADIIATVGPMFYKM"
FT   assembly_gap    231703..231722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(252394..>257938)
FT                   /locus_tag="mCG_140681"
FT                   /note="gene_id=mCG140681.0"
FT   mRNA            complement(join(252394..252893,257783..>257938))
FT                   /locus_tag="mCG_140681"
FT                   /product="mCG140681"
FT                   /note="gene_id=mCG140681.0 transcript_id=mCT170662.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(252663..252893,257783..>257917))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140681"
FT                   /product="mCG140681"
FT                   /note="gene_id=mCG140681.0 transcript_id=mCT170662.0
FT                   protein_id=mCP93580.0"
FT                   /protein_id="EDL05925.1"
FT                   /translation="LYKSKVPRACNQVIAKDSIKDTEMEMPGEPAASLGQTLEWLREEL
FT                   AEMQIQDQKLLLTLRHLHSLLEELRAESTHWQDTRPSRNTSPFRARLGSEGRACQPVPR
FT                   QLTELLRGEKSRRSSLP"
FT   assembly_gap    268934..269477
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    270664..270683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <273556..283704
FT                   /locus_tag="mCG_50094"
FT                   /note="gene_id=mCG50094.2"
FT   mRNA            join(<273556..273994,277871..278861)
FT                   /locus_tag="mCG_50094"
FT                   /product="mCG50094, transcript variant mCT50277"
FT                   /note="gene_id=mCG50094.2 transcript_id=mCT50277.2 created
FT                   on 16-JUL-2002"
FT   CDS             join(<273856..273994,277871..278610)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50094"
FT                   /product="mCG50094, isoform CRA_b"
FT                   /note="gene_id=mCG50094.2 transcript_id=mCT50277.2
FT                   protein_id=mCP32039.2 isoform=CRA_b"
FT                   /protein_id="EDL05927.1"
FT                   /translation="LSRRPRPPRAELDRRRSRILRSRPALSLPSRSPPAADAVQPGAAR
FT                   AAAKGPRDELGSFFPMASPPGLELKTLSNGPQVPRRAASQGPVAPPRMGVENACFFSEE
FT                   QETHFQNPGDARLGNAPSPPGGVPSLSRSQRDDLSLHSEEGPGLEPVSRPVDYGFVSAL
FT                   VFLVSGILLVVTAYAIPREARVNPDTVTAREMERLEMYYARLGSHLDKCIIAGLGLLTV
FT                   GGMLLSVLLMVSLCKGELYRRQTFVPGRGSRKTYGSINLRMRQLTGDGGQVLVENEVVQ
FT                   VSETSYTTQGS"
FT   mRNA            join(<278512..278610,283179..283704)
FT                   /locus_tag="mCG_50094"
FT                   /product="mCG50094, transcript variant mCT170672"
FT                   /note="gene_id=mCG50094.2 transcript_id=mCT170672.0 created
FT                   on 16-JUL-2002"
FT   assembly_gap    281497..281724
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   CDS             <283361..283567
FT                   /codon_start=1
FT                   /locus_tag="mCG_50094"
FT                   /product="mCG50094, isoform CRA_a"
FT                   /note="gene_id=mCG50094.2 transcript_id=mCT170672.0
FT                   protein_id=mCP93590.0 isoform=CRA_a"
FT                   /protein_id="EDL05926.1"
FT                   /translation="SPGLKGKQKMKRDSPILLAQRNRDGKRRQLPCQPLPGRCGIWVSP
FT                   DARASDIQQTLSPLLSFLLTSFT"
FT   gene            complement(287359..>315657)
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /note="gene_id=mCG13177.1"
FT   mRNA            complement(join(287359..290230,291030..291188,
FT                   292368..292421,301036..301221,305767..305849,
FT                   307023..307175,312560..312703,315552..>315657))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT11752"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT11752.2 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(289546..290230,291030..291188,
FT                   292368..292896,295347..>295436))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT170658"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170658.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(289685..>290161)
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170658.0
FT                   protein_id=mCP93574.0 isoform=CRA_c"
FT                   /protein_id="EDL05930.1"
FT                   /translation="QLSLPFTLQELPPLAPSASVFLWAWGRGFCPCVCRPAGVASPALV
FT                   RAEVPAAAPHQAAYRSHGEISVSQSPAPPHLQGRLRQHQPSTRCSRGHSAIRTERILDV
FT                   IIKNQMSIQNTCCQSSTLLFVNAQTLKSVILHRTTGFLQGILLKHPRVTSYSCS"
FT   mRNA            complement(join(289802..290230,291030..291188,
FT                   292368..292421,301036..301221,305767..305849,
FT                   307023..307175,312560..312806))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT173573"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT173573.0 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(290129..290230,291030..291188,
FT                   292368..292421,301036..>301437))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT170656"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170656.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(290179..290230,291030..291188,
FT                   292368..292421,301036..301221,305767..305849,
FT                   307023..307175,312560..312703,315552..>315650))
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT11752.2
FT                   protein_id=mCP9963.2 isoform=CRA_a"
FT                   /protein_id="EDL05928.1"
FT                   /translation="SGAPGRPGKPLPPAPCLSFSQNSQGQLGPLLMKKPQTSMAGLEVL
FT                   FASAAPSMSCPQDALVCFLHWEVVTNGYYALGTGDQPGPSDKKSELLPAKWNSNKELYA
FT                   LRYESKDGARKLLLKAVSVENGMIINVLELGTQQVADLTLNLDDYIDAEDLSDFHRTYK
FT                   NSEELRSQIRSGIITPIHEQWEKARANSPPREFPPATAREVDPLQISSHRPHTSRQPAW
FT                   RDPLSPFAVGGDDLDPFGCQRGGMIVDPLRSGFPRVLIDPSSGLPNRLPPGAVPPGARF
FT                   DPFGPIGTSPSGPNPDHLPPPGYDDMYL"
FT   CDS             complement(join(290179..290230,291030..291188,
FT                   292368..292421,301036..301221,305767..305849,
FT                   307023..307175,312560..312688))
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_e"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT173573.0
FT                   protein_id=mCP96492.0 isoform=CRA_e"
FT                   /db_xref="GOA:A2AU35"
FT                   /db_xref="InterPro:IPR013886"
FT                   /db_xref="InterPro:IPR021625"
FT                   /db_xref="MGI:MGI:1346072"
FT                   /db_xref="UniProtKB/TrEMBL:A2AU35"
FT                   /protein_id="EDL05932.1"
FT                   /translation="MAGLEVLFASAAPSMSCPQDALVCFLHWEVVTNGYYALGTGDQPG
FT                   PSDKKSELLPAKWNSNKELYALRYESKDGARKLLLKAVSVENGMIINVLELGTQQVADL
FT                   TLNLDDYIDAEDLSDFHRTYKNSEELRSQIRSGIITPIHEQWEKARANSPPREFPPATA
FT                   REVDPLQISSHRPHTSRQPAWRDPLSPFAVGGDDLDPFGCQRGGMIVDPLRSGFPRVLI
FT                   DPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL"
FT   CDS             complement(join(290179..290230,291030..291188,
FT                   292368..292421,301036..>301436))
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170656.0
FT                   protein_id=mCP93576.0 isoform=CRA_d"
FT                   /protein_id="EDL05931.1"
FT                   /translation="PKKLRPKSRRQHQAVAPLTQVRRTARSHHSKQAKRKTKAAQGRRR
FT                   RRPSHQNTVHETPSQLQEANFLSQSCRTYKNSEELRSQIRSGIITPIHEQWEKARANSP
FT                   PREFPPATAREVDPLQISSHRPHTSRQPAWRDPLSPFAVGGDDLDPFGCQRGGMIVDPL
FT                   RSGFPRVLIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL"
FT   mRNA            complement(join(291027..291188,292368..292421,
FT                   301036..301221,312560..>312845))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT170657"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170657.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(292408..292421,301036..301221,
FT                   312560..>312845))
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170657.0
FT                   protein_id=mCP93575.0 isoform=CRA_b"
FT                   /protein_id="EDL05929.1"
FT                   /translation="RVSTFPRRCGQSRKRRRHQKASLPLAVPLLLGGAAFCIVPSFSSF
FT                   PTEAANIHGGSRGSLRVGRSIHELPAGRTRLLPALGSGDKRLLCLGHGRPGPIRTVRSF
FT                   GLRSDLELSHLSMSSGRRLVQTVLRGSSHLPLPERWTHSRFPHTVLILAGSLLGVIP"
FT   assembly_gap    317896..318958
FT                   /estimated_length=1063
FT                   /gap_type="unknown"
FT   gene            complement(319383..>323269)
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /note="gene_id=mCG140674.0"
FT   mRNA            complement(join(319383..320629,321541..321779,
FT                   323081..>323238))
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, transcript variant
FT                   mCT170644"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170644.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(319890..>320204)
FT                   /codon_start=1
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, isoform CRA_a"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170644.0
FT                   protein_id=mCP93562.0 isoform=CRA_a"
FT                   /protein_id="EDL05933.1"
FT                   /translation="GGVLHACTYFSVPVLGSSLFLALPEVPPTDAFKIAHSIWIFPALT
FT                   SEFRGGFPQTRTNAVRGMDLECLLVIHTIRCLPRDINRAGSHLRKEGLFCLCFLGKEWR
FT                   "
FT   mRNA            complement(join(<319938..320629,321541..321779,
FT                   323167..>323269))
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, transcript variant
FT                   mCT170646"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170646.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(<319938..>320204)
FT                   /codon_start=1
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, isoform CRA_b"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170646.0
FT                   protein_id=mCP93563.0 isoform=CRA_b"
FT                   /protein_id="EDL05934.1"
FT                   /translation="GGVLHACTYFSVPVLGSSLFLALPEVPPTDAFKIAHSIWIFPALT
FT                   SEFRGGFPQTRTNAVRGMDLECLLVIHTIRCLPRDINRAGSHLR"
FT   mRNA            complement(join(320088..320629,321541..321779,
FT                   323103..>323231))
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, transcript variant
FT                   mCT170645"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170645.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(321674..321779,323103..>323230))
FT                   /codon_start=1
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, isoform CRA_c"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170645.0
FT                   protein_id=mCP93564.0 isoform=CRA_c"
FT                   /protein_id="EDL05935.1"
FT                   /translation="TKILRGEKLRRRFRQEEPSERGSKPTEPPRKDILQAVELPPAVVQ
FT                   PGWPCLPPCKQDGNYGGAGWSGVHVLTSRSHP"
FT   assembly_gap    334388..334469
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    339636..340210
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   assembly_gap    347913..348281
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    387750..387978
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    397722..398000
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   gene            <401355..404372
FT                   /locus_tag="mCG_140675"
FT                   /note="gene_id=mCG140675.0"
FT   mRNA            join(<401355..401517,403973..404372)
FT                   /locus_tag="mCG_140675"
FT                   /product="mCG140675"
FT                   /note="gene_id=mCG140675.0 transcript_id=mCT170647.0
FT                   created on 17-JUL-2002"
FT   CDS             join(<401425..401517,403973..404047)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140675"
FT                   /product="mCG140675"
FT                   /note="gene_id=mCG140675.0 transcript_id=mCT170647.0
FT                   protein_id=mCP93565.0"
FT                   /protein_id="EDL05936.1"
FT                   /translation="WSLESGTADHMKMVAVLLGGTGSIIMSTDQLPRSSWTPSLTSASL
FT                   CDSECWVVSE"
FT   gene            <415211..446027
FT                   /gene="Rspo4"
FT                   /locus_tag="mCG_13178"
FT                   /note="gene_id=mCG13178.1"
FT   mRNA            join(<415211..415438,440308..440496,441123..441263,
FT                   442321..442506,445591..446027)
FT                   /gene="Rspo4"
FT                   /locus_tag="mCG_13178"
FT                   /product="R-spondin family, member 4"
FT                   /note="gene_id=mCG13178.1 transcript_id=mCT11755.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(<415213..415438,440308..440496,441123..441263,
FT                   442321..442506,445591..445682)
FT                   /codon_start=1
FT                   /gene="Rspo4"
FT                   /locus_tag="mCG_13178"
FT                   /product="R-spondin family, member 4"
FT                   /note="gene_id=mCG13178.1 transcript_id=mCT11755.2
FT                   protein_id=mCP9959.2"
FT                   /protein_id="EDL05937.1"
FT                   /translation="TRPTAPWAHRRVPGGRSDQRPADAQRAPQAVPRTEAAGPSGSQEH
FT                   QAAQMRAPLCLLLLLAHAVDMLALYRRKKQAGTGLGGNCTGCVICSEENGCSTCQQRLF
FT                   LFIRREGIRQYGKCVHDCPLGFFGIRGQEANRCKKCGATCESCFSQDFCIRCKRRFHLY
FT                   KGKCLPSCPPGTLTHQSTRECQEECEPSPWGSWSPCIHNGKTCGSGWGLETRVREAGPA
FT                   KQEETASCRVLSESRKCPIKRLCPGERNPRQKNRKDRRQRKDRKLERRPHQRGSQ"
FT   assembly_gap    420316..420607
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   gene            complement(437629..>439269)
FT                   /locus_tag="mCG_140680"
FT                   /note="gene_id=mCG140680.1"
FT   mRNA            complement(join(437629..438714,439080..>439269))
FT                   /locus_tag="mCG_140680"
FT                   /product="mCG140680"
FT                   /note="gene_id=mCG140680.1 transcript_id=mCT170659.1
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(438502..438714,439080..>439259))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140680"
FT                   /product="mCG140680"
FT                   /note="gene_id=mCG140680.1 transcript_id=mCT170659.1
FT                   protein_id=mCP93577.1"
FT                   /protein_id="EDL05938.1"
FT                   /translation="DKTTEVAQNCSMFTSHQAGILNELVAHPGPPEPMAPHRRTFLDLQ
FT                   LLSFPMCIFPTEVPLENDMQWDRREKTWCLRKCEAMRAAPRLERASHITTARQSPLSHS
FT                   PSKTCSVQITPRTDRNERKAFLLLGV"
FT   assembly_gap    440178..440254
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    454375..459476
FT                   /estimated_length=5102
FT                   /gap_type="unknown"
FT   gene            complement(461559..>467272)
FT                   /locus_tag="mCG_140676"
FT                   /note="gene_id=mCG140676.0"
FT   mRNA            complement(join(461559..462214,467209..>467272))
FT                   /locus_tag="mCG_140676"
FT                   /product="mCG140676"
FT                   /note="gene_id=mCG140676.0 transcript_id=mCT170648.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(461994..462214,467209..>467236))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140676"
FT                   /product="mCG140676"
FT                   /note="gene_id=mCG140676.0 transcript_id=mCT170648.0
FT                   protein_id=mCP93566.0 partial"
FT                   /protein_id="EDL05939.1"
FT                   /translation="TIVGNWAADCMGXXXXXXXRKRKLRKEDRLTTTSPHTQEDLEEES
FT                   QDLRRKPKARQFLDLKQEKICRDFWSSQEVLDKTQKL"
FT   assembly_gap    462188..462207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            481329..515345
FT                   /gene="Angpt4"
FT                   /locus_tag="mCG_13185"
FT                   /note="gene_id=mCG13185.2"
FT   mRNA            join(481329..481786,495317..495472,496994..497115,
FT                   499310..499548,504414..504529,506676..506777,
FT                   508914..509080,513313..513443,514503..515345)
FT                   /gene="Angpt4"
FT                   /locus_tag="mCG_13185"
FT                   /product="angiopoietin 4"
FT                   /note="gene_id=mCG13185.2 transcript_id=mCT14095.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(481451..481786,495317..495472,496994..497115,
FT                   499310..499548,504414..504529,506676..506777,
FT                   508914..509080,513313..513443,514503..514663)
FT                   /codon_start=1
FT                   /gene="Angpt4"
FT                   /locus_tag="mCG_13185"
FT                   /product="angiopoietin 4"
FT                   /note="gene_id=mCG13185.2 transcript_id=mCT14095.1
FT                   protein_id=mCP9968.0"
FT                   /db_xref="GOA:Q3V0P7"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="InterPro:IPR020837"
FT                   /db_xref="InterPro:IPR028845"
FT                   /db_xref="MGI:MGI:1336887"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0P7"
FT                   /protein_id="EDL05940.1"
FT                   /translation="MLCQPAMLLDGLLLLATMAAAQHRGPEAGGHRQIHQVRRGQCSYT
FT                   FVVPEPDICQLAPTAAPEALGGSNSLQRDLPASRLHLTDWRAQRAQRAQRVSQLEKILE
FT                   NNTQWLLKLEQSIKVNLRSHLVQAQQDTIQNQTTTMLALGANLMNQTKAQTHKLTAVEA
FT                   QVLNQTLHMKTQMLENSLSTNKLERQMLMQSRELQRLQGRNRALETRLQALEAQHQAQL
FT                   NSLQEKREQLHSLLGHQTGTLANLKHNLHALSSNSSSLQQQQQQLTEFVQRLVRIVAQD
FT                   QHPVSLKTPKPVFQDCAEIKRSGVNTSGVYTIYETNMTKPLKVFCDMETDGGGWTLIQH
FT                   REDGSVNFQRTWEEYKEGFGNVAREHWLGNEAVHRLTSRTAYLLRVELHDWEGRQTSIQ
FT                   YENFQLGSERQRYSLSVNDSSSSAGRKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGW
FT                   WFDACGLSNLNGIYYSVHQHLHKINGIRWHYFRGPSYSLHGTRMMLRPMGA"
FT   assembly_gap    489896..491915
FT                   /estimated_length=2020
FT                   /gap_type="unknown"
FT   assembly_gap    502588..502823
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    515615..515754
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    520680..522258
FT                   /estimated_length=1579
FT                   /gap_type="unknown"
FT   assembly_gap    532217..532849
FT                   /estimated_length=633
FT                   /gap_type="unknown"
FT   gene            complement(539771..>550671)
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /note="gene_id=mCG13175.1"
FT   mRNA            complement(join(539771..541298,550367..>550671))
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, transcript variant
FT                   mCT11751"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT11751.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(539774..541298,544277..>544340))
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, transcript variant
FT                   mCT170655"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170655.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(539774..541298,543984..>544309))
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, transcript variant
FT                   mCT170654"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170654.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(539774..541298,543673..>543768))
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, transcript variant
FT                   mCT170653"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170653.1 created
FT                   on 20-JUN-2003"
FT   CDS             complement(join(540332..541298,550367..>550671))
FT                   /codon_start=1
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, isoform CRA_c"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT11751.1
FT                   protein_id=mCP9961.1 isoform=CRA_c"
FT                   /protein_id="EDL05943.1"
FT                   /translation="LLHLRLLMLPGNPGGAPFERKRRANQEVRGEPLQQRGRRAHFPFL
FT                   WGPRDVLPEGIVGQPGRPTRKSSPVFTRSSLLRSAGTTSCQPRQPARSGIPLDVGCSGA
FT                   RYPAANFVPVSVFSPLPSGYVTAMPVDTLSPGAPATPALPFRLRTKVPGYLLPRPADGG
FT                   ARKPSAVERLEADKAKYVKSLRVANTRQEPVQPPLVRQPLFSPGPRGPVLTPSRRVLPC
FT                   SGRRPQLDLDILSSLINLCDSPVSPSEASRTPGRPEGSAHKVPPATPPRPPPSTVAVRR
FT                   VDVRPLPASPARPYPSPGTTTTSSPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLD
FT                   PEEARGLGVAHLARASSDIVSLAGPSAGPCSSEGGCSRRSSATVEERSLDRVPYGVSVI
FT                   ERNARVIKWLYGLRQARDPPTTEG"
FT   CDS             complement(join(540332..541298,544277..>544338))
FT                   /codon_start=1
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, isoform CRA_b"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170655.1
FT                   protein_id=mCP93573.0 isoform=CRA_b"
FT                   /protein_id="EDL05942.1"
FT                   /translation="YLSQVGGRRAGCWKEAACTASGARYPAANFVPVSVFSPLPSGYVT
FT                   AMPVDTLSPGAPATPALPFRLRTKVPGYLLPRPADGGARKPSAVERLEADKAKYVKSLR
FT                   VANTRQEPVQPPLVRQPLFSPGPRGPVLTPSRRVLPCSGRRPQLDLDILSSLINLCDSP
FT                   VSPSEASRTPGRPEGSAHKVPPATPPRPPPSTVAVRRVDVRPLPASPARPYPSPGTTTT
FT                   SSPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLARASSDIVSL
FT                   AGPSAGPCSSEGGCSRRSSATVEERSLDRVPYGVSVIERNARVIKWLYGLRQARDPPTT
FT                   EG"
FT   CDS             complement(join(540332..541298,543984..>544252))
FT                   /codon_start=1
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, isoform CRA_d"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170654.1
FT                   protein_id=mCP93571.0 isoform=CRA_d"
FT                   /protein_id="EDL05944.1"
FT                   /translation="GAHQGLSLQSLHSSRGPTPAQRGTADGGGHTAFAQPKPHRLSLQD
FT                   CLQVRTTRNKTRGFPGVLLIYLLLGSLKGGTKSGYGTGIDQKGSSGARYPAANFVPVSV
FT                   FSPLPSGYVTAMPVDTLSPGAPATPALPFRLRTKVPGYLLPRPADGGARKPSAVERLEA
FT                   DKAKYVKSLRVANTRQEPVQPPLVRQPLFSPGPRGPVLTPSRRVLPCSGRRPQLDLDIL
FT                   SSLINLCDSPVSPSEASRTPGRPEGSAHKVPPATPPRPPPSTVAVRRVDVRPLPASPAR
FT                   PYPSPGTTTTSSPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHL
FT                   ARASSDIVSLAGPSAGPCSSEGGCSRRSSATVEERSLDRVPYGVSVIERNARVIKWLYG
FT                   LRQARDPPTTEG"
FT   CDS             complement(join(540332..541298,543673..>543710))
FT                   /codon_start=1
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, isoform CRA_a"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170653.1
FT                   protein_id=mCP93572.0 isoform=CRA_a"
FT                   /protein_id="EDL05941.1"
FT                   /translation="QCVWFPERCPFSSGARYPAANFVPVSVFSPLPSGYVTAMPVDTLS
FT                   PGAPATPALPFRLRTKVPGYLLPRPADGGARKPSAVERLEADKAKYVKSLRVANTRQEP
FT                   VQPPLVRQPLFSPGPRGPVLTPSRRVLPCSGRRPQLDLDILSSLINLCDSPVSPSEASR
FT                   TPGRPEGSAHKVPPATPPRPPPSTVAVRRVDVRPLPASPARPYPSPGTTTTSSPGRPPG
FT                   LQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLARASSDIVSLAGPSAGPC
FT                   SSEGGCSRRSSATVEERSLDRVPYGVSVIERNARVIKWLYGLRQARDPPTTEG"
FT   assembly_gap    552876..552900
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    560037..561900
FT                   /estimated_length=1864
FT                   /gap_type="unknown"
FT   gene            566989..579704
FT                   /gene="2310046K01Rik"
FT                   /locus_tag="mCG_13176"
FT                   /note="gene_id=mCG13176.1"
FT   mRNA            join(566989..567107,574504..575130,575984..576471,
FT                   577930..578053,578395..579704)
FT                   /gene="2310046K01Rik"
FT                   /locus_tag="mCG_13176"
FT                   /product="RIKEN cDNA 2310046K01"
FT                   /note="gene_id=mCG13176.1 transcript_id=mCT11754.1 created
FT                   on 17-JUL-2002"
FT   assembly_gap    569862..569881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(574573..575130,575984..576471,577930..578053,
FT                   578395..578607)
FT                   /codon_start=1
FT                   /gene="2310046K01Rik"
FT                   /locus_tag="mCG_13176"
FT                   /product="RIKEN cDNA 2310046K01"
FT                   /note="gene_id=mCG13176.1 transcript_id=mCT11754.1
FT                   protein_id=mCP9956.1"
FT                   /db_xref="GOA:Q9D6X5"
FT                   /db_xref="InterPro:IPR009357"
FT                   /db_xref="MGI:MGI:1916948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D6X5"
FT                   /protein_id="EDL05945.1"
FT                   /translation="MAFLTHLLVCVFGMGSWVAINGLWVELPLLVTELPEAWYLPSYLT
FT                   VVIQLANIGPLLVTLMHRFRPGCLSEVPVIFLILCVGTAACILLAFLWNVTSWIQGGQH
FT                   SVAFIVLTFFLALVDCTSSVTFLPFMSQLPTYYLTTFFIGEGLSGLLPALVALVQGSGI
FT                   TTCVNVTETPGTTLNTMETPITQGNLSPSLPSPSWHQESRYLAPRFSPLLFFLLLSFLT
FT                   GCCLVAFFLLQRQPWGRQGSIEDLLHSQVTLHSIRPRDTEDTSSLGAPVSSPGKGSVEA
FT                   SVASLRPAQLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLAC
FT                   FLPIFLPNRSLLFLGVLTVLGTGFGAYNMAMAAMSPCPVLQGHWGGEVLIVLSWVLFAA
FT                   CLSYVKVMLGVILRDRSRSALLWCGAAVQLGSLIGALLMFPLVNVLKLFSSADYCSLDC
FT                   SV"
FT   gene            complement(579845..582926)
FT                   /locus_tag="mCG_147185"
FT                   /note="gene_id=mCG147185.0"
FT   mRNA            complement(579845..582926)
FT                   /locus_tag="mCG_147185"
FT                   /product="mCG147185"
FT                   /note="gene_id=mCG147185.0 transcript_id=mCT187448.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(580282..580488)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147185"
FT                   /product="mCG147185"
FT                   /note="gene_id=mCG147185.0 transcript_id=mCT187448.0
FT                   protein_id=mCP109246.0"
FT                   /protein_id="EDL05946.1"
FT                   /translation="MPTWLCKGRTFLFTMSRNCFFFLTVLGRNFGMHHAITLPLRSMPS
FT                   LCVHISVVDCDTHGCQICNLFLR"
FT   assembly_gap    582931..584129
FT                   /estimated_length=1199
FT                   /gap_type="unknown"
FT   assembly_gap    607908..608379
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    619131..619180
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    641431..642105
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   gene            complement(645967..>647418)
FT                   /locus_tag="mCG_140677"
FT                   /note="gene_id=mCG140677.0"
FT   mRNA            complement(join(645967..646465,647243..>647418))
FT                   /locus_tag="mCG_140677"
FT                   /product="mCG140677"
FT                   /note="gene_id=mCG140677.0 transcript_id=mCT170649.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(646024..>646461)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140677"
FT                   /product="mCG140677"
FT                   /note="gene_id=mCG140677.0 transcript_id=mCT170649.0
FT                   protein_id=mCP93567.0"
FT                   /protein_id="EDL05947.1"
FT                   /translation="RNQGSERCFDSPKETQLRTCLRSDQTAWLQSLHHTSPELLSKRPN
FT                   MPALGEWVDSCKKSPSPPTSAAFIISPSTSCWARVEAQQSVKRKTTLPVTTPLCSPLAK
FT                   ARWYFECLRCFPRVLGDHWIPALAPTPCQVSFLQSWRYFCP"
FT   assembly_gap    651698..651717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    652052..652204
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   gene            662579..666412
FT                   /locus_tag="mCG_13184"
FT                   /note="gene_id=mCG13184.2"
FT   mRNA            662579..666412
FT                   /locus_tag="mCG_13184"
FT                   /product="mCG13184"
FT                   /note="gene_id=mCG13184.2 transcript_id=mCT14094.3 created
FT                   on 19-JUN-2003"
FT   CDS             663857..664474
FT                   /codon_start=1
FT                   /locus_tag="mCG_13184"
FT                   /product="mCG13184"
FT                   /note="gene_id=mCG13184.2 transcript_id=mCT14094.3
FT                   protein_id=mCP9966.3"
FT                   /protein_id="EDL05948.1"
FT                   /translation="MDAFFISDGRSRRRRAGAGGDAAGAGDAGGGGGGGGGGGERAGRS
FT                   GATAGGGHRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMH
FT                   VLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHS
FT                   AFKHYRCRQCDKSFALKSYLHKHCEAACVKAAEPPPSAGPAS"
FT   assembly_gap    675006..675173
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            <676392..682025
FT                   /gene="Srxn1"
FT                   /locus_tag="mCG_13189"
FT                   /note="gene_id=mCG13189.1"
FT   mRNA            join(<676392..676611,679653..682025)
FT                   /gene="Srxn1"
FT                   /locus_tag="mCG_13189"
FT                   /product="sulfiredoxin 1 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG13189.1 transcript_id=mCT14099.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(<676393..676611,679653..679856)
FT                   /codon_start=1
FT                   /gene="Srxn1"
FT                   /locus_tag="mCG_13189"
FT                   /product="sulfiredoxin 1 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG13189.1 transcript_id=mCT14099.1
FT                   protein_id=mCP9953.1"
FT                   /protein_id="EDL05949.1"
FT                   /translation="QGRGMGLRAGGALRRAGAGPGAPEGQGPGGAQGGSIHSGCIATVH
FT                   NVPIAVLIRPLPSVLDPAKVQSLVDTILADPDSVPPIDVLWIKGAQGGDYYYSFGGCHR
FT                   YAAYQQLQRETIPAKLVRSTLSDLRMYLGASTPDLQ"
FT   assembly_gap    687241..687800
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    689633..689804
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    693083..693143
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            714323..719861
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /note="gene_id=mCG13183.2"
FT   mRNA            join(714323..714905,719463..719861)
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /product="transcription factor 15, transcript variant
FT                   mCT11753"
FT                   /note="gene_id=mCG13183.2 transcript_id=mCT11753.2 created
FT                   on 25-SEP-2002"
FT   CDS             join(714393..714905,719463..719537)
FT                   /codon_start=1
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /product="transcription factor 15, isoform CRA_a"
FT                   /note="gene_id=mCG13183.2 transcript_id=mCT11753.2
FT                   protein_id=mCP9967.1 isoform=CRA_a"
FT                   /protein_id="EDL05950.1"
FT                   /translation="MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLE
FT                   AARRGPGPGSGRRASNGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDR
FT                   KLSKIETLRLASSYIAHLANVLLLGDAADDGQPCFRAAGGGKSAVPAADGRQPRSICTF
FT                   CLSNQRKGGSRRDLGGSCLKVRGVAPLRGPRR"
FT   mRNA            join(<714635..714905,719468..719860)
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /product="transcription factor 15, transcript variant
FT                   mCT173575"
FT                   /note="gene_id=mCG13183.2 transcript_id=mCT173575.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(<714652..714905,719468..719537)
FT                   /codon_start=1
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /product="transcription factor 15, isoform CRA_b"
FT                   /note="gene_id=mCG13183.2 transcript_id=mCT173575.0
FT                   protein_id=mCP96494.0 isoform=CRA_b"
FT                   /protein_id="EDL05951.1"
FT                   /translation="TRPSPPCARSSPPSPWTESCLRSRRCVWRPATSPTWPTCCCWATR
FT                   PTTGSRVSARRAVARARSPPPTAVSRAPSAPSVSATSARGRRDLGGSCLKVRGVAPLRG
FT                   PRR"
FT   assembly_gap    726584..726603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    741683..741795
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    742612..742850
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    748502..748549
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    755403..755422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(756095..>756428)
FT                   /locus_tag="mCG_140678"
FT                   /note="gene_id=mCG140678.0"
FT   mRNA            complement(756095..>756428)
FT                   /locus_tag="mCG_140678"
FT                   /product="mCG140678"
FT                   /note="gene_id=mCG140678.0 transcript_id=mCT170650.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(756131..>756427)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140678"
FT                   /product="mCG140678"
FT                   /note="gene_id=mCG140678.0 transcript_id=mCT170650.0
FT                   protein_id=mCP93568.0"
FT                   /protein_id="EDL05952.1"
FT                   /translation="VIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISP
FT                   RFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHRGGKILGFFF"
FT   assembly_gap    756429..757131
FT                   /estimated_length=703
FT                   /gap_type="unknown"
FT   assembly_gap    762549..762575
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    786772..786791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    792547..792621
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    797747..797816
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            797832..850598
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /note="gene_id=mCG13182.2"
FT   mRNA            join(797832..797948,821359..821568,825167..825278,
FT                   828335..828436,828898..828948,829633..829692,
FT                   831716..831799,834140..834250,841383..841484,
FT                   842847..842947,844152..844300,845701..845787,
FT                   847723..850598)
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /product="casein kinase II, alpha 1 polypeptide, transcript
FT                   variant mCT14093"
FT                   /note="gene_id=mCG13182.2 transcript_id=mCT14093.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(797890..797948,821359..821568,825167..825278,
FT                   828335..828436,828898..828948,829633..829692,
FT                   831716..831799,834140..834250,841383..841898)
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /product="casein kinase II, alpha 1 polypeptide, transcript
FT                   variant mCT173574"
FT                   /note="gene_id=mCG13182.2 transcript_id=mCT173574.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(821468..821568,825167..825278,828335..828436,
FT                   828898..828948,829633..829692,831716..831799,
FT                   834140..834250,841383..841484,842847..842947,
FT                   844152..844300,845701..845787,847723..847838)
FT                   /codon_start=1
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /product="casein kinase II, alpha 1 polypeptide, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13182.2 transcript_id=mCT14093.2
FT                   protein_id=mCP9965.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q60737"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:88543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60737"
FT                   /protein_id="EDL05953.1"
FT                   /translation="MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKL
FT                   GRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDP
FT                   VSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVM
FT                   IDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCML
FT                   ASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRW
FT                   ERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMA
FT                   GGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ"
FT   CDS             join(821468..821568,825167..825278,828335..828436,
FT                   828898..828948,829633..829692,831716..831799,
FT                   834140..834250,841383..841508)
FT                   /codon_start=1
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /product="casein kinase II, alpha 1 polypeptide, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13182.2 transcript_id=mCT173574.0
FT                   protein_id=mCP96493.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D0E8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D0E8"
FT                   /protein_id="EDL05954.1"
FT                   /translation="MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKL
FT                   GRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDP
FT                   VSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVM
FT                   IDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCML
FT                   ASMIFRKEPFFHGHDNYDQVMTCFSH"
FT   assembly_gap    837643..838662
FT                   /estimated_length=1020
FT                   /gap_type="unknown"
FT   assembly_gap    860563..860582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <862651..882810
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /note="gene_id=mCG13191.1"
FT   mRNA            join(<862651..862822,870970..871155,873764..873844,
FT                   876807..876993,877148..877249,879199..879340,
FT                   880130..880317,880523..882810)
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, transcript variant
FT                   mCT14101"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT14101.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(<862651..862822,870970..871155,873764..873844,
FT                   876807..876993,877148..877249,879199..879340,
FT                   880130..880317,880523..880778)
FT                   /codon_start=1
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, isoform CRA_c"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT14101.2
FT                   protein_id=mCP9954.2 isoform=CRA_c"
FT                   /protein_id="EDL05957.1"
FT                   /translation="GVYPAPAELGLGPWWEPLLRLRRQPGLGLGPGPPEMALRPSKGDG
FT                   SAGRWDRGAGKADFNAKRKKKVAEIHQALNSDPIDLAALRRMAISEGGLLTDEIRCQVW
FT                   PKLLNVNTSEPPPVSRKDLRDMSKDYQQVLLDVRRSLRRFPPGMPDEQREGLQEELIDI
FT                   ILLVLDRNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHI
FT                   LNYLMPIIDQVSPELHDFMQSAEVGTIFALSWLITWFGHVLMDFRHVVRLYDFFLACHP
FT                   LMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPPSE
FT                   LAREAAAQQEAERTAASTFKDFELASTQQRPDMVLRQRFRGLLRPEARTKDVLTKPRTN
FT                   RFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP"
FT   mRNA            join(<862657..862822,870970..871155,873764..873844,
FT                   876807..877249,879199..879340,880130..880317,
FT                   880523..882804)
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, transcript variant
FT                   mCT189903"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT189903.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<862745..862822,870970..871155,873764..873844,
FT                   876807..876993,877148..877249,879199..879344,
FT                   880130..880317,880523..882809)
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, transcript variant
FT                   mCT189902"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT189902.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<862747..862822,870970..871155,873764..873844,
FT                   876807..876993,877148..877249,879199..879344,
FT                   880130..880167)
FT                   /codon_start=1
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, isoform CRA_a"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT189902.0
FT                   protein_id=mCP110855.0 isoform=CRA_a"
FT                   /protein_id="EDL05955.1"
FT                   /translation="PPEMALRPSKGDGSAGRWDRGAGKADFNAKRKKKVAEIHQALNSD
FT                   PIDLAALRRMAISEGGLLTDEIRCQVWPKLLNVNTSEPPPVSRKDLRDMSKDYQQVLLD
FT                   VRRSLRRFPPGMPDEQREGLQEELIDIILLVLDRNPQLHYYQGYHDIVVTFLLVVGERL
FT                   ATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVSPELHDFMQSAEVGTIFALSW
FT                   LITWFGHVLMDFRHVVRLYDFFLACHPLMPIYFAAVVDRAVPGAGSPGL"
FT   assembly_gap    868040..868059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<877116..877249,879199..879340,880130..880317,
FT                   880523..880778)
FT                   /codon_start=1
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, isoform CRA_b"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT189903.0
FT                   protein_id=mCP110856.0 isoform=CRA_b"
FT                   /protein_id="EDL05956.1"
FT                   /translation="PLALTELSSCRDFMDPTMDNTKHILNYLMPIIDQVSPELHDFMQS
FT                   AEVGTIFALSWLITWFGHVLMDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDC
FT                   DCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPPSELAREAAAQQEAERTAASTFKD
FT                   FELASTQQRPDMVLRQRFRGLLRPEARTKDVLTKPRTNRFVKLAVMGLTVALGAAALAV
FT                   VKSALEWAPKFQLQLFP"
FT   gene            complement(885141..901461)
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /note="gene_id=mCG13181.2"
FT   mRNA            complement(join(885141..885727,887125..887268,
FT                   887526..887624,887937..888116,890973..891084,
FT                   891985..892145,893080..893253,893338..893453,
FT                   895029..895227,896060..896153,899773..899917,
FT                   900847..900935,901309..901461))
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /product="RanBP-type and C3HC4-type zinc finger containing
FT                   1, transcript variant mCT14092"
FT                   /note="gene_id=mCG13181.2 transcript_id=mCT14092.2 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(885151..885727,887125..887268,
FT                   887526..887624,887937..888116,890973..891084,
FT                   891985..892145,893080..893253,893338..893453,
FT                   895029..895227,896060..896153,899773..899917,
FT                   900847..>901226))
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /product="RanBP-type and C3HC4-type zinc finger containing
FT                   1, transcript variant mCT189871"
FT                   /note="gene_id=mCG13181.2 transcript_id=mCT189871.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(885647..885727,887125..887268,
FT                   887526..887624,887937..888116,890973..891084,
FT                   891985..892145,893080..893253,893338..893453,
FT                   895029..895227,896060..896153,899773..899917,
FT                   900847..>900970))
FT                   /codon_start=1
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /product="RanBP-type and C3HC4-type zinc finger containing
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG13181.2 transcript_id=mCT189871.0
FT                   protein_id=mCP110854.0 isoform=CRA_a"
FT                   /protein_id="EDL05958.1"
FT                   /translation="GRVASTFPLSPRLPQSSVFRKQQPFLRGWAQPGQMDEKTKKAEEM
FT                   ALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEVSPTQDIRLCVSVEDAYMHTVT
FT                   IWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDGAYLY
FT                   LLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRGPLEPVLPKPRTNQEPGQPDAAP
FT                   ESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQ
FT                   YQQRKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCREC
FT                   LQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTL
FT                   SYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCREYQDDLALRAQNDV
FT                   AARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGG
FT                   PGDTSGGCRCRVNGIPCHPSCQNCH"
FT   CDS             complement(join(885647..885727,887125..887268,
FT                   887526..887624,887937..888116,890973..891084,
FT                   891985..892145,893080..893253,893338..893453,
FT                   895029..895227,896060..896153,899773..899909))
FT                   /codon_start=1
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /product="RanBP-type and C3HC4-type zinc finger containing
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG13181.2 transcript_id=mCT14092.2
FT                   protein_id=mCP9960.2 isoform=CRA_b"
FT                   /protein_id="EDL05959.1"
FT                   /translation="MALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEVSPTQDI
FT                   RLCVSVEDAYMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETL
FT                   HSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRGPLEPVLP
FT                   KPRTNQEPGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDE
FT                   EERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGE
FT                   AVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQR
FT                   FLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNC
FT                   REYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHT
FT                   EICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH"
FT   gene            complement(906215..>912989)
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /note="gene_id=mCG13180.2"
FT   mRNA            complement(join(906215..907483,908511..908803,
FT                   911819..912109,912639..912809))
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), transcript
FT                   variant mCT14091"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT14091.1 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(906216..907483,908511..908803,
FT                   911819..911972,912972..>912989))
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), transcript
FT                   variant mCT170661"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT170661.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(906216..907483,908511..908803,
FT                   911819..912065,912639..>912803))
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), transcript
FT                   variant mCT170660"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT170660.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(907003..907483,908511..908803,
FT                   911819..911972,912972..>912988))
FT                   /codon_start=1
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT170661.0
FT                   protein_id=mCP93579.0 isoform=CRA_b"
FT                   /protein_id="EDL05961.1"
FT                   /translation="RVGGSDLLPPSPPPASDLSPAVAPATRLGPYILLEREQGSCSYRA
FT                   LHCPTGTEYTCKVYPASEAQAVLAPYARLPTHQHVARPTEVLLGSRLLYIFFTKTHGDL
FT                   HSLVRSRRGIPESEAAGLFRQMASAVAHCHKHGLVLRDLKLRRFVFSNCERTKLVLENL
FT                   EDACVMTGSDDSLWDKHACPAYVGPEILSSRPSYSGKAADVWSLGVALFTMLAGRYPFH
FT                   DSEPVLLFGKIRRGTFALPEGLSAPARCLIRCLLRKEPSERLVALGILLHPWLREDHGR
FT                   VSPPQSDRREMDQVVPDGPQLEEAEEGEVGLYG"
FT   CDS             complement(join(907003..907483,908511..908803,
FT                   911819..912065,912639..>912652))
FT                   /codon_start=1
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT170660.0
FT                   protein_id=mCP93578.0 isoform=CRA_c"
FT                   /protein_id="EDL05962.1"
FT                   /translation="GSRTRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLPSLLPPSPPPA
FT                   SDLSPAVAPATRLGPYILLEREQGSCSYRALHCPTGTEYTCKVYPASEAQAVLAPYARL
FT                   PTHQHVARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESEAAGLFRQMASAVAHC
FT                   HKHGLVLRDLKLRRFVFSNCERTKLVLENLEDACVMTGSDDSLWDKHACPAYVGPEILS
FT                   SRPSYSGKAADVWSLGVALFTMLAGRYPFHDSEPVLLFGKIRRGTFALPEGLSAPARCL
FT                   IRCLLRKEPSERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGPQLEEAEEGEV
FT                   GLYG"
FT   CDS             complement(join(907003..907483,908511..908803,
FT                   911819..912109))
FT                   /codon_start=1
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT14091.1
FT                   protein_id=mCP9962.2 isoform=CRA_a"
FT                   /protein_id="EDL05960.1"
FT                   /translation="MRATPLAASADVSCRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLP
FT                   SLLPPSPPPASDLSPAVAPATRLGPYILLEREQGSCSYRALHCPTGTEYTCKVYPASEA
FT                   QAVLAPYARLPTHQHVARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESEAAGLF
FT                   RQMASAVAHCHKHGLVLRDLKLRRFVFSNCERTKLVLENLEDACVMTGSDDSLWDKHAC
FT                   PAYVGPEILSSRPSYSGKAADVWSLGVALFTMLAGRYPFHDSEPVLLFGKIRRGTFALP
FT                   EGLSAPARCLIRCLLRKEPSERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGP
FT                   QLEEAEEGEVGLYG"
FT   assembly_gap    910395..910511
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            914451..944069
FT                   /locus_tag="mCG_1050958"
FT                   /note="gene_id=mCG1050958.0"
FT   mRNA            join(914451..914508,930477..930622,937438..937540,
FT                   939544..939710,942544..944069)
FT                   /locus_tag="mCG_1050958"
FT                   /product="mCG1050958"
FT                   /note="gene_id=mCG1050958.0 transcript_id=mCT194747.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    919138..919157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            922286..923377
FT                   /pseudo
FT                   /locus_tag="mCG_118797"
FT                   /note="gene_id=mCG118797.0"
FT   mRNA            922286..923377
FT                   /pseudo
FT                   /locus_tag="mCG_118797"
FT                   /note="gene_id=mCG118797.0 transcript_id=mCT119958.0
FT                   created on 17-JUL-2002"
FT   assembly_gap    927090..927185
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    934797..934895
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   gene            complement(937495..>945359)
FT                   /gene="Nrsn2"
FT                   /locus_tag="mCG_3729"
FT                   /note="gene_id=mCG3729.1"
FT   mRNA            complement(join(937495..938663,942840..943034,
FT                   945293..>945359))
FT                   /gene="Nrsn2"
FT                   /locus_tag="mCG_3729"
FT                   /product="neurensin 2"
FT                   /note="gene_id=mCG3729.1 transcript_id=mCT2818.1 created on
FT                   22-JUL-2002"
FT   CDS             complement(join(938241..938663,942840..943034,
FT                   945293..>945358))
FT                   /codon_start=1
FT                   /gene="Nrsn2"
FT                   /locus_tag="mCG_3729"
FT                   /product="neurensin 2"
FT                   /note="gene_id=mCG3729.1 transcript_id=mCT2818.1
FT                   protein_id=mCP7981.1"
FT                   /protein_id="EDL05964.1"
FT                   /translation="SALLCSAPAPTASVGSGDAGPEGSVMSCSRPCVCSHGTSVEESTW
FT                   YGFDFYPNLFYNDWLGTTTLPYNPERIPIRYINRPWPSLCWKVTVAVASLFLLLGVAAL
FT                   TTGYAVPPKLELVNESKFSSMEDPVADYNQALMTCRVVGATLCGVAGIMLAVCLFLIAS
FT                   GWMFQDIKAEPLVTETDSPVEVFRDEPEKLSPAFHETSSQSPFLTPPSPFGQQSVQTSQ
FT                   PQRDL"
FT   CDS             943493..943894
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050958"
FT                   /product="mCG1050958"
FT                   /note="gene_id=mCG1050958.0 transcript_id=mCT194747.0
FT                   protein_id=mCP115776.0"
FT                   /protein_id="EDL05963.1"
FT                   /translation="MCGQTRVEVKGSVSESPLPFDQVNPPAISLAAACVLTPMSHLDNS
FT                   NYYSLFLFLFPSSTFGAPMFTVRDPYVPPQNFCPFRTISRGNFHRRYSCSWVGVFTLYS
FT                   PKSLRQISPIHKSQGIVSSGLRALGPFDY"
FT   assembly_gap    950335..950354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    954991..955341
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    960233..960252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(964739..>965535)
FT                   /locus_tag="mCG_1027917"
FT                   /note="gene_id=mCG1027917.1"
FT   mRNA            complement(964739..>965535)
FT                   /locus_tag="mCG_1027917"
FT                   /product="mCG1027917"
FT                   /note="gene_id=mCG1027917.1 transcript_id=mCT145621.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(965134..>965535)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027917"
FT                   /product="mCG1027917"
FT                   /note="gene_id=mCG1027917.1 transcript_id=mCT145621.1
FT                   protein_id=mCP72832.1"
FT                   /protein_id="EDL05965.1"
FT                   /translation="PGRELWSMVPAGRAARGPAERAQGPSGEGAAASAASPTLSEDEEP
FT                   EEEEEEAATAEEGEEETVVSGEEPLGFLSRMPPGPAGLDCSALDRDPDLLPPSGTSHFE
FT                   FPDYCTPEVTEMIAGDWRPSSIADLVFTY"
FT   assembly_gap    965537..966698
FT                   /estimated_length=1162
FT                   /gap_type="unknown"
FT   assembly_gap    970823..970872
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(979542..>982569)
FT                   /gene="Zcchc3"
FT                   /locus_tag="mCG_3721"
FT                   /note="gene_id=mCG3721.2"
FT   mRNA            complement(979542..>982569)
FT                   /gene="Zcchc3"
FT                   /locus_tag="mCG_3721"
FT                   /product="zinc finger, CCHC domain containing 3"
FT                   /note="gene_id=mCG3721.2 transcript_id=mCT2821.2 created on
FT                   22-JUL-2002"
FT   CDS             complement(981156..>982568)
FT                   /codon_start=1
FT                   /gene="Zcchc3"
FT                   /locus_tag="mCG_3721"
FT                   /product="zinc finger, CCHC domain containing 3"
FT                   /note="gene_id=mCG3721.2 transcript_id=mCT2821.2
FT                   protein_id=mCP7973.2"
FT                   /protein_id="EDL05966.1"
FT                   /translation="EPGSRRAVSGRHEFPHARLPRGRKPEASGFRAGAGSRPRSPRPSS
FT                   LIPSGSAPWAPRTAGTSGGCWERGNMATGGGAEEESQRGRPQLPLPARPVARVEEPEGV
FT                   REKMGWAQVVKNLAEKKGDFREPRRRDEAGSGASGGLGSPGGLATPNPGDFPPAARGDP
FT                   KGRRRDPTGEASDAYRKKSASGAGDPSRRKKAEVTAAMATPARPSTTEDATERPLQDEP
FT                   PAAGPGKGRFLVRICFQGDESACPTRDFVVGALILRSIGMDPDDIYAVIQIPGSREFDV
FT                   SFRSAEKLALFLRVYEEKRELEDCWENFVVLGRSRSSLKTLFILFRNETVDVEDIVTWL
FT                   KRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQP
FT                   KTCFKCGSRTHMSGTCTQDRCFRCGEEGHLSPYCRKVIVCNLCGKRGHAFAQCPKAVHN
FT                   SVTAQLTSVAGH"
FT   gene            983168..1013557
FT                   /gene="6820408C15Rik"
FT                   /locus_tag="mCG_141039"
FT                   /note="gene_id=mCG141039.1"
FT   mRNA            join(983168..983303,994980..995276,995452..995506,
FT                   996033..996132,1003248..1003360,1006697..1006855,
FT                   1008840..1008939,1009995..1010152,1010230..1010331,
FT                   1010446..1010532,1011604..1011722,1013303..1013557)
FT                   /gene="6820408C15Rik"
FT                   /locus_tag="mCG_141039"
FT                   /product="RIKEN cDNA 6820408C15"
FT                   /note="gene_id=mCG141039.1 transcript_id=mCT172812.1
FT                   created on 11-JUN-2003"
FT   assembly_gap    984089..984138
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    991773..991792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(995266..995276,995452..995506,996033..996132,
FT                   1003248..1003360,1006697..1006855,1008840..1008939,
FT                   1009995..1010152,1010230..1010331,1010446..1010532,
FT                   1011604..1011722,1013303..1013363)
FT                   /codon_start=1
FT                   /gene="6820408C15Rik"
FT                   /locus_tag="mCG_141039"
FT                   /product="RIKEN cDNA 6820408C15"
FT                   /note="gene_id=mCG141039.1 transcript_id=mCT172812.1
FT                   protein_id=mCP95731.0"
FT                   /db_xref="GOA:Q8BJX2"
FT                   /db_xref="InterPro:IPR029236"
FT                   /db_xref="MGI:MGI:3045333"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BJX2"
FT                   /protein_id="EDL05967.1"
FT                   /translation="MAQKQTSRPQFSGNKFQVPVRLGPEKNLKPSTLPPLRQVKGRNKS
FT                   KTKNLNKIQPVQSQVSVEMANSTKTSGGLRRRDQTHHGKVQAKVRLMRSMLRNQRTSLQ
FT                   ELYSHEGYLSKLNKELIKAILDTEDSVALSVREMLQQQSILGSIIDILEYSNKKRVQQL
FT                   RSELQEWKEKEESKTNSLQREVDQLNSEIQKASEEVNFLDTYMDHEYPVKLVQIASHIR
FT                   QVQQAKDNQQDELDNLSEMRETILALFSNVIQEKKKKILKSLVVNTQKPHENILLLKTL
FT                   DRRRLQRCMVLFRELIEQMKEEIPILLSEVEQMCAELWNPREAVYKDVLLQRPKCTPDM
FT                   AVELNIPVQEPFPF"
FT   assembly_gap    996556..996575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    998247..998266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1015573..1015592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1018632..1018848
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   gene            <1028237..1050090
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /note="gene_id=mCG119782.1"
FT   mRNA            join(<1028237..1028619,1040400..1040478,1049510..1050089)
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /product="RIKEN cDNA 9230107O10, transcript variant
FT                   mCT120959"
FT                   /note="gene_id=mCG119782.1 transcript_id=mCT120959.1
FT                   created on 22-JUL-2002"
FT   CDS             <1028237..1028548
FT                   /codon_start=1
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /product="RIKEN cDNA 9230107O10, isoform CRA_a"
FT                   /note="gene_id=mCG119782.1 transcript_id=mCT120959.1
FT                   protein_id=mCP72862.1 isoform=CRA_a"
FT                   /protein_id="EDL05968.1"
FT                   /translation="LILMPVEAERSLMPQEKDLLPTNMLSPLPWEPWACLRWSRSGPRG
FT                   SIGRILALFDVHLGGSSSAHAASPGPGGDRLHGEGVWAHSRVGIGQKVLGSSALEECH"
FT   gene            complement(<1028342..1034779)
FT                   /locus_tag="mCG_51783"
FT                   /note="gene_id=mCG51783.2"
FT   mRNA            complement(join(<1028342..1028784,1034717..1034779))
FT                   /locus_tag="mCG_51783"
FT                   /product="mCG51783"
FT                   /note="gene_id=mCG51783.2 transcript_id=mCT51966.1 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(1028342..1028784,1034717..1034774))
FT                   /codon_start=1
FT                   /locus_tag="mCG_51783"
FT                   /product="mCG51783"
FT                   /note="gene_id=mCG51783.2 transcript_id=mCT51966.1
FT                   protein_id=mCP30354.0"
FT                   /db_xref="GOA:Q30KP0"
FT                   /db_xref="InterPro:IPR020520"
FT                   /db_xref="InterPro:IPR025933"
FT                   /db_xref="MGI:MGI:3644405"
FT                   /db_xref="UniProtKB/TrEMBL:Q30KP0"
FT                   /protein_id="EDL05970.1"
FT                   /translation="MKLLFPLFASLMLQSQVKSEFATVKRCLVGFGKCKDSCLADETQM
FT                   QHCKAKKCCIGPKVSELIKSYLRQEIPHIPDEDIVEMMRTKKNSTEEMQGKQALMALFQ
FT                   SRAAKNLLSNTNSAMGPNAFPVKSVTTRTRRRRMGATASTKMHIKQSKDSANAAPRPRP
FT                   GPP"
FT   assembly_gap    1029701..1030151
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    1031032..1032800
FT                   /estimated_length=1769
FT                   /gap_type="unknown"
FT   assembly_gap    1033558..1034263
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    1035437..1035520
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            1037564..1038046
FT                   /pseudo
FT                   /locus_tag="mCG_140713"
FT                   /note="gene_id=mCG140713.0"
FT   mRNA            1037564..1038046
FT                   /pseudo
FT                   /locus_tag="mCG_140713"
FT                   /note="gene_id=mCG140713.0 transcript_id=mCT170925.0
FT                   created on 22-JUL-2002"
FT   mRNA            join(<1047233..1047341,1049510..1050090)
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /product="RIKEN cDNA 9230107O10, transcript variant
FT                   mCT170924"
FT                   /note="gene_id=mCG119782.1 transcript_id=mCT170924.0
FT                   created on 22-JUL-2002"
FT   CDS             join(<1047233..1047341,1049510..1049751)
FT                   /codon_start=1
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /product="RIKEN cDNA 9230107O10, isoform CRA_b"
FT                   /note="gene_id=mCG119782.1 transcript_id=mCT170924.0
FT                   protein_id=mCP93842.0 isoform=CRA_b"
FT                   /protein_id="EDL05969.1"
FT                   /translation="VLGSEWHTTGSPAVSGGSEDMKLLQVLLVLLFVALADGAQPKRCF
FT                   SNVEGYCRKKCRLVEISEMGCLHGKYCCVNELENKKHKKHSVVEETVKLQDKSKVQDYM
FT                   ILPTVTYYTISI"
FT   gene            complement(1055799..>1060255)
FT                   /gene="9230002F21Rik"
FT                   /locus_tag="mCG_1027918"
FT                   /note="gene_id=mCG1027918.1"
FT   mRNA            complement(join(1055799..1056338,1060167..>1060255))
FT                   /gene="9230002F21Rik"
FT                   /locus_tag="mCG_1027918"
FT                   /product="RIKEN cDNA 9230002F21"
FT                   /note="gene_id=mCG1027918.1 transcript_id=mCT145622.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(join(1055857..1056338,1060167..>1060254))
FT                   /codon_start=1
FT                   /gene="9230002F21Rik"
FT                   /locus_tag="mCG_1027918"
FT                   /product="RIKEN cDNA 9230002F21"
FT                   /note="gene_id=mCG1027918.1 transcript_id=mCT145622.1
FT                   protein_id=mCP72834.1"
FT                   /protein_id="EDL05971.1"
FT                   /translation="HRTYCLLTGAMKSLLSTLVIIMFLAHLVTGGWYVKKCANTLGNCR
FT                   KMCRDGEKQTEPATSKCPIGKLCCVLDFKISGHCGGGGQNSDNLVTAGGDEGSSAKAST
FT                   AAMVGAAAMAGTPTKTSAPAKTSAPAKTSTTTKASNAAKASTTTKASNAAKASAATMAG
FT                   NTTKVSTAAIASTPAQASTPTKANST"
FT   gene            <1088335..1091528
FT                   /gene="Defb28"
FT                   /locus_tag="mCG_1027970"
FT                   /note="gene_id=mCG1027970.1"
FT   mRNA            join(<1088335..1088441,1090097..1090261,1091403..1091528)
FT                   /gene="Defb28"
FT                   /locus_tag="mCG_1027970"
FT                   /product="defensin beta 28"
FT                   /note="gene_id=mCG1027970.1 transcript_id=mCT145674.1
FT                   created on 22-JUL-2002"
FT   CDS             join(<1088336..1088441,1090097..1090261,1091403..1091413)
FT                   /codon_start=1
FT                   /gene="Defb28"
FT                   /locus_tag="mCG_1027970"
FT                   /product="defensin beta 28"
FT                   /note="gene_id=mCG1027970.1 transcript_id=mCT145674.1
FT                   protein_id=mCP73158.0"
FT                   /protein_id="EDL05972.1"
FT                   /translation="STFSMLQTRSSTLSGHNKLWFLTLAVLVVLAQTSPEGWFRTCFYG
FT                   LGKCRRICRANEKKKERCGERTFCCLRETNSRLSHIPVTKDREKDESC"
FT   assembly_gap    1099380..1099399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1103292..1104559
FT                   /estimated_length=1268
FT                   /gap_type="unknown"
FT   assembly_gap    1105927..1105946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1107286..1107305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1108512..1109379
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   gene            <1140363..1142565
FT                   /gene="4930525K10Rik"
FT                   /locus_tag="mCG_119800"
FT                   /note="gene_id=mCG119800.1"
FT   mRNA            join(<1140363..1140445,1141383..1141469,1142307..1142565)
FT                   /gene="4930525K10Rik"
FT                   /locus_tag="mCG_119800"
FT                   /product="RIKEN cDNA 4930525K10"
FT                   /note="gene_id=mCG119800.1 transcript_id=mCT120978.1
FT                   created on 22-JUL-2002"
FT   CDS             join(<1140421..1140445,1141383..1141469,1142307..1142530)
FT                   /codon_start=1
FT                   /gene="4930525K10Rik"
FT                   /locus_tag="mCG_119800"
FT                   /product="RIKEN cDNA 4930525K10"
FT                   /note="gene_id=mCG119800.1 transcript_id=mCT120978.1
FT                   protein_id=mCP73056.0"
FT                   /protein_id="EDL05973.1"
FT                   /translation="VSACVSFLDVWMFYLPRAMRFLLLVLPVLALLPQVTPDYGAKKRC
FT                   LKILGHCRRHCKDGEMDHGSCKYYRVCCVPDLNSYNQNYAITWTTEETSTSEYDLSSDF
FT                   IGVLRAI"
FT   gene            complement(1143712..>1148578)
FT                   /gene="Defb19"
FT                   /locus_tag="mCG_1027919"
FT                   /note="gene_id=mCG1027919.1"
FT   mRNA            complement(join(1143712..1143978,1148459..>1148578))
FT                   /gene="Defb19"
FT                   /locus_tag="mCG_1027919"
FT                   /product="defensin beta 19"
FT                   /note="gene_id=mCG1027919.1 transcript_id=mCT145623.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(join(1143785..1143978,1148459..>1148576))
FT                   /codon_start=1
FT                   /gene="Defb19"
FT                   /locus_tag="mCG_1027919"
FT                   /product="defensin beta 19"
FT                   /note="gene_id=mCG1027919.1 transcript_id=mCT145623.1
FT                   protein_id=mCP72847.0"
FT                   /protein_id="EDL05974.1"
FT                   /translation="RNSAAVPCRPLTTSTLGGATMRLALLLLAILVATELVVSGKNPIL
FT                   QCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP"
FT   assembly_gap    1146044..1146063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1161455..>1167839)
FT                   /locus_tag="mCG_58458"
FT                   /note="gene_id=mCG58458.2"
FT   mRNA            complement(join(1161455..1161696,1164605..>1164691))
FT                   /locus_tag="mCG_58458"
FT                   /product="mCG58458, transcript variant mCT58641"
FT                   /note="gene_id=mCG58458.2 transcript_id=mCT58641.1 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(1161510..1161696,1167460..>1167839))
FT                   /locus_tag="mCG_58458"
FT                   /product="mCG58458, transcript variant mCT170942"
FT                   /note="gene_id=mCG58458.2 transcript_id=mCT170942.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(1161551..1161696,1164605..>1164689))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58458"
FT                   /product="mCG58458, isoform CRA_b"
FT                   /note="gene_id=mCG58458.2 transcript_id=mCT58641.1
FT                   protein_id=mCP30355.1 isoform=CRA_b"
FT                   /protein_id="EDL05976.1"
FT                   /translation="TSQHPEFPEVMKTAVLTMALLLLSQVIPGTPERCWKSFGVCREEC
FT                   AKKESFYIFCWNGKLCCVKPKNVPLWSQNLD"
FT   CDS             complement(join(1161592..1161696,1167460..>1167579))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58458"
FT                   /product="mCG58458, isoform CRA_a"
FT                   /note="gene_id=mCG58458.2 transcript_id=mCT170942.0
FT                   protein_id=mCP93860.0 isoform=CRA_a"
FT                   /protein_id="EDL05975.1"
FT                   /translation="EKTTTKSNLGRVSDCSLSLREAKGGIQDRDLEAGTEAETMGPLKD
FT                   AGSLLVSAVKSVPRKKVSTSSAGMANCAV"
FT   assembly_gap    1180485..1180842
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    1182901..1182920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1184734..1184753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1186966..1189125
FT                   /estimated_length=2160
FT                   /gap_type="unknown"
FT   gene            1197617..1216388
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /note="gene_id=mCG3722.2"
FT   mRNA            join(1197617..1197719,1198573..1199108,1199850..1199929,
FT                   1204083..1204284,1205073..1205822)
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /product="rad and gem related GTP binding protein 1,
FT                   transcript variant mCT2822"
FT                   /note="gene_id=mCG3722.2 transcript_id=mCT2822.1 created on
FT                   25-SEP-2002"
FT   mRNA            join(<1197624..1197719,1198573..1198893,1205246..1205399,
FT                   1216262..1216388)
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /product="rad and gem related GTP binding protein 1,
FT                   transcript variant mCT173582"
FT                   /note="gene_id=mCG3722.2 transcript_id=mCT173582.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(<1198634..1198893,1205246..1205273)
FT                   /codon_start=1
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /product="rad and gem related GTP binding protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3722.2 transcript_id=mCT173582.0
FT                   protein_id=mCP96501.0 isoform=CRA_a"
FT                   /protein_id="EDL05977.1"
FT                   /translation="EGSGGNYFHRLSGPKKGLRATGYRLTVLLLEGRKKPGKLKISSQR
FT                   MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSHAPAASWHV"
FT   CDS             join(1198769..1199108,1199850..1199929,1204083..1204284,
FT                   1205073..1205344)
FT                   /codon_start=1
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /product="rad and gem related GTP binding protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3722.2 transcript_id=mCT2822.1
FT                   protein_id=mCP7974.1 isoform=CRA_b"
FT                   /protein_id="EDL05978.1"
FT                   /translation="MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSQHPR
FT                   LGQSVSLNPPVRKPSPAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQ
FT                   DRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIA
FT                   DRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIE
FT                   TSATLQHNVTELFEGVVRQLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARR
FT                   RALKARSKSCHNLAVL"
FT   gene            complement(1223500..>1224944)
FT                   /locus_tag="mCG_140716"
FT                   /note="gene_id=mCG140716.0"
FT   mRNA            complement(join(1223500..1224007,1224700..>1224944))
FT                   /locus_tag="mCG_140716"
FT                   /product="mCG140716"
FT                   /note="gene_id=mCG140716.0 transcript_id=mCT170929.0
FT                   created on 22-JUL-2002"
FT   CDS             complement(1223670..>1223945)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140716"
FT                   /product="mCG140716"
FT                   /note="gene_id=mCG140716.0 transcript_id=mCT170929.0
FT                   protein_id=mCP93847.0"
FT                   /protein_id="EDL05979.1"
FT                   /translation="NDSAQEPKEEARNLDTSPWADARSVASRICPSPCKPDSPRPLPLI
FT                   AGLCKQSFWMDTGHGCASSLNTFHSQTEPQPRLLRKIGRKRHFPCS"
FT   gene            1240083..1279207
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /note="gene_id=mCG3727.2"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1275178..1275200,
FT                   1279005..1279207)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT2816"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT2816.3 created on
FT                   28-APR-2003"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1275178..1277380)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT120968"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT120968.2 created
FT                   on 28-APR-2003"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1274551..1274750,
FT                   1275178..1275592)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT170935"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170935.1 created
FT                   on 28-APR-2003"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1258623)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT170936"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170936.1 created
FT                   on 28-APR-2003"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1255688)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT170934"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170934.1 created
FT                   on 28-APR-2003"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1275178..1275200,
FT                   1279005..1279033)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_e"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT2816.3
FT                   protein_id=mCP7979.2 isoform=CRA_e"
FT                   /protein_id="EDL05984.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIINYEFDTKDL
FT                   VCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFW
FT                   VFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDI
FT                   SLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEV
FT                   AEMFSYEESNPKDPVVSKLID"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1275178..1275280)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_a"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT120968.2
FT                   protein_id=mCP72941.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D8V0"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="MGI:MGI:95886"
FT                   /db_xref="PDB:1INQ"
FT                   /db_xref="PDB:1JUF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D8V0"
FT                   /protein_id="EDL05980.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIINYEFDTKDL
FT                   VCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFW
FT                   VFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDI
FT                   SLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEV
FT                   AEMFSYEESNPKDPAAETESKEESTEASASKRLEKKEK"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1274551..1274701)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_b"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170935.1
FT                   protein_id=mCP93853.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D8V0"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="MGI:MGI:95886"
FT                   /db_xref="PDB:1INQ"
FT                   /db_xref="PDB:1JUF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D8V0"
FT                   /protein_id="EDL05981.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIINYEFDTKDL
FT                   VCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFW
FT                   VFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDI
FT                   SLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEV
FT                   AEMFSYESSAVILPHTPRLTHFPTVSGSPASLADSMQQKLAGPRRRRPQNPSAM"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256949)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_d"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170936.1
FT                   protein_id=mCP93854.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q6PGJ8"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="MGI:MGI:95886"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PGJ8"
FT                   /protein_id="EDL05983.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEGQCCPCPLGCVF
FT                   PSCLSPVLGFPKKRALKTKPNLYGPGSYPAWSPPSNGNLNDPVVSEHGLFLEVCYPICK
FT                   ME"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251832)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_c"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170934.1
FT                   protein_id=mCP93852.1 isoform=CRA_c"
FT                   /protein_id="EDL05982.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTIRSEGISRQPLKLLSQEPVQGLGWEHGLLCHSEPGLNPGCKIQ
FT                   GNLPSRQHYT"
FT   gene            complement(1255050..>1256157)
FT                   /locus_tag="mCG_140718"
FT                   /note="gene_id=mCG140718.0"
FT   mRNA            complement(join(1255050..1255570,1255928..>1256157))
FT                   /locus_tag="mCG_140718"
FT                   /product="mCG140718"
FT                   /note="gene_id=mCG140718.0 transcript_id=mCT170937.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(1255508..1255570,1255928..>1256116))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140718"
FT                   /product="mCG140718"
FT                   /note="gene_id=mCG140718.0 transcript_id=mCT170937.0
FT                   protein_id=mCP93855.0"
FT                   /protein_id="EDL05985.1"
FT                   /translation="KQFYPACSISWPGREQRWSFPDYVRARPANQGLLVVGVRILQSCG
FT                   GYISDSLSGLWVPYLCVRSEHPRKADSARTAKARGSVC"
FT   gene            <1306965..1308121
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /note="gene_id=mCG1027891.1"
FT   mRNA            <1306965..1308117
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /product="inhibitor of DNA binding 1, transcript variant
FT                   mCT145595"
FT                   /note="gene_id=mCG1027891.1 transcript_id=mCT145595.1
FT                   created on 19-JUN-2003"
FT   CDS             <1306965..1307558
FT                   /codon_start=1
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /product="inhibitor of DNA binding 1, isoform CRA_b"
FT                   /note="gene_id=mCG1027891.1 transcript_id=mCT145595.1
FT                   protein_id=mCP72997.1 isoform=CRA_b"
FT                   /protein_id="EDL05987.1"
FT                   /translation="HCTTFLQLLVLFPHSVLSLLRSPPPVLRIMKVASGSAAAAAGPSC
FT                   SLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNGCYSRLKELVPT
FT                   LPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTTGGRGLPVRAPLSTLNGEISALAA
FT                   EVRSEAEYYIILQWETEATGGGCPPSLLFRRIAI"
FT   mRNA            join(<1306966..1307456,1307683..1308121)
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /product="inhibitor of DNA binding 1, transcript variant
FT                   mCT170919"
FT                   /note="gene_id=mCG1027891.1 transcript_id=mCT170919.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<1306968..1307456,1307683..1307724)
FT                   /codon_start=1
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /product="inhibitor of DNA binding 1, isoform CRA_a"
FT                   /note="gene_id=mCG1027891.1 transcript_id=mCT170919.0
FT                   protein_id=mCP93837.0 isoform=CRA_a"
FT                   /protein_id="EDL05986.1"
FT                   /translation="CTTFLQLLVLFPHSVLSLLRSPPPVLRIMKVASGSAAAAAGPSCS
FT                   LKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNGCYSRLKELVPTL
FT                   PQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTTGGRGLPVRAPLSTLNGEISALAAE
FT                   AACVPADDRILCR"
FT   gene            1316345..1316975
FT                   /pseudo
FT                   /locus_tag="mCG_1027901"
FT                   /note="gene_id=mCG1027901.1"
FT   mRNA            1316345..1316975
FT                   /pseudo
FT                   /locus_tag="mCG_1027901"
FT                   /note="gene_id=mCG1027901.1 transcript_id=mCT145605.1
FT                   created on 24-JUL-2002"
FT   gene            1324846..1335693
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /note="gene_id=mCG119799.1"
FT   mRNA            join(1324846..1324897,1325828..1325912,1327687..1327851,
FT                   1331315..1331446,1335401..1335693)
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /product="cytochrome c oxidase subunit IV isoform 2,
FT                   transcript variant mCT120977"
FT                   /note="gene_id=mCG119799.1 transcript_id=mCT120977.1
FT                   created on 24-JUL-2002"
FT   mRNA            join(<1325767..1325912,1327687..1327851,1331315..1331446,
FT                   1335401..1335687)
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /product="cytochrome c oxidase subunit IV isoform 2,
FT                   transcript variant mCT189917"
FT                   /note="gene_id=mCG119799.1 transcript_id=mCT189917.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1325774..1325912,1327687..1327851,1331315..1331446,
FT                   1335401..1335537)
FT                   /codon_start=1
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /product="cytochrome c oxidase subunit IV isoform 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG119799.1 transcript_id=mCT189917.0
FT                   protein_id=mCP110904.0 isoform=CRA_b"
FT                   /protein_id="EDL05989.1"
FT                   /translation="GAAREQRGAEQDVSLILQMFSRAARSLVMRTGLRTRGTGTHSPGD
FT                   AAGSQRRMTPYVDCYAQRSYPMPDEPFCTELSEEQRALKEKEKGSWTQLSQAEKVALYR
FT                   LQFHETFAEMNHRSNEWKTVMGCVFFFIGFTALVIWWQRVYVFPKKVVTLTEERKAQQL
FT                   QRLLDMKSNPIQGLAAHWDYEKKEWKK"
FT   CDS             join(1325828..1325912,1327687..1327851,1331315..1331446,
FT                   1335401..1335537)
FT                   /codon_start=1
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /product="cytochrome c oxidase subunit IV isoform 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG119799.1 transcript_id=mCT120977.1
FT                   protein_id=mCP73047.1 isoform=CRA_a"
FT                   /protein_id="EDL05988.1"
FT                   /translation="MFSRAARSLVMRTGLRTRGTGTHSPGDAAGSQRRMTPYVDCYAQR
FT                   SYPMPDEPFCTELSEEQRALKEKEKGSWTQLSQAEKVALYRLQFHETFAEMNHRSNEWK
FT                   TVMGCVFFFIGFTALVIWWQRVYVFPKKVVTLTEERKAQQLQRLLDMKSNPIQGLAAHW
FT                   DYEKKEWKK"
FT   gene            complement(1329409..>1402915)
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /note="gene_id=mCG50852.2"
FT   mRNA            complement(join(1329409..1329598,1336313..1336421,
FT                   1337975..1338117,1400109..1400784,1401068..>1401857))
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, transcript variant mCT170940"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170940.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(1336421,1337975..1338117,
FT                   1400109..>1400720))
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170940.0
FT                   protein_id=mCP93858.0 isoform=CRA_b"
FT                   /protein_id="EDL05991.1"
FT                   /translation="AGVLDNGLVEPISIIKMSQSNRELVVDFLSYKLSQKGYSWSQFSD
FT                   VEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ
FT                   ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFG
FT                   GALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWGVSGGTPLRSVFRRLVQV
FT                   PGVAEHVCDPSLWEVETEGSEVQGPPQLL"
FT   mRNA            complement(join(1351322..1351424,1352801..1352927,
FT                   1400109..1400784,1402285..>1402915))
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, transcript variant mCT51035"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT51035.2 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(1351369..1351424,1352801..1352927,
FT                   1400109..>1400720))
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT51035.2
FT                   protein_id=mCP30356.2 isoform=CRA_c"
FT                   /protein_id="EDL05992.1"
FT                   /translation="AGVLDNGLVEPISIIKMSQSNRELVVDFLSYKLSQKGYSWSQFSD
FT                   VEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ
FT                   ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFG
FT                   GALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKG
FT                   QERFNRWFLTGMTVAGVVLLGSLFRAPVPPLPSPYTCSSSLK"
FT   mRNA            complement(join(1352065..1352927,1400109..1400784,
FT                   1401068..1401257))
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, transcript variant mCT170939"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170939.0 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(1352299..1352927,1399129..>1399189))
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, transcript variant mCT170941"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170941.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(1352627..>1352836)
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, isoform CRA_d"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170941.0
FT                   protein_id=mCP93859.0 isoform=CRA_d"
FT                   /protein_id="EDL05993.1"
FT                   /translation="LWLVWFCWAHSSVGSDQTLTVHSPLTSHPAPTTTLSSATIATRRT
FT                   TTCNSRPLPYHRVGPRRSPLQLAF"
FT   CDS             complement(join(1352790..1352927,1400109..1400672))
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170939.0
FT                   protein_id=mCP93857.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5HZH3"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="MGI:MGI:88139"
FT                   /db_xref="UniProtKB/TrEMBL:Q5HZH3"
FT                   /protein_id="EDL05990.1"
FT                   /translation="MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAER
FT                   ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLV
FT                   SRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAG
FT                   VVLLGSLFSRK"
FT   assembly_gap    1393850..1393930
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    1408500..1408519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1414551..1414570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1418673..1466390
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /note="gene_id=mCG3724.2"
FT   mRNA            join(1418673..1418987,1425513..1425607,1437683..1437853,
FT                   1440143..1440265,1443580..1443706,1446031..1446162,
FT                   1447057..1447182,1450590..1450711,1451502..1451653,
FT                   1452734..1452868,1454339..1454507,1456320..1456458,
FT                   1457157..1457373,1460245..1460337,1461288..1461464,
FT                   1462629..1462775,1463581..1463692,1464251..1464438,
FT                   1465735..1466389)
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), transcript variant mCT2819"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT2819.2 created on
FT                   24-JUL-2002"
FT   mRNA            join(1418674..1418799,1425513..1425596,1437683..1437853,
FT                   1440143..1440265,1443580..1443706,1446031..1446162,
FT                   1447057..1447182,1450590..1450711,1451502..1451653,
FT                   1454339..1454507,1456320..1456458,1457157..1457373,
FT                   1460245..1460337,1461288..1461464,1462629..1462775,
FT                   1463581..1463692,1464251..1464438,1465735..1466390)
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), transcript variant mCT170930"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT170930.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(<1418698..1418799,1425513..1425594,1437683..1437853,
FT                   1440143..1440265,1443580..1443706,1446031..1446162,
FT                   1447057..1447182,1450590..1450711,1451502..1451653,
FT                   1454339..1454507,1456320..1456458,1457157..1457373,
FT                   1460245..1460337,1461288..1461464,1462629..1462775,
FT                   1463581..1463692,1464251..1464438,1465735..1466170)
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), transcript variant mCT189899"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT189899.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<1418753..1418987,1425513..1425596,1437683..1437853,
FT                   1440143..1440265,1443580..1443706,1446031..1446162,
FT                   1447057..1447182,1450590..1450711,1451502..1451653,
FT                   1454339..1454507,1456320..1456458,1457157..1457373,
FT                   1460245..1460337,1461288..1461464,1462629..1462775,
FT                   1463581..1463692,1464251..1464438,1465735..1466169)
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), transcript variant mCT189900"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT189900.0 created
FT                   on 08-MAR-2004"
FT   assembly_gap    1422538..1422691
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    1427487..1427569
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    1437450..1437556
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   CDS             join(<1437739..1437853,1440143..1440265,1443580..1443706,
FT                   1446031..1446162,1447057..1447182,1450590..1450711,
FT                   1451502..1451653,1454339..1454507,1456320..1456458,
FT                   1457157..1457373,1460245..1460337,1461288..1461464,
FT                   1462629..1462775,1463581..1463692,1464251..1464438,
FT                   1465735..1465842)
FT                   /codon_start=1
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), isoform CRA_b"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT189899.0
FT                   protein_id=mCP110887.0 isoform=CRA_b"
FT                   /protein_id="EDL05995.1"
FT                   /translation="VGAMSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLE
FT                   NKFLRQRGIGEPFQGKNSLRKAKLQQGFVTPLKAVDNTYHKETEKENLQKQSIPSNDCS
FT                   SLDAKRAVSGNTPVQPQRRSIRLSAQKDLEQKEKNHVASVEMKAKRCVAPATDCPPQKR
FT                   MKVSHKKKLEEEEEGSAPATSRKNERETLEKAKGKHTVPGVPPAREKVLKSTEEQEIEK
FT                   RLRMQQEVVELRRKNEEFKKLALAGPGQPVKKSTSQVTKTVDFHFLTDERIKQHPKNQE
FT                   EYKEVNFMSELRKHSSTPARGTRGCTIIKPFNLSKGKKRTFDEAASTYVPIAQQVEAFH
FT                   KRTPNRYHLRNKKDESLLPSKSVNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEK
FT                   LQQYKFKARELDPRIFESGPILPKRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQF
FT                   EFHSRPCPTKILEDVVGVPEKKVIPATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQP
FT                   VPHYGVPYKPHIAEARNVEVCPFSFDTRDKERQLQKEKKIKEMQKGEVPKFKALPVPHF
FT                   DTINLPEKKVKNVTQAEPFSLETDKRGAYKAEMWKHQLEEEQKQQKDAACFKARPNTVI
FT                   FQEPFVPKKEKKSLAENPSGSLVQEPFQLATERRAKERQELEKKMAEVEAWKLQQLEEV
FT                   RQQEEEQQKEELARLRKELVHKANPIRKYAAVEVKSSELPLTVPVSPKFSTRFQ"
FT   CDS             join(<1437739..1437853,1440143..1440265,1443580..1443706,
FT                   1446031..1446162,1447057..1447182,1450590..1450711,
FT                   1451502..1451653,1454339..1454507,1456320..1456458,
FT                   1457157..1457373,1460245..1460337,1461288..1461464,
FT                   1462629..1462775,1463581..1463692,1464251..1464438,
FT                   1465735..1465842)
FT                   /codon_start=1
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), isoform CRA_b"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT189900.0
FT                   protein_id=mCP110888.0 isoform=CRA_b"
FT                   /protein_id="EDL05996.1"
FT                   /translation="VGAMSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLE
FT                   NKFLRQRGIGEPFQGKNSLRKAKLQQGFVTPLKAVDNTYHKETEKENLQKQSIPSNDCS
FT                   SLDAKRAVSGNTPVQPQRRSIRLSAQKDLEQKEKNHVASVEMKAKRCVAPATDCPPQKR
FT                   MKVSHKKKLEEEEEGSAPATSRKNERETLEKAKGKHTVPGVPPAREKVLKSTEEQEIEK
FT                   RLRMQQEVVELRRKNEEFKKLALAGPGQPVKKSTSQVTKTVDFHFLTDERIKQHPKNQE
FT                   EYKEVNFMSELRKHSSTPARGTRGCTIIKPFNLSKGKKRTFDEAASTYVPIAQQVEAFH
FT                   KRTPNRYHLRNKKDESLLPSKSVNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEK
FT                   LQQYKFKARELDPRIFESGPILPKRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQF
FT                   EFHSRPCPTKILEDVVGVPEKKVIPATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQP
FT                   VPHYGVPYKPHIAEARNVEVCPFSFDTRDKERQLQKEKKIKEMQKGEVPKFKALPVPHF
FT                   DTINLPEKKVKNVTQAEPFSLETDKRGAYKAEMWKHQLEEEQKQQKDAACFKARPNTVI
FT                   FQEPFVPKKEKKSLAENPSGSLVQEPFQLATERRAKERQELEKKMAEVEAWKLQQLEEV
FT                   RQQEEEQQKEELARLRKELVHKANPIRKYAAVEVKSSELPLTVPVSPKFSTRFQ"
FT   CDS             join(1437748..1437853,1440143..1440265,1443580..1443706,
FT                   1446031..1446162,1447057..1447182,1450590..1450711,
FT                   1451502..1451653,1452734..1452868,1454339..1454507,
FT                   1456320..1456458,1457157..1457373,1460245..1460337,
FT                   1461288..1461464,1462629..1462775,1463581..1463692,
FT                   1464251..1464438,1465735..1465842)
FT                   /codon_start=1
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), isoform CRA_c"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT2819.2
FT                   protein_id=mCP7976.2 isoform=CRA_c"
FT                   /protein_id="EDL05997.1"
FT                   /translation="MSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLENKF
FT                   LRQRGIGEPFQGKNSLRKAKLQQGFVTPLKAVDNTYHKETEKENLQKQSIPSNDCSSLD
FT                   AKRAVSGNTPVQPQRRSIRLSAQKDLEQKEKNHVASVEMKAKRCVAPATDCPPQKRMKV
FT                   SHKKKLEEEEEGSAPATSRKNERETLEKAKGKHTVPGVPPAREKVLKSTEEQEIEKRLR
FT                   MQQEVVELRRKNEEFKKLALAGPGQPVKKSTSQVTKTVDFHFLTDERIKQHPKNQEEYK
FT                   EVNFMSELRKHSSTPSTSQVTKTVDFHFLTDERIKQHPKNQEEYKEVNFMSELRKHSST
FT                   PARGTRGCTIIKPFNLSKGKKRTFDEAASTYVPIAQQVEAFHKRTPNRYHLRNKKDESL
FT                   LPSKSVNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEKLQQYKFKARELDPRIFE
FT                   SGPILPKRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQFEFHSRPCPTKILEDVVG
FT                   VPEKKVIPATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQPVPHYGVPYKPHIAEARN
FT                   VEVCPFSFDTRDKERQLQKEKKIKEMQKGEVPKFKALPVPHFDTINLPEKKVKNVTQAE
FT                   PFSLETDKRGAYKAEMWKHQLEEEQKQQKDAACFKARPNTVIFQEPFVPKKEKKSLAEN
FT                   PSGSLVQEPFQLATERRAKERQELEKKMAEVEAWKLQQLEEVRQQEEEQQKEELARLRK
FT                   ELVHKANPIRKYAAVEVKSSELPLTVPVSPKFSTRFQ"
FT   CDS             join(1437748..1437853,1440143..1440265,1443580..1443706,
FT                   1446031..1446162,1447057..1447182,1450590..1450711,
FT                   1451502..1451653,1454339..1454507,1456320..1456458,
FT                   1457157..1457373,1460245..1460337,1461288..1461464,
FT                   1462629..1462775,1463581..1463692,1464251..1464438,
FT                   1465735..1465842)
FT                   /codon_start=1
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), isoform CRA_a"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT170930.0
FT                   protein_id=mCP93848.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2APB8"
FT                   /db_xref="InterPro:IPR009675"
FT                   /db_xref="InterPro:IPR015128"
FT                   /db_xref="InterPro:IPR027329"
FT                   /db_xref="InterPro:IPR027330"
FT                   /db_xref="MGI:MGI:1919369"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2APB8"
FT                   /protein_id="EDL05994.1"
FT                   /translation="MSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLENKF
FT                   LRQRGIGEPFQGKNSLRKAKLQQGFVTPLKAVDNTYHKETEKENLQKQSIPSNDCSSLD
FT                   AKRAVSGNTPVQPQRRSIRLSAQKDLEQKEKNHVASVEMKAKRCVAPATDCPPQKRMKV
FT                   SHKKKLEEEEEGSAPATSRKNERETLEKAKGKHTVPGVPPAREKVLKSTEEQEIEKRLR
FT                   MQQEVVELRRKNEEFKKLALAGPGQPVKKSTSQVTKTVDFHFLTDERIKQHPKNQEEYK
FT                   EVNFMSELRKHSSTPARGTRGCTIIKPFNLSKGKKRTFDEAASTYVPIAQQVEAFHKRT
FT                   PNRYHLRNKKDESLLPSKSVNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEKLQQ
FT                   YKFKARELDPRIFESGPILPKRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQFEFH
FT                   SRPCPTKILEDVVGVPEKKVIPATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQPVPH
FT                   YGVPYKPHIAEARNVEVCPFSFDTRDKERQLQKEKKIKEMQKGEVPKFKALPVPHFDTI
FT                   NLPEKKVKNVTQAEPFSLETDKRGAYKAEMWKHQLEEEQKQQKDAACFKARPNTVIFQE
FT                   PFVPKKEKKSLAENPSGSLVQEPFQLATERRAKERQELEKKMAEVEAWKLQQLEEVRQQ
FT                   EEEQQKEELARLRKELVHKANPIRKYAAVEVKSSELPLTVPVSPKFSTRFQ"
FT   assembly_gap    1452709..1452728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1453791..1453810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1474714..1474733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1483789..1495573
FT                   /locus_tag="mCG_3723"
FT                   /note="gene_id=mCG3723.2"
FT   mRNA            join(1483789..1484038,1484479..1484953,1485870..1486165,
FT                   1487555..1487660,1488076..1488169,1489775..1489884,
FT                   1489966..1490107,1491590..1491660,1491815..1491943,
FT                   1492798..1492950,1493033..1493165,1494588..1495573)
FT                   /locus_tag="mCG_3723"
FT                   /product="mCG3723"
FT                   /note="gene_id=mCG3723.2 transcript_id=mCT2823.2 created on
FT                   24-JUL-2002"
FT   CDS             join(1483987..1484038,1484479..1484953,1485870..1486165,
FT                   1487555..1487660,1488076..1488169,1489775..1489884,
FT                   1489966..1490107,1491590..1491660,1491815..1491943,
FT                   1492798..1492950,1493033..1493165,1494588..1494668)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3723"
FT                   /product="mCG3723"
FT                   /note="gene_id=mCG3723.2 transcript_id=mCT2823.2
FT                   protein_id=mCP7975.2"
FT                   /db_xref="GOA:B2RXZ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="MGI:MGI:2139434"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXZ9"
FT                   /protein_id="EDL05998.1"
FT                   /translation="MTTENGAVELGSQSLSTEQTPKAAAGDGPSASEKEPSAPATEKDL
FT                   SPPNAKKDPGAPDPKNNPDPPSLKKDPAKAPGPEKKGDPVPASASSQGPSGEGDGGGGP
FT                   AEGSEGPPAALPLPTATAEASIQKLDPTQAPSGNQGSGEAKAGKKAAECREAGRRGSPA
FT                   FLHSPSCPAIISCSEKTLAVKPLSETTDLVFTGVSVTPDPQDPGPVKAGGTNALAEKKK
FT                   EEAEKASGQAGQAKAQGDTPQRIGFQAVPSERVEVGQALCLTAREEDCFQILDDCPPPP
FT                   APFPHRIVELRTGNVNSEFSMNSKEALGGGKFGAVCTCTERATGLKLAAKVIKKQTPKD
FT                   KEMVLLEIEVMNQLNHRNLIQLYAAIETSHEIILFMEYIEGGELFERIVDEDYHLTEVD
FT                   TMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKV
FT                   NFGTPEFLSPEVVNYDQISDKTDMWSLGVITYMLLSGLSPFLGDDDTETLNNVLSANWY
FT                   FDEETFEAVSDEAKDFVSNLLTKDQSARMSAEQCLAHPWLNNLAEKAKRCNRRLKSQIL
FT                   LKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV"
FT   assembly_gap    1491675..1491779
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            complement(1504410..>1505722)
FT                   /gene="Fkhl18"
FT                   /locus_tag="mCG_1027892"
FT                   /note="gene_id=mCG1027892.1"
FT   mRNA            complement(1504410..>1505722)
FT                   /gene="Fkhl18"
FT                   /locus_tag="mCG_1027892"
FT                   /product="forkhead-like 18 (Drosophila)"
FT                   /note="gene_id=mCG1027892.1 transcript_id=mCT145596.1
FT                   created on 24-JUL-2002"
FT   CDS             complement(1504655..>1505719)
FT                   /codon_start=1
FT                   /gene="Fkhl18"
FT                   /locus_tag="mCG_1027892"
FT                   /product="forkhead-like 18 (Drosophila)"
FT                   /note="gene_id=mCG1027892.1 transcript_id=mCT145596.1
FT                   protein_id=mCP73010.1"
FT                   /protein_id="EDL05999.1"
FT                   /translation="QPGQPVQIASSEYRAWLCGVSNTASMQKQPSPESLAPSAEPTKPP
FT                   YSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKV
FT                   PRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPVKIDHRPHRATS
FT                   PDPGAPKTTTGRLCPFPQEVPNPKGLSFEGLMGSLPANMSSTTSDVRPQLPTGPKEMCS
FT                   AKSGGPRELSEATSPSPCPAFGFSSAFSDAESLGKAPTPGVAPESVGSSYQCRMQTLNF
FT                   CMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVAGSFPVQGGSGYPLGL
FT                   PPCLYRTPGMFFFE"
FT   gene            complement(1513538..>1514675)
FT                   /locus_tag="mCG_1027971"
FT                   /note="gene_id=mCG1027971.1"
FT   mRNA            complement(1513538..>1514261)
FT                   /locus_tag="mCG_1027971"
FT                   /product="mCG1027971, transcript variant mCT170922"
FT                   /note="gene_id=mCG1027971.1 transcript_id=mCT170922.0
FT                   created on 24-JUL-2002"
FT   mRNA            complement(join(<1513549..1513767,1514603..>1514675))
FT                   /locus_tag="mCG_1027971"
FT                   /product="mCG1027971, transcript variant mCT145675"
FT                   /note="gene_id=mCG1027971.1 transcript_id=mCT145675.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(1513549..1513767,1514603..>1514608))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027971"
FT                   /product="mCG1027971, isoform CRA_a"
FT                   /note="gene_id=mCG1027971.1 transcript_id=mCT145675.0
FT                   protein_id=mCP73161.0 isoform=CRA_a"
FT                   /protein_id="EDL06000.1"
FT                   /translation="KKLLAYGTKRKRNKNALPPVLVKGRPDSPPLSMLAGTAAALGDFF
FT                   FLLELQFYLQQGLGQPELLNTFHSANISS"
FT   CDS             complement(1513549..>1513800)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027971"
FT                   /product="mCG1027971, isoform CRA_b"
FT                   /note="gene_id=mCG1027971.1 transcript_id=mCT170922.0
FT                   protein_id=mCP93840.0 isoform=CRA_b"
FT                   /protein_id="EDL06001.1"
FT                   /translation="VDSVCMNFMGQLLAYGTKRKRNKNALPPVLVKGRPDSPPLSMLAG
FT                   TAAALGDFFFLLELQFYLQQGLGQPELLNTFHSANISS"
FT   gene            complement(1515425..>1524086)
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /note="gene_id=mCG3728.2"
FT   mRNA            complement(join(1515425..1515985,1516683..1516854,
FT                   1517959..1518033,1518820..1518869,1521566..1521648,
FT                   1523149..1523182,1523842..1524033))
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /product="dual specificity phosphatase-like 15, transcript
FT                   variant mCT2817"
FT                   /note="gene_id=mCG3728.2 transcript_id=mCT2817.2 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(1515713..1515985,1516683..1516854,
FT                   1517959..1518033,1518820..1518869,1521566..1521648,
FT                   1523149..1523182,1523842..1523862))
FT                   /codon_start=1
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /product="dual specificity phosphatase-like 15, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3728.2 transcript_id=mCT2817.2
FT                   protein_id=mCP7980.2 isoform=CRA_a"
FT                   /protein_id="EDL06002.1"
FT                   /translation="MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIISIHESPQPLL
FT                   QDITYLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVHCFAGISRSTTIVIAYVM
FT                   TVTGLGWQEVLEAIKASRPIANPNPGFRQQLEEFGWANSQKLRRQLEERFGEIPFRDEE
FT                   DLRALLPLCRRCRQGSATSAASATTASSAAEGTLQRLVPRSPRDSHQPLPLLARVKQTF
FT                   FCLPRCLSRKGGK"
FT   mRNA            complement(join(<1517959..1518033,1518820..1518869,
FT                   1521566..1521648,1523842..>1524086))
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /product="dual specificity phosphatase-like 15, transcript
FT                   variant mCT170938"
FT                   /note="gene_id=mCG3728.2 transcript_id=mCT170938.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(<1517959..1518033,1518820..1518869,
FT                   1521566..1521648,1523842..>1523914))
FT                   /codon_start=1
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /product="dual specificity phosphatase-like 15, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3728.2 transcript_id=mCT170938.0
FT                   protein_id=mCP93856.0 isoform=CRA_b"
FT                   /protein_id="EDL06003.1"
FT                   /translation="RLEGAKIGVRPATLPQDHGEWHDQDAKDPDQLGRNKITHIISIHE
FT                   SPQPLLQDITYLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVH"
FT   gene            1534955..1591344
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /note="gene_id=mCG140714.0"
FT   mRNA            join(1534955..1535081,1545056..1545099,1548915..1549007,
FT                   1555806..1555917,1556887..1557072,1573588..1573656,
FT                   1574018..1574092,1575571..1575661,1577162..1577202,
FT                   1578049..1578136,1583312..1583370,1584114..1584310,
FT                   1586208..1586321,1586862..1587194)
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /product="tubulin tyrosine ligase like family 9, transcript
FT                   variant mCT170926"
FT                   /note="gene_id=mCG140714.0 transcript_id=mCT170926.0
FT                   created on 24-JUL-2002"
FT   mRNA            join(<1535031..1535081,1545056..1545099,1548915..1549007,
FT                   1555806..1555917,1556887..1557072,1573588..1573656,
FT                   1574018..1574092,1575571..1575661,1577162..1577202,
FT                   1578049..1578136,1583312..1583370,1584114..1584310,
FT                   1586208..1586321,1586862..1586986,1590855..1591344)
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /product="tubulin tyrosine ligase like family 9, transcript
FT                   variant mCT170927"
FT                   /note="gene_id=mCG140714.0 transcript_id=mCT170927.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<1535034..1535081,1545056..1545099,1548915..1549007,
FT                   1555806..1555917,1556887..1557072,1573588..1573656,
FT                   1574018..1574092,1575571..1575661,1577162..1577202,
FT                   1578049..1578136,1583312..1583370,1584114..1584310,
FT                   1586208..1586321,1586862..1586986,1590855..1590931)
FT                   /codon_start=1
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /product="tubulin tyrosine ligase like family 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140714.0 transcript_id=mCT170927.0
FT                   protein_id=mCP93846.0 isoform=CRA_a"
FT                   /protein_id="EDL06004.1"
FT                   /translation="GARGGLVWAQLMSRQKNQNSKGHGVSKGKEREQRTLIRFKTTLMN
FT                   TLMDVLRHRPGWVEVKDEGEWDFYWCDVSWLRENFDHTYMDEHVRISHFRNHYELTRKN
FT                   YMVKNLKRFRKYLERESGKTEAAKCDFFPKTFEMPCEYHLFVEEFRKNPGITWIMKPVA
FT                   RSQGKGIFLFRRLKDIMDWRKGTSGKKPTGVETQPARANMNPSGSHDTRSSDDQKDDLP
FT                   VENYVAQRYVENPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDD
FT                   HYVHLTNVAVQKTSPDYHLKKGCKWMLQRFRQYLASKHGPKAVETLFSDMDNIFIKSLQ
FT                   SVQKVIISDKHCFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLH
FT                   VVDMEARLTGKEKRVGGFDLMWNDGPVSREDGPSDLSGMGNFVTNTHLGCVNDRKEQLR
FT                   QLFRSLQAQRKAPS"
FT   CDS             join(1535067..1535081,1545056..1545099,1548915..1549007,
FT                   1555806..1555917,1556887..1557072,1573588..1573656,
FT                   1574018..1574092,1575571..1575661,1577162..1577202,
FT                   1578049..1578136,1583312..1583370,1584114..1584310,
FT                   1586208..1586321,1586862..1587072)
FT                   /codon_start=1
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /product="tubulin tyrosine ligase like family 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG140714.0 transcript_id=mCT170926.0
FT                   protein_id=mCP93844.0 isoform=CRA_b"
FT                   /protein_id="EDL06005.1"
FT                   /translation="MSRQKNQNSKGHGVSKGKEREQRTLIRFKTTLMNTLMDVLRHRPG
FT                   WVEVKDEGEWDFYWCDVSWLRENFDHTYMDEHVRISHFRNHYELTRKNYMVKNLKRFRK
FT                   YLERESGKTEAAKCDFFPKTFEMPCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFR
FT                   RLKDIMDWRKGTSGKKPTGVETQPARANMNPSGSHDTRSSDDQKDDLPVENYVAQRYVE
FT                   NPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDDHYVHLTNVAVQ
FT                   KTSPDYHLKKGCKWMLQRFRQYLASKHGPKAVETLFSDMDNIFIKSLQSVQKVIISDKH
FT                   CFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLHVVDMEARLTGK
FT                   EKRVGGFDLMWNDGPVSREDGPSDLSGMGNFVTNTHLGTLSQTGSEWERNIIGSGGGLG
FT                   PLGRAV"
FT   assembly_gap    1536464..1536835
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    1543440..1544010
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    1549362..1549441
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1558178..1558422
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    1561515..1561534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1562628..1571271
FT                   /estimated_length=8644
FT                   /gap_type="unknown"
FT   assembly_gap    1572330..1572349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1578157..1578229
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1584577..1585195
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   gene            complement(1592833..1599346)
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /note="gene_id=mCG3726.1"
FT   mRNA            complement(join(1592833..1593680,1594202..1594282,
FT                   1596325..1596399,1597954..1598029,1599189..1599346))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT2815"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT2815.2 created on
FT                   10-JAN-2003"
FT   mRNA            complement(join(1592836..1593680,1594202..1594282,
FT                   1596325..1596399,1597954..1598029,1599163..>1599245))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT170931"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170931.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(1593256..1593680,1594202..1594282,
FT                   1596325..1596396,1597954..1598029,1599189..>1599262))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT170932"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170932.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(1593337..1593680,1594202..1594282,
FT                   1597954..1598029,1599189..>1599285))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT170933"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170933.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(1593448..1593680,1594202..1594282,
FT                   1596325..1596396,1597961..1598029,1599189..>1599291))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT178304"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT178304.0 created
FT                   on 10-JAN-2003"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1596325..1596396,1597961..1598029,1599189..>1599291))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_c"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT178304.0
FT                   protein_id=mCP101226.0 isoform=CRA_c"
FT                   /protein_id="EDL06008.1"
FT                   /translation="RGAWHHAVPRGGAGAAVPGRSRGVGRGRAVGQAADCRPGHQEESE
FT                   PRGPEGPTEGPEYVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRL
FT                   FEAQGKPELKGFNLNPLSPDEVKALKVILKG"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1597954..1598029,1599189..>1599284))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_b"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170933.0
FT                   protein_id=mCP93850.0 isoform=CRA_b"
FT                   /protein_id="EDL06007.1"
FT                   /translation="RGTMLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNRE
FT                   GLRALQKDLSVSDQEHLDKEIERLRSQLKVKVNRLFEAQGKPELKGFNLNPLSPDEVKA
FT                   LKVILKG"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1596325..1596399,1597954..1598029,1599189..1599275))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_d"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT2815.2
FT                   protein_id=mCP7978.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q3UKN2"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR030482"
FT                   /db_xref="MGI:MGI:1915809"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UKN2"
FT                   /protein_id="EDL06009.1"
FT                   /translation="MLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLR
FT                   ALQKDLSVSEDVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFE
FT                   AQGKPELKGFNLNPLSPDEVKALKVILKG"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1596325..1596396,1597954..1598029,1599189..>1599260))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_a"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170932.0
FT                   protein_id=mCP93849.0 isoform=CRA_a"
FT                   /protein_id="EDL06006.1"
FT                   /translation="AERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKD
FT                   LSVSDVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFEAQGKPE
FT                   LKGFNLNPLSPDEVKALKVILKG"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1596325..1596399,1597954..1598029,1599163..>1599243))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_e"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170931.0
FT                   protein_id=mCP93851.0 isoform=CRA_e"
FT                   /protein_id="EDL06010.1"
FT                   /translation="VPGRSRGVGRGRAVGQAAGERRGGCERIVDLDTKRNQNREGLRAL
FT                   QKDLSVSEDVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFEAQ
FT                   GKPELKGFNLNPLSPDEVKALKVILKG"
FT   assembly_gap    1605618..1605765
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    1607469..1607488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1609127..1609146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1610734..1611091
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    1612198..1612217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1617782..>1640535
FT                   /gene="Xkr7"
FT                   /locus_tag="mCG_140715"
FT                   /note="gene_id=mCG140715.0"
FT   mRNA            join(<1617782..1618206,1638276..1638478,1639580..>1640535)
FT                   /gene="Xkr7"
FT                   /locus_tag="mCG_140715"
FT                   /product="X Kell blood group precursor related family
FT                   member 7 homolog"
FT                   /note="gene_id=mCG140715.0 transcript_id=mCT170928.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<1617782..1618206,1638276..1638478,1639580..1640535)
FT                   /codon_start=1
FT                   /gene="Xkr7"
FT                   /locus_tag="mCG_140715"
FT                   /product="X Kell blood group precursor related family
FT                   member 7 homolog"
FT                   /note="gene_id=mCG140715.0 transcript_id=mCT170928.0
FT                   protein_id=mCP93845.0"
FT                   /protein_id="EDL06011.1"
FT                   /translation="LRDCCWVLCALLVFFSDGATDLWLAASYYLQGQSTYFGLTLLFVL
FT                   LPSLVVQLLSFRWFVYDYSEPAGTPGPAVSTKDSDIVGAAISTKDSAVAFRTKEGSAEL
FT                   VPRPAPSSAGTYRRRCCRLCVWLLQTLVHLLQLGQVWRYLRALYLGLQSRWRGERLRRH
FT                   FYWQMLFESADVSMLRLLETFLRSAPQLVLQLSLLVHRGREPELLTALSISASLVSLAW
FT                   TLASYQKVLRDSRDDKRPLSYKGAVVQVLWHLFTIAARTLAFALFASVYKLYFGIFIVA
FT                   HWCIMTFWVIQGETDFCMSKWEEIIYNMVVGIIYIFCWFNVKEGRSRRRVTLYYCIVLL
FT                   ENAALTGFWYSSRNFSTDFYSLILVCVVASSFALGIFFMCVYYCLLHPNGPMLGPQAPG
FT                   CIFPEAPGPCGPPADAITSPPRSLPRTTGTERDGVAVGGERAGTPTLPVFQVRPGLPPT
FT                   PVARPLRTEGPVIRIDLPRKKYPAWDAHFIDRRLRKTILALEYSSPATPRLQYRSMGTS
FT                   QELLEYETTV"
FT   assembly_gap    1640585..1640613
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            <1651519..1667972
FT                   /gene="BC020535"
FT                   /locus_tag="mCG_119792"
FT                   /note="gene_id=mCG119792.1"
FT   mRNA            join(<1651519..1651601,1653402..1653569,1656314..1656397,
FT                   1656495..1656689,1657431..1657885,1660560..1660698,
FT                   1665094..1665223,1666006..1666144,1667128..1667972)
FT                   /gene="BC020535"
FT                   /locus_tag="mCG_119792"
FT                   /product="cDNA sequence BC020535"
FT                   /note="gene_id=mCG119792.1 transcript_id=mCT120970.1
FT                   created on 24-JUL-2002"
FT   assembly_gap    1653249..1653325
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   CDS             join(<1656674..1656689,1657431..1657885,1660560..1660698,
FT                   1665094..1665223,1666006..1666144,1667128..1667247)
FT                   /codon_start=1
FT                   /gene="BC020535"
FT                   /locus_tag="mCG_119792"
FT                   /product="cDNA sequence BC020535"
FT                   /note="gene_id=mCG119792.1 transcript_id=mCT120970.1
FT                   protein_id=mCP72960.1"
FT                   /protein_id="EDL06012.1"
FT                   /translation="DWCGAGLGVDPVPAGMDGSPGGSGRDPGPPGAAPEKRRVGTAERR
FT                   HTICSLDWRVAWGGGAGAEARAAGGGGSLERQRAGARASGSWERRQTFSGSWERRHAGG
FT                   GAGKPGGSWERRQASGGVGGSWERRHPGPNPLDPQNHSPDAYCNLVILAVANRDAAEES
FT                   CALICQVFQIIYGDQSIECVDRAGYHYRSTPKRPWLSSCSAMAPRTHLKRATVAHPHRL
FT                   STAPTAAVSTTAAGPSSSYRITWSRCGVSWVLLRSSSLHCCYETIAWGCLSRTTVQVCR
FT                   NSMGTDGSSFSLECGPSSQIRTSATSRASWRVWVSARAESSPTASAASSGA"
FT   assembly_gap    1658759..1658778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662087..1662106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662733..1663880
FT                   /estimated_length=1148
FT                   /gap_type="unknown"
FT   assembly_gap    1666277..1666296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1688863..1732539
FT                   /gene="Hck"
FT                   /locus_tag="mCG_119794"
FT                   /note="gene_id=mCG119794.0"
FT   mRNA            join(1688863..1689787,1705213..1705330,1709321..1709363,
FT                   1710101..1710200,1710899..1710997,1712259..1712362,
FT                   1715083..1715232,1715638..1715790,1717721..1717900,
FT                   1719286..1719362,1725431..1725584,1729978..1730109,
FT                   1732048..1732539)
FT                   /gene="Hck"
FT                   /locus_tag="mCG_119794"
FT                   /product="hemopoietic cell kinase"
FT                   /note="gene_id=mCG119794.0 transcript_id=mCT120972.0
FT                   created on 24-JUL-2002"
FT   CDS             join(1705214..1705330,1709321..1709363,1710101..1710200,
FT                   1710899..1710997,1712259..1712362,1715083..1715232,
FT                   1715638..1715790,1717721..1717900,1719286..1719362,
FT                   1725431..1725584,1729978..1730109,1732048..1732250)
FT                   /codon_start=1
FT                   /gene="Hck"
FT                   /locus_tag="mCG_119794"
FT                   /product="hemopoietic cell kinase"
FT                   /note="gene_id=mCG119794.0 transcript_id=mCT120972.0
FT                   protein_id=mCP72988.1"
FT                   /protein_id="EDL06013.1"
FT                   /translation="MGCVKSRFLRDGSKASKTEPSANQKGPVYVPDPTSSSKLGPNNSN
FT                   SMPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGEWWKARSLATKKEGY
FT                   IPSNYVARVNSLETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRD
FT                   FDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVLHYKKGKDGLCQKLSVPCVSPK
FT                   PQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLA
FT                   EANLMKSLQHDKLVKLHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSA
FT                   QISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
FT                   WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDN
FT                   CPEELYNIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP"
FT   gene            1742308..1792078
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /note="gene_id=mCG10481.2"
FT   mRNA            join(1742308..1742578,1759682..1759795,1763181..1763280,
FT                   1768051..1768219,1768319..1768451,1769742..1769865,
FT                   1771619..1771737,1771839..1771950,1772718..1772788,
FT                   1775070..1775202,1776102..1776183,1776281..1776356,
FT                   1779138..1779221,1781433..1781608,1783132..1783195,
FT                   1784574..1784693,1785327..1785416,1790209..1792078)
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   transcript variant mCT11069"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT11069.2 created
FT                   on 04-APR-2003"
FT   mRNA            join(1742308..1742578,1759682..1759795,1763181..1763280,
FT                   1768051..1768219,1768319..1768451,1769742..1769865,
FT                   1771619..1771737,1771839..1771950,1772718..1772788,
FT                   1775070..1775202,1776102..1776183,1776281..1776356,
FT                   1779138..1779221,1781433..1781608,1783132..1783195,
FT                   1784574..1784693,1785327..1785654)
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   transcript variant mCT181612"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT181612.0 created
FT                   on 04-APR-2003"
FT   CDS             join(1742564..1742578,1759682..1759795,1763181..1763280,
FT                   1768051..1768219,1768319..1768451,1769742..1769865,
FT                   1771619..1771737,1771839..1771950,1772718..1772788,
FT                   1775070..1775202,1776102..1776183,1776281..1776356,
FT                   1779138..1779221,1781433..1781608,1783132..1783195,
FT                   1784574..1784693,1785327..1785416,1790209..1790358)
FT                   /codon_start=1
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT11069.2
FT                   protein_id=mCP18241.1 isoform=CRA_b"
FT                   /protein_id="EDL06015.1"
FT                   /translation="MAAAMIWWPRFLLLLCLTCKGSTFYVPGVAPINFHQNDPVEIKAV
FT                   KLTSSRTQLPYEYYSLPFCQPIKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLC
FT                   NQSNKPITLTVEQSRLVAERITEEYYVHLIADNLPVATRLELYSSNRDSDDKKKEKDVQ
FT                   FEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKT
FT                   GEKSSCTLPEGANSLPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHW
FT                   FSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQ
FT                   YPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAG
FT                   RLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWF
FT                   GISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFI
FT                   ELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVS
FT                   GGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTTLMVLSFWLLTGTIGFYAAYMFVRK
FT                   IYAAVKID"
FT   CDS             join(1742564..1742578,1759682..1759795,1763181..1763280,
FT                   1768051..1768219,1768319..1768451,1769742..1769865,
FT                   1771619..1771737,1771839..1771950,1772718..1772788,
FT                   1775070..1775202,1776102..1776183,1776281..1776356,
FT                   1779138..1779221,1781433..1781608,1783132..1783195,
FT                   1784574..1784693,1785327..1785443)
FT                   /codon_start=1
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT181612.0
FT                   protein_id=mCP104534.0 isoform=CRA_c"
FT                   /protein_id="EDL06016.1"
FT                   /translation="MAAAMIWWPRFLLLLCLTCKGSTFYVPGVAPINFHQNDPVEIKAV
FT                   KLTSSRTQLPYEYYSLPFCQPIKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLC
FT                   NQSNKPITLTVEQSRLVAERITEEYYVHLIADNLPVATRLELYSSNRDSDDKKKEKDVQ
FT                   FEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKT
FT                   GEKSSCTLPEGANSLPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHW
FT                   FSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQ
FT                   YPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAG
FT                   RLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWF
FT                   GISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFI
FT                   ELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVS
FT                   GGSAFYVLVYAIFYFVNKVLPSQRSP"
FT   mRNA            join(<1759682..1759795,1763181..1763280,1768051..1768219,
FT                   1768319..1768451,1769742..1769837,1771619..1771737,
FT                   1771839..1771950,1772718..1774324)
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   transcript variant mCT181613"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT181613.0 created
FT                   on 04-APR-2003"
FT   CDS             join(<1759682..1759795,1763181..1763280,1768051..1768219,
FT                   1768319..1768451,1769742..1769837,1771619..1771737,
FT                   1771839..1771881)
FT                   /codon_start=1
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT181613.0
FT                   protein_id=mCP104535.0 isoform=CRA_a"
FT                   /protein_id="EDL06014.1"
FT                   /translation="IWWPRFLLLLCLTCKGSTFYVPGVAPINFHQNDPVEIKAVKLTSS
FT                   RTQLPYEYYSLPFCQPIKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCNQSNK
FT                   PITLTVEQSRLVAERITEEYYVHLIADNLPVATRLELYSSNRDSDDKKKEKDVQFEHGY
FT                   RLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFETSKQARRVHVPYPRVPTP
FT                   YPKKLTPLRRISCTSPTLCTGRKVTSNGPLDGTLT"
FT   gene            complement(1777485..>1777811)
FT                   /locus_tag="mCG_140712"
FT                   /note="gene_id=mCG140712.0"
FT   mRNA            complement(1777485..>1777811)
FT                   /locus_tag="mCG_140712"
FT                   /product="mCG140712"
FT                   /note="gene_id=mCG140712.0 transcript_id=mCT170923.0
FT                   created on 25-JUL-2002"
FT   CDS             complement(1777555..>1777809)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140712"
FT                   /product="mCG140712"
FT                   /note="gene_id=mCG140712.0 transcript_id=mCT170923.0
FT                   protein_id=mCP93841.0"
FT                   /protein_id="EDL06017.1"
FT                   /translation="SPKLRVSTLSIRHPTNMDQVMQFVEPSRQFVKDSIRMVKRCTKPD
FT                   RKEFQKIAMATAIGFAIMGFIGFFVKLIHILINNIIVGD"
FT   assembly_gap    1786943..1786962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1801795..1801814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1804629..>1807683)
FT                   /locus_tag="mCG_49000"
FT                   /note="gene_id=mCG49000.1"
FT   mRNA            complement(1804629..>1807683)
FT                   /locus_tag="mCG_49000"
FT                   /product="mCG49000"
FT                   /note="gene_id=mCG49000.1 transcript_id=mCT49183.2 created
FT                   on 25-JUL-2002"
FT   CDS             complement(1806560..>1807567)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49000"
FT                   /product="mCG49000"
FT                   /note="gene_id=mCG49000.1 transcript_id=mCT49183.2
FT                   protein_id=mCP38872.2"
FT                   /protein_id="EDL06018.1"
FT                   /translation="VMAWEGIGVLEATMCLPPIQERDAHPARPRVPGAEPLRPCNPAAS
FT                   PATAPPSSENTGENSASRVLNLDGCEKGSGNGVGTKGKTEEVTTEEDSVAAEEPAEVGE
FT                   KLEWVAEAQESLRPLDLRALIVDPLEAIQWELEAMSAQADGAHLQLVRRFGRMRRLHLA
FT                   RRSFIIQNIPGFWVTAFLNHPQLSAMISPRDEDMLGYLMNLEVRELRHSRTGCKFKFLF
FT                   ESNPYFRNEVIVKEYECRASGGVVSIATRILWHRGQEPPALVHRNRDAVRSFFSWFSQH
FT                   SLLEADRVAQIIKDDLWPNPLQYYLLGQRPYRARRSLARWSAEARPRPYGFQSG"
FT   gene            complement(1810005..1823607)
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /note="gene_id=mCG10468.3"
FT   mRNA            complement(join(1810005..1814957,1818042..1818414,
FT                   1823518..1823606))
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /product="pleiomorphic adenoma gene-like 2, transcript
FT                   variant mCT11055"
FT                   /note="gene_id=mCG10468.3 transcript_id=mCT11055.2 created
FT                   on 24-DEC-2002"
FT   mRNA            complement(join(1810670..1812816,1814749..1814957,
FT                   1818042..1818414,1823518..1823607))
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /product="pleiomorphic adenoma gene-like 2, transcript
FT                   variant mCT177787"
FT                   /note="gene_id=mCG10468.3 transcript_id=mCT177787.0 created
FT                   on 24-DEC-2002"
FT   CDS             complement(join(1812782..1812816,1814749..1814957,
FT                   1818042..1818301))
FT                   /codon_start=1
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /product="pleiomorphic adenoma gene-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG10468.3 transcript_id=mCT177787.0
FT                   protein_id=mCP100709.0 isoform=CRA_b"
FT                   /protein_id="EDL06020.1"
FT                   /translation="MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEIS
FT                   GTPFSNGEKLRPHSLPHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCD
FT                   KMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSLQFGFS
FT                   PSTS"
FT   CDS             complement(join(1813727..1814957,1818042..1818301))
FT                   /codon_start=1
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /product="pleiomorphic adenoma gene-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG10468.3 transcript_id=mCT11055.2
FT                   protein_id=mCP18242.2 isoform=CRA_a"
FT                   /protein_id="EDL06019.1"
FT                   /translation="MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEIS
FT                   GTPFSNGEKLRPHSLPHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCD
FT                   KMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQ
FT                   TFENTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQ
FT                   YCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASR
FT                   DVMGAKAFPGMLPMGMYGAHIPTMPSAGMPHSLVHNTLPMGMSYPLESSPISSSAQLPP
FT                   KYQLGSTSYLPDKLPKVEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKS
FT                   PANLSEALCAANVDFSHLLGFLPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQ
FT                   DSAGAGGPLNFGPLHSLPPVFTSGLSTTTLPRFHQAFQ"
FT   gene            1823795..1848230
FT                   /gene="Pofut1"
FT                   /locus_tag="mCG_10480"
FT                   /note="gene_id=mCG10480.2"
FT   mRNA            join(1823795..1823967,1825881..1826002,1830692..1830874,
FT                   1831924..1832036,1841834..1842026,1843450..1843692,
FT                   1847946..1848230)
FT                   /gene="Pofut1"
FT                   /locus_tag="mCG_10480"
FT                   /product="protein O-fucosyltransferase 1"
FT                   /note="gene_id=mCG10480.2 transcript_id=mCT11068.2 created
FT                   on 25-JUL-2002"
FT   CDS             join(1823829..1823967,1825881..1826002,1830692..1830874,
FT                   1831924..1832036,1841834..1842026,1843450..1843692,
FT                   1847946..1848134)
FT                   /codon_start=1
FT                   /gene="Pofut1"
FT                   /locus_tag="mCG_10480"
FT                   /product="protein O-fucosyltransferase 1"
FT                   /note="gene_id=mCG10480.2 transcript_id=mCT11068.2
FT                   protein_id=mCP18253.2"
FT                   /protein_id="EDL06021.1"
FT                   /translation="MGAAAWAPPHLLLRASFLLLLLLLPLRGRSAGSWDLAGYLLYCPC
FT                   MGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAY
FT                   HRVVSLEDFMENLAPSHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVS
FT                   FNKSELFTGISFSASYKEQWTQRFPAKEHPVLALPGAPAQFPVLEEHRELQKYMVWSDE
FT                   MVRTGEALISAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAT
FT                   PLTMTMCLPDLKEIQRAVTLWVRALNARSVYIATDSESYVSEIQQLFKDKVRVVSLKPE
FT                   VAQIDLYILGQADHFIGNCVSSFTAFVKRERDLHGRQSSFFGMDRPSQLRDEF"
FT   assembly_gap    1857970..1860809
FT                   /estimated_length=2840
FT                   /gap_type="unknown"
FT   gene            1873070..1928291
FT                   /gene="Kif3b"
FT                   /locus_tag="mCG_119797"
FT                   /note="gene_id=mCG119797.0"
FT   mRNA            join(1873070..1873141,1911060..1912527,1915119..1915220,
FT                   1915423..1915545,1915629..1915747,1917694..1917807,
FT                   1918419..1918524,1924477..1924655,1924964..1928291)
FT                   /gene="Kif3b"
FT                   /locus_tag="mCG_119797"
FT                   /product="kinesin family member 3B"
FT                   /note="gene_id=mCG119797.0 transcript_id=mCT120975.1
FT                   created on 25-JUL-2002"
FT   assembly_gap    1881133..1881152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1882385..1882404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1889586..1889605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1890706..1890725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1895860..1896029
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    1897999..1900385
FT                   /estimated_length=2387
FT                   /gap_type="unknown"
FT   assembly_gap    1901960..1901979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1903012..1903031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1906312..1906331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1911124..1912527,1915119..1915220,1915423..1915545,
FT                   1915629..1915747,1917694..1917807,1918419..1918524,
FT                   1924477..1924655,1924964..1925060)
FT                   /codon_start=1
FT                   /gene="Kif3b"
FT                   /locus_tag="mCG_119797"
FT                   /product="kinesin family member 3B"
FT                   /note="gene_id=mCG119797.0 transcript_id=mCT120975.1
FT                   protein_id=mCP73031.1"
FT                   /protein_id="EDL06022.1"
FT                   /translation="MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKN
FT                   PKGTSHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTY
FT                   TMEGVRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKR
FT                   LELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVIT
FT                   IECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISA
FT                   LVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNI
FT                   KNKPRVNEDPKDALLREFQEEIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEE
FT                   GEEGEEDGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKD
FT                   AAEMLGAKIKAMESKLLVGGKNIVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRD
FT                   EETLELKETYTSLQQEVDIKTKKLKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNEL
FT                   TRELKLKHLIIENFIPLEEKNKIMNRSFFDDEEDHWKLHPITRLENQQMMKRPVSAVGY
FT                   KRPLSQHARMSMMIRPEPRYRAENIMLLELDMPSRTTRDYEGPAISPKVQAALDAALQD
FT                   EDEIQVDASSFESTANRKPKARPKSGRKSGSSSSSSGNPASQFYPQSRGLVPK"
FT   assembly_gap    1930738..1932271
FT                   /estimated_length=1534
FT                   /gap_type="unknown"
FT   assembly_gap    1933916..1934052
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            complement(1938304..>1943467)
FT                   /locus_tag="mCG_140752"
FT                   /note="gene_id=mCG140752.0"
FT   mRNA            complement(join(1938304..1940013,1942770..>1943467))
FT                   /locus_tag="mCG_140752"
FT                   /product="mCG140752, transcript variant mCT171251"
FT                   /note="gene_id=mCG140752.0 transcript_id=mCT171251.0
FT                   created on 29-JUL-2002"
FT   mRNA            complement(join(1939656..1940013,1940319..>1940436))
FT                   /locus_tag="mCG_140752"
FT                   /product="mCG140752, transcript variant mCT171252"
FT                   /note="gene_id=mCG140752.0 transcript_id=mCT171252.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(1939775..>1939972)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140752"
FT                   /product="mCG140752, isoform CRA_a"
FT                   /note="gene_id=mCG140752.0 transcript_id=mCT171252.0
FT                   protein_id=mCP94171.0 isoform=CRA_a"
FT                   /protein_id="EDL06023.1"
FT                   /translation="DKRNFCSTPPSLGMSHCFQIYEQSTQIKNNTSKKQQRGTKGHRIP
FT                   DPHCDLVTLVLGLEREMLRA"
FT   CDS             complement(join(1940010..1940013,1942770..>1943092))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140752"
FT                   /product="mCG140752, isoform CRA_b"
FT                   /note="gene_id=mCG140752.0 transcript_id=mCT171251.0
FT                   protein_id=mCP94170.0 isoform=CRA_b"
FT                   /protein_id="EDL06024.1"
FT                   /translation="WRAGPDGETRLSFRRSDACVSAVGMCVYVCARVCVREKSEEGECG
FT                   VFFFFEQKQTERVAGICSPHWLPGLPLSGRKWLPQVLGPHFPECPGLLFSAHFLPYPAA
FT                   LQAR"
FT   assembly_gap    1943494..1948237
FT                   /estimated_length=4744
FT                   /gap_type="unknown"
FT   assembly_gap    1950867..1951141
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    1966273..1966292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1968577..1968596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1970645..1970664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1988707..2001072
FT                   /locus_tag="mCG_10478"
FT                   /note="gene_id=mCG10478.2"
FT   mRNA            join(<1988707..1988827,1989874..1990008,1990432..1990584,
FT                   1990707..1990870,1990965..1991061,1993794..1993899,
FT                   1994452..1995076,1996306..2001072)
FT                   /locus_tag="mCG_10478"
FT                   /product="mCG10478"
FT                   /note="gene_id=mCG10478.2 transcript_id=mCT11066.2 created
FT                   on 29-JUL-2002"
FT   CDS             join(<1988707..1988827,1989874..1990008,1990432..1990584,
FT                   1990707..1990870,1990965..1991061,1993794..1993899,
FT                   1994452..1995076,1996306..1999140)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10478"
FT                   /product="mCG10478"
FT                   /note="gene_id=mCG10478.2 transcript_id=mCT11066.2
FT                   protein_id=mCP18262.2"
FT                   /protein_id="EDL06025.1"
FT                   /translation="KDAVQWSRNAATVDGDEPEDSADVESCGSNEASTVSGENDDNSFF
FT                   SFKFLLGIQANKQKKRTGVMLPRVVLTPLKVNGAHVEPASGFSGRHADGESGSPSSSSS
FT                   GSLALGNSAIRGQAEVTRDPAPLLRGFRKPATGQMKRNRGEEVDFETPGSILVNTNLRA
FT                   LINSRTFHALPLHFQQQLLLLLPEVDRQVGTDGLLRLSGSALNNEFFTHAAQSWRERLA
FT                   DGEFTHEMQVRLRQEMEKEKKVEQWKEKFFEDYYGQKLGLTKEESLQQKEVQEEAKVKS
FT                   GLCVSGESVRPQRGPNTRQRDGHFKKRSRPDLRTRSRRNIYKKQEPEQAGVAKDASAAP
FT                   DVSLSKDTKTDLAGVNSTPGPDVSSATSGQEGPKCPSEPVASQIQAERDNLACASASPD
FT                   RIPTLPQDTVDQETKDQKRKPFEQEASAPFPEKKPRLEDRQSFRNTIESVHTEKPQPTK
FT                   EEPKVPPIRIQLSRIKPPWVAKGRPTYQICPRIVPITESSCRGWTGARTLADIKARALQ
FT                   ARGARGYHCNRETATTAIGGGGGPGGGGSGAIDEGGGRDSSSGDGSEACGHPEPRGAPS
FT                   TSGESASDLQRTQLLPPCPLNGEHTPAEAAMPRARREDSASLRKEESCLLKRVPGVLTS
FT                   GLEDASQPPIAPTGDQPCQALPPLSSQTPVAEMLTEQPKLLLDDRTECESSREDQGPTI
FT                   PSESSSGRFPLGDLLGGGSDQAFDNMKEPISMTPTFISELSLANYLQDRPADDGLGLGA
FT                   TGLLIRESSRQEALTEAFASGSPTSWVPILSNYEVIKTSDPESRENIPCPEPQDEKEWE
FT                   RAVPLIAATESVPQPESCISHWTPPPAAVGSTGSDSEQVDLERLEMNGISEAPSPHSES
FT                   TDTASDSEGHLSEDSSEVDASEVTVVKGSLGGDEKQDWDPSASLSKVNNDLSVLTRTGG
FT                   VAASQSWVSRVCSVPHKIPDSLLLSSTECQPRSVCPLRPGSSVEVTNPLVMHLLHGNLP
FT                   LEKVLPPGHRSSRLESSQLPLREQSQHRGTLQGTGENNRLAARINPGSAQTLKESILAQ
FT                   SYGASAGLVRAMASKAPAMSQKIAKMVTSLDSQHPETELTPSSGNLEEIDSKEHLSSFL
FT                   CEEQKEGHSLSQGSDPGAAPGQCLGDHTTSKVPCFSSTNVSLSFGSEQTDGTLSDQNNA
FT                   GGHEKKLFGPGNTVTTLQCPRSEEQTPLPAEVPPVFPSRKIEPSKNSVSGGVQTTRENR
FT                   MPKPPPVSAGSIRTEQTFLRDPIKADAENRKAAGYSSLELVGHLQGMPFVVDLPFWKLP
FT                   REPGKGFSQPLEPSSIPSQLNIKQALYGKLSKLQLSPTSFNYSSSSATFPKGLAGGVVQ
FT                   LSHKASFGTGHTASLSLQMFTDSSAVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSK
FT                   LCVLCLVVR"
FT   assembly_gap    1988868..1989018
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   gene            complement(2004522..>2126592)
FT                   /gene="8430427H17Rik"
FT                   /locus_tag="mCG_140756"
FT                   /note="gene_id=mCG140756.0"
FT   mRNA            complement(join(2004522..2008901,2013717..2013918,
FT                   2014436..2014558,2014761..2014952,2015033..2015218,
FT                   2017605..2017882,2032991..2033132,2060376..2060602,
FT                   2067434..2067543,2074584..2074695,2076214..2076416,
FT                   2080164..2080319,2126234..>2126592))
FT                   /gene="8430427H17Rik"
FT                   /locus_tag="mCG_140756"
FT                   /product="RIKEN cDNA 8430427H17"
FT                   /note="gene_id=mCG140756.0 transcript_id=mCT171264.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(2008684..2008901,2013717..2013918,
FT                   2014436..2014558,2014761..2014952,2015033..2015218,
FT                   2017605..2017882,2032991..2033132,2060376..>2060435))
FT                   /codon_start=1
FT                   /gene="8430427H17Rik"
FT                   /locus_tag="mCG_140756"
FT                   /product="RIKEN cDNA 8430427H17"
FT                   /note="gene_id=mCG140756.0 transcript_id=mCT171264.0
FT                   protein_id=mCP94183.0"
FT                   /protein_id="EDL06026.1"
FT                   /translation="AAGTYCSVHHSFKIYLLLNSDETSVSSEDFDMNDSAWMSADPHLA
FT                   SSLSPSQEERMRSPQNLHSQEDDDSSSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNG
FT                   AAAPMDFTATAEDQPINLCEKLPPGTALGTPSYPSDGCGTDGLRSRVKYGVKNTPESPP
FT                   YSSGSYDSIKTEVSGCPEDLTVGRAPAADDDDDDHDDHEDNDKMNDSEGMDPERLKAFN
FT                   MFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKK
FT                   NGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQEEPIALDKQHSRD
FT                   STAITHSTYSLPASAYSQDPVYVNGGLNYSYRGYGSLSSNLQPSASLQTGNHSNGPTDL
FT                   SMKGGASTPTPPTPTPSSNSTSRTMPTAQLSPTEISAVRQLIAGYRESAAFLLRSADEL
FT                   ENLILQQN"
FT   gene            2010876..2011456
FT                   /pseudo
FT                   /locus_tag="mCG_10477"
FT                   /note="gene_id=mCG10477.2"
FT   mRNA            2010876..2011456
FT                   /pseudo
FT                   /locus_tag="mCG_10477"
FT                   /note="gene_id=mCG10477.2 transcript_id=mCT11065.2 created
FT                   on 29-JUL-2002"
FT   assembly_gap    2037516..2037613
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    2040660..2042084
FT                   /estimated_length=1425
FT                   /gap_type="unknown"
FT   assembly_gap    2062928..2063957
FT                   /estimated_length=1030
FT                   /gap_type="unknown"
FT   assembly_gap    2082464..2083183
FT                   /estimated_length=720
FT                   /gap_type="unknown"
FT   assembly_gap    2089055..2089741
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    2124884..2125199
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    2125782..2125946
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    2126593..2126797
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    2128384..2128573
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    2151800..2152095
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    2158935..2159028
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    2161181..2161471
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    2163281..2163300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2166530..2166944
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    2167915..2168524
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    2169740..2170256
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    2177695..2177798
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    2189291..2189491
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    2191634..2192584
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    2193751..2194319
FT                   /estimated_length=569
FT                   /gap_type="unknown"
FT   assembly_gap    2195315..2195617
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    2208118..2208272
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    2210908..2212030
FT                   /estimated_length=1123
FT                   /gap_type="unknown"
FT   assembly_gap    2213241..2213662
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   gene            complement(2214308..>2233553)
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /note="gene_id=mCG52224.2"
FT   mRNA            complement(join(2214308..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229235,2229959..2230012,
FT                   2233391..>2233553))
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, transcript variant
FT                   mCT52407"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT52407.3 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(2215696..2216777,2217714..2217762,
FT                   2219054..2219103,2219331..2219382,2222006..2222045,
FT                   2222556..2222593,2222677..2222733,2229133..2229235,
FT                   2229959..2230012,2233391..>2233537))
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, transcript variant
FT                   mCT185594"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185594.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(2215696..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229235,2229959..2230012,
FT                   2232985..2233059,2233391..2233524))
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, transcript variant
FT                   mCT185593"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185593.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(2216247..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229237,2233453..>2233511))
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, transcript variant
FT                   mCT185595"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185595.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(2216701..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229235,2229959..2230012,
FT                   2233391..>2233552))
FT                   /codon_start=1
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, isoform CRA_b"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT52407.3
FT                   protein_id=mCP38871.2 isoform=CRA_b"
FT                   /protein_id="EDL06028.1"
FT                   /translation="KCGCGSAARPGWRKRASLPGCGVPGTMGRLHCTQDPVPEAVRGDM
FT                   QQLNQLGAQQFSDLTEVLFHFLTEPKEVERFLAQLSEFATSNQISLGPLKSIMKSLLLV
FT                   PNGALKKGLTAEQVRTDLQTLGLSEEKATYFSEKWKQNASTLAQWAMGQTLMVNQLIDM
FT                   EWRFGVTSGSSELEKVGSIFLQLKLVVKKGKQTENLYIELTLPQFYSFLHEMERVRASM
FT                   ECLS"
FT   CDS             complement(join(2216701..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229237,2233453..>2233510))
FT                   /codon_start=1
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, isoform CRA_d"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185595.0
FT                   protein_id=mCP106851.0 isoform=CRA_d"
FT                   /protein_id="EDL06030.1"
FT                   /translation="RASLPGCGVPGTMGRLHCTQVERFLAQLSEFATSNQISLGPLKSI
FT                   MKSLLLVPNGALKKGLTAEQVRTDLQTLGLSEEKATYFSEKWKQNASTLAQWAMGQTLM
FT                   VNQLIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKGKQTENLYIELTLPQFYSFLHEM
FT                   ERVRASMECLS"
FT   CDS             complement(join(2216701..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229160))
FT                   /codon_start=1
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, isoform CRA_c"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185593.0
FT                   protein_id=mCP106852.0 isoform=CRA_c"
FT                   /protein_id="EDL06029.1"
FT                   /translation="MKSLLLVPNGALKKGLTAEQVRTDLQTLGLSEEKATYFSEKWKQN
FT                   ASTLAQWAMGQTLMVNQLIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKGKQTENLYI
FT                   ELTLPQFYSFLHEMERVRASMECLS"
FT   CDS             complement(join(2219363..2219382,2222006..2222045,
FT                   2222556..2222593,2222677..2222733,2229133..2229235,
FT                   2229959..2230012,2233391..>2233537))
FT                   /codon_start=1
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185594.0
FT                   protein_id=mCP106853.0 isoform=CRA_a"
FT                   /protein_id="EDL06027.1"
FT                   /translation="SAARPGWRKRASLPGCGVPGTMGRLHCTQDPVPEAVRGDMQQLNQ
FT                   LGAQQFSDLTEVLFHFLTEPKEVERFLAQLSEFATSNQISLGPLKSIMKSLLLVPNGAL
FT                   KKGLTAEQVRTDLQTLGLSEEKATYFSEKWKQNASTLAQWAMGSDPDG"
FT   assembly_gap    2221857..2221876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2226643..2226714
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2228169..2228308
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    2229517..2229702
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    2238167..2238835
FT                   /estimated_length=669
FT                   /gap_type="unknown"
FT   assembly_gap    2239560..2239579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2249288..>2250964)
FT                   /locus_tag="mCG_140754"
FT                   /note="gene_id=mCG140754.0"
FT   mRNA            complement(join(2249288..2249769,2250735..>2250964))
FT                   /locus_tag="mCG_140754"
FT                   /product="mCG140754"
FT                   /note="gene_id=mCG140754.0 transcript_id=mCT171261.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(2249418..2249769,2250735..>2250964))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140754"
FT                   /product="mCG140754"
FT                   /note="gene_id=mCG140754.0 transcript_id=mCT171261.0
FT                   protein_id=mCP94180.0"
FT                   /protein_id="EDL06031.1"
FT                   /translation="SQQPATLQHKRLRSGGPRGQRPSSIPTCRYPERHPNLGVRGSKSE
FT                   RIHNHYYIDKTTSASTSQPFLPEEALGKNWARSDAHTHIQAHSQVWMSGPEREELLLES
FT                   HSNPALAFRPSLRCKAVQGAVVALWVTRWGPPFCFLLSPSLAFVSHLEGRGGLGGRKSI
FT                   HVPPTTWVPRASWGGALPCSLGLPRPKGPR"
FT   assembly_gap    2249789..2250089
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   gene            2250136..2288683
FT                   /locus_tag="mCG_10465"
FT                   /note="gene_id=mCG10465.2"
FT   mRNA            join(2250136..2250424,2251467..2251581,2262137..2262314,
FT                   2262855..2262916,2263426..2263545,2265972..2266097,
FT                   2266627..2266821,2268224..2268382,2270468..2270575,
FT                   2271023..2271167,2271569..2271628,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2284573..2284642,2285322..2285440,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171254"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171254.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2251467..2251581,2262137..2262314,
FT                   2262855..2262916,2263426..2263545,2265972..2266097,
FT                   2266627..2266821,2268224..2268382,2270468..2270575,
FT                   2271023..2271167,2271569..2271628,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171256"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171256.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2251467..2251581,2262137..2262314,
FT                   2262855..2262916,2263426..2263545,2265972..2266097,
FT                   2266627..2266821,2268224..2268382,2270468..2270575,
FT                   2271023..2271167,2272936..2273055,2273216..2273260,
FT                   2274707..2274786,2275069..2275181,2275578..2275764,
FT                   2276449..2276533,2277413..2277558,2277888..2277978,
FT                   2278228..2278376,2279188..2279273,2284573..2284642,
FT                   2285322..2285440,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171257"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171257.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2251467..2251581,2262137..2262314,
FT                   2262855..2262916,2263426..2263545,2265972..2266097,
FT                   2266627..2266821,2268224..2268382,2270468..2270575,
FT                   2271023..2271167,2272936..2273055,2273216..2273260,
FT                   2274707..2274786,2275069..2275181,2275578..2275764,
FT                   2276449..2276533,2277413..2277558,2277888..2277978,
FT                   2278228..2278376,2279188..2279273,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT11053"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT11053.2 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2262137..2262314,2262855..2262916,
FT                   2263426..2263545,2265972..2266097,2266627..2266821,
FT                   2268224..2268382,2270468..2270575,2271023..2271167,
FT                   2271569..2271628,2272936..2273055,2273216..2273260,
FT                   2274707..2274786,2275069..2275181,2275578..2275764,
FT                   2276449..2276533,2277413..2277558,2277888..2277978,
FT                   2278228..2278376,2279188..2279273,2284573..2284642,
FT                   2285322..2285440,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171260"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171260.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2262137..2262314,2262855..2262916,
FT                   2263426..2263545,2265972..2266097,2266627..2266821,
FT                   2268224..2268382,2270468..2270575,2271023..2271167,
FT                   2271569..2271628,2272936..2273055,2273216..2273260,
FT                   2274707..2274786,2275069..2275181,2275578..2275764,
FT                   2276449..2276533,2277413..2277558,2277888..2277978,
FT                   2278228..2278376,2279188..2279273,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171259"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171259.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2262137..2262314,2262855..2262916,
FT                   2263426..2263545,2265972..2266097,2266627..2266821,
FT                   2268224..2268382,2270468..2270575,2271023..2271167,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2284573..2284642,2285322..2285440,
FT                   2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171255"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171255.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2262137..2262314,2262855..2262916,
FT                   2263426..2263545,2265972..2266097,2266627..2266821,
FT                   2268224..2268382,2270468..2270575,2271023..2271167,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171258"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171258.0 created
FT                   on 29-JUL-2002"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2271569..2271628,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2284573..2284642,2285322..2285440,
FT                   2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_b"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171254.0
FT                   protein_id=mCP94175.0 isoform=CRA_b"
FT                   /protein_id="EDL06033.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASES
FT                   PPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGG
FT                   LCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGT
FT                   AEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAA
FT                   KRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVR
FT                   KITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGD
FT                   NRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVM
FT                   ASKNDKLELQDCLEFSRTAKLKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELE
FT                   RIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2271569..2271628,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2284573..2284642,2285322..2285440,
FT                   2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_b"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171260.0
FT                   protein_id=mCP94178.0 isoform=CRA_b"
FT                   /protein_id="EDL06036.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASES
FT                   PPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGG
FT                   LCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGT
FT                   AEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAA
FT                   KRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVR
FT                   KITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGD
FT                   NRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVM
FT                   ASKNDKLELQDCLEFSRTAKLKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELE
FT                   RIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2271569..2271628,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_c"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171256.0
FT                   protein_id=mCP94173.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q541E5"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR025766"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030488"
FT                   /db_xref="MGI:MGI:1261819"
FT                   /db_xref="UniProtKB/TrEMBL:Q541E5"
FT                   /protein_id="EDL06034.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASES
FT                   PPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGG
FT                   LCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGT
FT                   AEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAA
FT                   KRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVR
FT                   KITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGD
FT                   NRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRIFG
FT                   FPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2271569..2271628,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_c"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171259.0
FT                   protein_id=mCP94177.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q541E5"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR025766"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030488"
FT                   /db_xref="MGI:MGI:1261819"
FT                   /db_xref="UniProtKB/TrEMBL:Q541E5"
FT                   /protein_id="EDL06039.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASES
FT                   PPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGG
FT                   LCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGT
FT                   AEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAA
FT                   KRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVR
FT                   KITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGD
FT                   NRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRIFG
FT                   FPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2284573..2284642,2285322..2285440,2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_d"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171255.0
FT                   protein_id=mCP94174.0 isoform=CRA_d"
FT                   /protein_id="EDL06037.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDE
FT                   ESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDG
FT                   YQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRC
FT                   HGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLV
FT                   LKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGS
FT                   PCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKK
FT                   DISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVMASKNDKLELQDCLEFSRTAK
FT                   LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELERIFGFPAHYTDVSNMGRGAR
FT                   QKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2284573..2284642,2285322..2285440,2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_d"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171257.0
FT                   protein_id=mCP94179.0 isoform=CRA_d"
FT                   /protein_id="EDL06038.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDE
FT                   ESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDG
FT                   YQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRC
FT                   HGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLV
FT                   LKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGS
FT                   PCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKK
FT                   DISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVMASKNDKLELQDCLEFSRTAK
FT                   LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELERIFGFPAHYTDVSNMGRGAR
FT                   QKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_a"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT11053.2
FT                   protein_id=mCP18255.1 isoform=CRA_a"
FT                   /protein_id="EDL06032.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDE
FT                   ESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDG
FT                   YQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRC
FT                   HGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLV
FT                   LKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGS
FT                   PCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKK
FT                   DISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRIFGFPAHYTDVSNMGRGARQKLL
FT                   GRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_a"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171258.0
FT                   protein_id=mCP94176.0 isoform=CRA_a"
FT                   /protein_id="EDL06035.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDE
FT                   ESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDG
FT                   YQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRC
FT                   HGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLV
FT                   LKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGS
FT                   PCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKK
FT                   DISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRIFGFPAHYTDVSNMGRGARQKLL
FT                   GRSWSVPVIRHLFAPLKDYFACE"
FT   assembly_gap    2283266..2283285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2291995..2292281
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    2293559..2293578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2294965..>2328243
FT                   /locus_tag="mCG_140755"
FT                   /note="gene_id=mCG140755.0"
FT   mRNA            join(<2294965..2295121,2295955..2296016,2304668..2304877,
FT                   2310188..2310283,2311984..2312128,2313454..2313573,
FT                   2313734..2313778,2314981..2315060,2315343..2315455,
FT                   2315846..2316032,2316717..2316801,2317700..2317845,
FT                   2318440..2318530,2318850..2318998,2321965..2322050,
FT                   2328102..>2328243)
FT                   /locus_tag="mCG_140755"
FT                   /product="mCG140755"
FT                   /note="gene_id=mCG140755.0 transcript_id=mCT171262.0
FT                   created on 29-JUL-2002"
FT   CDS             join(2294965..2295121,2295955..2296016,2304668..2304877,
FT                   2310188..2310283,2311984..2312128,2313454..2313573,
FT                   2313734..2313778,2314981..2315060,2315343..2315455,
FT                   2315846..2316032,2316717..2316801,2317700..2317845,
FT                   2318440..2318530,2318850..2318998,2321965..2322050,
FT                   2328102..2328243)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140755"
FT                   /product="mCG140755"
FT                   /note="gene_id=mCG140755.0 transcript_id=mCT171262.0
FT                   protein_id=mCP94181.0"
FT                   /protein_id="EDL06040.1"
FT                   /translation="MRGGSRHLSNEEDVSGCEDCIIISGTCSDQSSDPKTVPLTQVLEA
FT                   VCTVENRGCRTSSQPSKRKASSLISYVQPLSWQANTSASTPWLSPASPYPIIDLTDEDV
FT                   IPQSISTPSVDWSQDSHQEGMDTTQVDAESRDGGNIEYQVSADKLLLSQSCILAAFYKL
FT                   VPYRESIYRTLEKARVRAGKACPSSPGESLEDQLKPMLEWAHGGFKPTGIEGLKPNKKQ
FT                   PENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESREQMASDVTNNKGNLEDHC
FT                   LSCGRKDPVSFHPLFEGGLCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTS
FT                   CCRCFCVECLEVLVGAGTAEDVKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTD
FT                   PDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESI
FT                   AVGTVKHEGQIKYVDDIRNITKEHIDEWGPFDLVIGGSPCNDLSCVNPVRKGLFEGTGR
FT                   LFFEFYRLLNYSCPEEEDDRPFFWMFENVVAMEVGDKRDISRFLECNPVMIDAIKVSAA
FT                   HRARYFWGNLPGMNRIFGFPEHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDHFA
FT                   CE"
FT   assembly_gap    2308182..2308625
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   gene            2339662..2368733
FT                   /gene="Mapre1"
FT                   /locus_tag="mCG_10464"
FT                   /note="gene_id=mCG10464.2"
FT   mRNA            join(2339662..2339765,2344602..2344725,2355830..2355975,
FT                   2357823..2358030,2361434..2361555,2364832..2364984,
FT                   2366793..2368733)
FT                   /gene="Mapre1"
FT                   /locus_tag="mCG_10464"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 1"
FT                   /note="gene_id=mCG10464.2 transcript_id=mCT11052.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(2344605..2344725,2355830..2355975,2357823..2358030,
FT                   2361434..2361555,2364832..2364984,2366793..2366849)
FT                   /codon_start=1
FT                   /gene="Mapre1"
FT                   /locus_tag="mCG_10464"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 1"
FT                   /note="gene_id=mCG10464.2 transcript_id=mCT11052.2
FT                   protein_id=mCP18254.2"
FT                   /db_xref="GOA:Q3U4H0"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR004953"
FT                   /db_xref="InterPro:IPR027328"
FT                   /db_xref="MGI:MGI:891995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4H0"
FT                   /protein_id="EDL06041.1"
FT                   /translation="MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYC
FT                   QFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDN
FT                   FEFVQWFKKFFDANYDGKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSSTAAPQRP
FT                   IATQRTTAAPKAGPGMVRKNPGVGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLR
FT                   NIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY"
FT   assembly_gap    2349432..2349451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2350553..2350572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2374530..2374577
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            2380407..2394756
FT                   /gene="A630008I04"
FT                   /locus_tag="mCG_145769"
FT                   /note="gene_id=mCG145769.0"
FT   mRNA            join(2380407..2380599,2381284..2381335,2383160..2383325,
FT                   2387161..2387279,2388683..2388947,2392234..2392369,
FT                   2393941..2394046,2394339..2394756)
FT                   /gene="A630008I04"
FT                   /locus_tag="mCG_145769"
FT                   /product="hypothetical protein A630008I04"
FT                   /note="gene_id=mCG145769.0 transcript_id=mCT185848.0
FT                   created on 18-JUN-2003"
FT   CDS             join(2380433..2380599,2381284..2381335,2383160..2383325,
FT                   2387161..2387279,2388683..2388790)
FT                   /codon_start=1
FT                   /gene="A630008I04"
FT                   /locus_tag="mCG_145769"
FT                   /product="hypothetical protein A630008I04"
FT                   /note="gene_id=mCG145769.0 transcript_id=mCT185848.0
FT                   protein_id=mCP107106.0"
FT                   /protein_id="EDL06042.1"
FT                   /translation="MPSSLHAPLSGEVSAFSLSCPYFRCQDSTGEDLGRFPSPLPFLMC
FT                   LLLFFPFRARWPRLMSSEKPGESPKPQKMAQPGGSQKKETSRSVPVTDPTSHNSEINQR
FT                   DQQFSDMHLADLQKVFEKEADENGALKKEGFIRIMKGVLSSMSEEMLELLFLKVDSDCN
FT                   GFVTWQKYVDYMMREFQGKEEMRKSQYRLRFHLPMTVIPL"
FT   assembly_gap    2393195..2393387
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    2400080..2400186
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    2406231..2406250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2407578..2407597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2414188..2414315
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    2416406..2416569
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    2417900..2418174
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    2419056..2419327
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    2420406..2429392
FT                   /estimated_length=8987
FT                   /gap_type="unknown"
FT   assembly_gap    2430554..2430942
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    2431533..2431552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2444874..2459282)
FT                   /gene="Spag4l"
FT                   /locus_tag="mCG_10466"
FT                   /note="gene_id=mCG10466.2"
FT   mRNA            complement(join(2444874..2445044,2446512..2446598,
FT                   2447046..2447213,2448687..2448790,2449517..2449595,
FT                   2453392..2453454,2455103..2455152,2455711..2455772,
FT                   2456420..2456486,2457616..2457671,2459128..2459282))
FT                   /gene="Spag4l"
FT                   /locus_tag="mCG_10466"
FT                   /product="sperm associated antigen 4-like"
FT                   /note="gene_id=mCG10466.2 transcript_id=mCT11054.2 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(2444901..2445044,2446512..2446598,
FT                   2447046..2447213,2448687..2448790,2449517..2449595,
FT                   2453392..2453454,2455103..2455152,2455711..2455772,
FT                   2456420..2456486,2457616..2457671,2459128..2459201))
FT                   /codon_start=1
FT                   /gene="Spag4l"
FT                   /locus_tag="mCG_10466"
FT                   /product="sperm associated antigen 4-like"
FT                   /note="gene_id=mCG10466.2 transcript_id=mCT11054.2
FT                   protein_id=mCP18245.2"
FT                   /protein_id="EDL06043.1"
FT                   /translation="MPRTRNIGALCTLPEDTTHSGRPRRGVQRSYISRMAEPAPANMTW
FT                   LTYLACFLRTQTQQVFLNTCRCKLFCQKVMEKMGLLVLCVFGFWMFSMHLPSKVEVWQL
FT                   RGSMNQLIAKLQKMEAISDEQKMAQKIMKMIQGDYIEKPDFALKSIGASIDFEHTSATY
FT                   NHDKARSYWNWIRLWNYAQPPDPNVTPGNCWAFASDRGQVTIRLAQKVYLSNITLQHIP
FT                   KTISLSGSLDTAPKDFVIYGLESLPREEVFLGAFQFQPENIIQTFQLQNLPPRSFAAVK
FT                   VKISSNWGNPRFTCMYRVRVHGSVTPPKDSHLEPLS"
FT   assembly_gap    2453457..2454725
FT                   /estimated_length=1269
FT                   /gap_type="unknown"
FT   gene            2462453..2485822
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /note="gene_id=mCG10476.2"
FT   mRNA            join(2462453..2462888,2463649..2463792,2466210..2466303,
FT                   2467807..2467911,2468912..2469058,2470888..2470948,
FT                   2471841..2471901,2479647..2479738,2479934..2480122,
FT                   2480346..2480399,2480954..2481124,2481641..2481708,
FT                   2481830..2481875,2482496..2482559,2482887..2482963,
FT                   2485541..2485822)
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   1, transcript variant mCT11064"
FT                   /note="gene_id=mCG10476.2 transcript_id=mCT11064.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(2463675..2463792,2466210..2466303,2467807..2467911,
FT                   2468912..2469058,2470888..2470948,2471841..2471901,
FT                   2479647..2479738,2479934..2480122,2480346..2480399,
FT                   2480954..2481124,2481641..2481708,2481830..2481875,
FT                   2482496..2482559,2482887..2482963,2485541..2485582)
FT                   /codon_start=1
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG10476.2 transcript_id=mCT11064.2
FT                   protein_id=mCP18246.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q14AV3"
FT                   /db_xref="InterPro:IPR001124"
FT                   /db_xref="InterPro:IPR017942"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="InterPro:IPR032942"
FT                   /db_xref="MGI:MGI:1913807"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AV3"
FT                   /protein_id="EDL06044.1"
FT                   /translation="MARACSLGLLLLLLLLLRTVVTVSLPVIVVRLNKAALDYVSDIGK
FT                   APLQRALQVTISDFMDPSGEVLQSTRVQILDAHVPFFYLKFIAGFGVHLSAAANFTIKV
FT                   FSVPEPMELVLPVDLLADVHVARDSIGTLVLSVPACSSIFSPAGMLDGSISTSQELLDR
FT                   VQEHIKADLNNKLCLHVYGLVQDLNVHLGTLIGLSPVGPESQIRYSITSMPTITSNYIS
FT                   LDIGAILSLLGKPILLPMHGAHPFVLPWPLGDAGAMATVGLSQHLFDCALLMLQKAGSL
FT                   NLEITGQLNSKNNPLNTSVLGQLIPEVAHLFPEPTPLVLKVQLGATPVVTLHTSNSTLQ
FT                   LQPLVEVFAAPSNLALQFLFSLDVMVNLDLQLSVSKAKLRGSTSLLGGFQLSVATSNVG
FT                   SVDMDQVLTLISTVFQKPLLDHLNALLGMGVVLPRVHNLHYVHSEVLVREGYVVVSSGL
FT                   AYQH"
FT   assembly_gap    2469889..2469908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2472129..2472148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(2472550..2472690,2479647..2479738,2479934..2480122,
FT                   2480346..2480399,2480954..2481124,2481641..2481708,
FT                   2481830..2481875,2482496..2482559,2482887..2482963,
FT                   2485541..2485822)
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   1, transcript variant mCT171263"
FT                   /note="gene_id=mCG10476.2 transcript_id=mCT171263.0 created
FT                   on 30-JUL-2002"
FT   CDS             join(2472591..2472690,2479647..2479738,2479934..2480122,
FT                   2480346..2480399,2480954..2481124,2481641..2481708,
FT                   2481830..2481875,2482496..2482559,2482887..2482963,
FT                   2485541..2485582)
FT                   /codon_start=1
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG10476.2 transcript_id=mCT171263.0
FT                   protein_id=mCP94182.0 isoform=CRA_b"
FT                   /protein_id="EDL06045.1"
FT                   /translation="MCTWPGTLLGPLCSASLPALPSSVQPACWIAVTGLSPVGPESQIR
FT                   YSITSMPTITSNYISLDIGAILSLLGKPILLPMHGAHPFVLPWPLGDAGAMATVGLSQH
FT                   LFDCALLMLQKAGSLNLEITGQLNSKNNPLNTSVLGQLIPEVAHLFPEPTPLVLKVQLG
FT                   ATPVVTLHTSNSTLQLQPLVEVFAAPSNLALQFLFSLDVMVNLDLQLSVSKAKLRGSTS
FT                   LLGGFQLSVATSNVGSVDMDQVLTLISTVFQKPLLDHLNALLGMGVVLPRVHNLHYVHS
FT                   EVLVREGYVVVSSGLAYQH"
FT   assembly_gap    2473259..2474331
FT                   /estimated_length=1073
FT                   /gap_type="unknown"
FT   assembly_gap    2475377..2475396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2476476..2476495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2477587..2477606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2499119..2503362
FT                   /gene="Bpil3"
FT                   /locus_tag="mCG_10470"
FT                   /note="gene_id=mCG10470.2"
FT   mRNA            join(<2499119..2499220,2499728..2499795,2501281..2501326,
FT                   2502028..2502091,2502474..2502550,2503159..2503362)
FT                   /gene="Bpil3"
FT                   /locus_tag="mCG_10470"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   3"
FT                   /note="gene_id=mCG10470.2 transcript_id=mCT11058.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(2499119..2499220,2499728..2499795,2501281..2501326,
FT                   2502028..2502091,2502474..2502550,2503159..2503191)
FT                   /codon_start=1
FT                   /gene="Bpil3"
FT                   /locus_tag="mCG_10470"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   3"
FT                   /note="gene_id=mCG10470.2 transcript_id=mCT11058.2
FT                   protein_id=mCP18261.2"
FT                   /protein_id="EDL06046.1"
FT                   /translation="MKAGKSLMHLHGSLEMFAARRHGKHPKSLFRLETHIGLEIHYSVQ
FT                   DNRLQMVTSMDSLLSLARESSSVGDFHEAELTGFITDYLQKAYIPVVNDVLHVGLPLPD
FT                   LLAINYNLAELDIVEDALVLGLKTE"
FT   gene            <2510199..2524026
FT                   /gene="Rya3"
FT                   /locus_tag="mCG_10484"
FT                   /note="gene_id=mCG10484.1"
FT   mRNA            join(<2510199..2510310,2511053..2511209,2512707..2512791,
FT                   2513151..2513269,2514415..2514478,2515810..2515870,
FT                   2516583..2516674,2516792..2516971,2518344..2518397,
FT                   2519716..2519886,2520372..2520439,2521569..2521611,
FT                   2522441..2522504,2522914..2522990,2523738..2524026)
FT                   /gene="Rya3"
FT                   /locus_tag="mCG_10484"
FT                   /product="antimicrobial peptide RYA3"
FT                   /note="gene_id=mCG10484.1 transcript_id=mCT11072.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(2510199..2510310,2511053..2511209,2512707..2512791,
FT                   2513151..2513269,2514415..2514478,2515810..2515870,
FT                   2516583..2516674,2516792..2516971,2518344..2518397,
FT                   2519716..2519886,2520372..2520439,2521569..2521611,
FT                   2522441..2522504,2522914..2522990,2523738..2523767)
FT                   /codon_start=1
FT                   /gene="Rya3"
FT                   /locus_tag="mCG_10484"
FT                   /product="antimicrobial peptide RYA3"
FT                   /note="gene_id=mCG10484.1 transcript_id=mCT11072.2
FT                   protein_id=mCP18239.2"
FT                   /protein_id="EDL06047.1"
FT                   /translation="MLGVYTLLLLWGLATPCLGLLETVGTLARIDKDELGKAIQNSLVG
FT                   GPILQNVLGTVTSVNQGLLGAGGLLGGGGLLSYGGIFSLVEELSGLKIEELTLPKVSLK
FT                   LLPGVGVQLNLHTKLAAEVNVSSKVALGMSPRGTPILVLKRCSTLLGHISLMSGLLPTP
FT                   IFGLVEQTLCKVLPGLLCPVVDSVLSVVNELLGATLSLVPLGPLGSVEFTLATLPLISN
FT                   QYIELDINPIVKSIAGDVIDFPKPRIPVKVPPKEDHTSQVTVPLYLFSTVFGLLQTNGA
FT                   LDLDITPEMVPRNVPLTTTDLAALAPEALGKLPPAQHLLLSLRVTKSPMVLLQNKKATV
FT                   SIPVTIHVLSSVPQGTPVALFQLNGVMTLNAHLAPSSTKLHISLSLERLSVQLASSFPQ
FT                   PFDASRLEEWLSDVVRAAYMQRLNEHLEVGIPLPKILNVNFANSVVDIIENAVVLTVAP
FT                   "
FT   assembly_gap    2515027..2515046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2525100..2525183
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    2531867..2532121
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   gene            <2534016..2555465
FT                   /locus_tag="mCG_10482"
FT                   /note="gene_id=mCG10482.1"
FT   mRNA            join(<2534016..2534351,2535270..2535374,2536003..2536146,
FT                   2538456..2538519,2538873..2538933,2539856..2539947,
FT                   2541436..2541639,2543382..2543435,2545527..2545697,
FT                   2548746..2548813,2549335..2549377,2551266..2551329,
FT                   2553129..2553205,2555196..2555465)
FT                   /locus_tag="mCG_10482"
FT                   /product="mCG10482"
FT                   /note="gene_id=mCG10482.1 transcript_id=mCT11070.2 created
FT                   on 13-AUG-2002"
FT   CDS             join(<2534017..2534351,2535270..2535374,2536003..2536146,
FT                   2538456..2538519,2538873..2538933,2539856..2539947,
FT                   2541436..2541639,2543382..2543435,2545527..2545697,
FT                   2548746..2548813,2549335..2549377,2551266..2551329,
FT                   2553129..2553205,2555196..2555219)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10482"
FT                   /product="mCG10482"
FT                   /note="gene_id=mCG10482.1 transcript_id=mCT11070.2
FT                   protein_id=mCP18259.2"
FT                   /protein_id="EDL06048.1"
FT                   /translation="DLRHEDYRPPDSAYHRGSGRYRSAADSSSVGRLYRRELRPGEIPA
FT                   GVATGALGPGGLLGTGGMLANEGILAGQGGLLGGGGLLGDGGLLGGGGVLGVLGEGGIL
FT                   STVQGITGLRIVELTLPRVSVRLLPGVGVYLSLYTRVAINGRSLIGFLDIAVEVNITAK
FT                   VRLTMDRTGYPRLVIERCDTLLGGIKVKLLRGLLPNLVDNLVNRVLANVLPDLLCPIVD
FT                   VVLGLVNDQLGLVDSLVPLGILGSVQYTFSSLPLVTGEFLELDLNTLVGEAGGDLIDYP
FT                   LGRPAILPRPQMPELPPMGDNTNSQLAISANFLSSVLTMLQKQGAMDIDITDGMFEDLP
FT                   PLTTSTLGALIPKVFQQYPESRPLTIRIQVPNPPTVTLQKDKALVKVFATSEVVVSQPN
FT                   DVETTICLIDVDTDLLASFSVEGDKLMIDAKLDKTSLNLRTSNVGNFDVFILEMLVEKI
FT                   FDLAFMPAMNAILGSGVPLPKILNIDFSNADIDVLEDLLVLST"
FT   assembly_gap    2547763..2547782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2555605..2555624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2559036..2559055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2560370..2560389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2563416..2565354
FT                   /estimated_length=1939
FT                   /gap_type="unknown"
FT   assembly_gap    2574680..2574699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2580541..2580560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2584685..2584704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2589057..2596298
FT                   /estimated_length=7242
FT                   /gap_type="unknown"
FT   assembly_gap    2598755..2598774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2599149..2606946
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /note="gene_id=mCG10473.2"
FT   mRNA            join(2599149..2599277,2599982..2600110,2600637..2600778,
FT                   2601339..2601446,2602220..2602372,2604548..2604629,
FT                   2605284..2605347,2605792..2605866,2606770..2606939)
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, transcript variant
FT                   mCT171807"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT171807.0 created
FT                   on 13-AUG-2002"
FT   mRNA            join(2599150..2599181,2599982..2600110,2600637..2600778,
FT                   2601339..2601446,2602220..2602372,2604548..2604629,
FT                   2605284..2605347,2605792..2605866,2606770..2606946)
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, transcript variant
FT                   mCT11061"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT11061.2 created
FT                   on 13-AUG-2002"
FT   mRNA            join(2599166..2599181,2599982..2600110,2600637..2600778,
FT                   2602220..2602372,2604548..2604629,2605284..2605347,
FT                   2605792..2605866,2606770..2606941)
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, transcript variant
FT                   mCT171808"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT171808.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(2599990..2600110,2600637..2600778,2601339..2601446,
FT                   2602220..2602372,2604548..2604629,2605284..2605347,
FT                   2605792..2605829)
FT                   /codon_start=1
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, isoform CRA_a"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT11061.2
FT                   protein_id=mCP18244.1 isoform=CRA_a"
FT                   /protein_id="EDL06049.1"
FT                   /translation="MFQLGSLVVLCGLLIGNSESLLGELGSAVNNLKILNPPSEAVPQN
FT                   LNLDVELLQQATSWPLAKNSILETLNTADLGNLKSFTSLNGLLLKINNLKVLDFQAKLS
FT                   SNGNGIELTVPLAGEASLVLPFIGKTVDISVSLDLINSLSIKTNAQTGLPEVTIGKCSS
FT                   NTDKISISLLGRRLPIINSILDGVSTLLTSTLSTVLQNFLCPLLQYVLSTLNPSVLQGL
FT                   LSNLLAGQVQLAL"
FT   CDS             join(2599990..2600110,2600637..2600778,2601339..2601446,
FT                   2602220..2602372,2604548..2604629,2605284..2605347,
FT                   2605792..2605829)
FT                   /codon_start=1
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, isoform CRA_a"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT171807.0
FT                   protein_id=mCP94726.0 isoform=CRA_a"
FT                   /protein_id="EDL06050.1"
FT                   /translation="MFQLGSLVVLCGLLIGNSESLLGELGSAVNNLKILNPPSEAVPQN
FT                   LNLDVELLQQATSWPLAKNSILETLNTADLGNLKSFTSLNGLLLKINNLKVLDFQAKLS
FT                   SNGNGIELTVPLAGEASLVLPFIGKTVDISVSLDLINSLSIKTNAQTGLPEVTIGKCSS
FT                   NTDKISISLLGRRLPIINSILDGVSTLLTSTLSTVLQNFLCPLLQYVLSTLNPSVLQGL
FT                   LSNLLAGQVQLAL"
FT   CDS             join(2599990..2600110,2600637..2600778,2602220..2602372,
FT                   2604548..2604629,2605284..2605347,2605792..2605829)
FT                   /codon_start=1
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, isoform CRA_b"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT171808.0
FT                   protein_id=mCP94727.0 isoform=CRA_b"
FT                   /protein_id="EDL06051.1"
FT                   /translation="MFQLGSLVVLCGLLIGNSESLLGELGSAVNNLKILNPPSEAVPQN
FT                   LNLDVELLQQATSWPLAKNSILETLNTADLGNLKSFTSLNGLLPFIGKTVDISVSLDLI
FT                   NSLSIKTNAQTGLPEVTIGKCSSNTDKISISLLGRRLPIINSILDGVSTLLTSTLSTVL
FT                   QNFLCPLLQYVLSTLNPSVLQGLLSNLLAGQVQLAL"
FT   assembly_gap    2614663..2617814
FT                   /estimated_length=3152
FT                   /gap_type="unknown"
FT   assembly_gap    2619309..2619328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2621709..2622271
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    2623926..2623945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2625386..2625766
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    2632056..2632530
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    2633914..2634053
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    2637649..2637668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2642888..2643059
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    2649685..2649704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2654792..2654811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2659817..2666003
FT                   /estimated_length=6187
FT                   /gap_type="unknown"
FT   assembly_gap    2667884..2667903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2670225..2670244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2672623..2672642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2675573..2675592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2679974..2679993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2682467..2682486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2690588..2692126
FT                   /estimated_length=1539
FT                   /gap_type="unknown"
FT   gene            <2697785..2698122
FT                   /locus_tag="mCG_1027979"
FT                   /note="gene_id=mCG1027979.1"
FT   mRNA            <2697785..2698122
FT                   /locus_tag="mCG_1027979"
FT                   /product="mCG1027979, transcript variant mCT171805"
FT                   /note="gene_id=mCG1027979.1 transcript_id=mCT171805.0
FT                   created on 13-AUG-2002"
FT   mRNA            join(<2697785..2698007,2698079..2698118)
FT                   /locus_tag="mCG_1027979"
FT                   /product="mCG1027979, transcript variant mCT145683"
FT                   /note="gene_id=mCG1027979.1 transcript_id=mCT145683.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<2697822..2698007,2698079..2698090)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027979"
FT                   /product="mCG1027979, isoform CRA_b"
FT                   /note="gene_id=mCG1027979.1 transcript_id=mCT145683.0
FT                   protein_id=mCP73229.0 isoform=CRA_b"
FT                   /protein_id="EDL06053.1"
FT                   /translation="KDWWSRRSCWSRVGATIGGPYGELTPPPSSELSAVSGCRQGKFTV
FT                   SETCDPRSLGRTSDKIERQV"
FT   CDS             <2697822..2698073
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027979"
FT                   /product="mCG1027979, isoform CRA_a"
FT                   /note="gene_id=mCG1027979.1 transcript_id=mCT171805.0
FT                   protein_id=mCP94724.0 isoform=CRA_a"
FT                   /protein_id="EDL06052.1"
FT                   /translation="KDWWSRRSCWSRVGATIGGPYGELTPPPSSELSAVSGCRQGKFTV
FT                   SETCDPRSLGRTSDKIEVSIKLPGSRHKVTQEFGKDLG"
FT   assembly_gap    2722089..2722399
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    2726557..2726576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2728206..2728225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2731880..2732011
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    2732974..2733812
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    2738821..2738877
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    2741028..2741090
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    2745317..2745392
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            complement(2754492..>2756702)
FT                   /locus_tag="mCG_116890"
FT                   /note="gene_id=mCG116890.1"
FT   mRNA            complement(join(2754492..2756367,2756515..>2756702))
FT                   /locus_tag="mCG_116890"
FT                   /product="mCG116890"
FT                   /note="gene_id=mCG116890.1 transcript_id=mCT118018.1
FT                   created on 13-AUG-2002"
FT   CDS             complement(2755321..>2755638)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116890"
FT                   /product="mCG116890"
FT                   /note="gene_id=mCG116890.1 transcript_id=mCT118018.1
FT                   protein_id=mCP72734.1"
FT                   /protein_id="EDL06054.1"
FT                   /translation="QHPLSCGFHWSACGMTVLEAVMEIQTIADVGLLWRQSHPGHTKLM
FT                   LGPNPTRKDLLGWLLSHGVPREQVDRQPIKVLLELYIKEAKRSRGHPNYGLNEEQPPPP
FT                   P"
FT   assembly_gap    2761055..2762825
FT                   /estimated_length=1771
FT                   /gap_type="unknown"
FT   assembly_gap    2764509..2764528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2768962..2768981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2772503..2772522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2774652..2775108
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    2778086..2778202
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    2784981..2785000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2791484..2791503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2794644..2795087
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    2801371..2801390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2803107..2803126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2804637..2804656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2807311..2815247
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /note="gene_id=mCG1239.1"
FT   mRNA            join(2807311..2807629,2810524..2810674,2812418..2812525,
FT                   2813162..2813311,2814010..2814094,2814469..2814532,
FT                   2815031..2815247)
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, transcript variant
FT                   mCT8450"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT8450.1 created on
FT                   13-AUG-2002"
FT   CDS             join(2807503..2807629,2810524..2810674,2812418..2812525,
FT                   2813162..2813311,2814010..2814094,2814469..2814532,
FT                   2815031..2815044)
FT                   /codon_start=1
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, isoform CRA_c"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT8450.1
FT                   protein_id=mCP23122.2 isoform=CRA_c"
FT                   /protein_id="EDL06057.1"
FT                   /translation="MHLLWRLLVLLLGLLALPSALPKQPWPGLTKAHKDGRSTLARIIA
FT                   QGLLKLNAEGRIQSMRLLDRLNVSGTVAPGMVGWLIGGMNFQQQQEISINITNVQLDCG
FT                   GIQMAFPKEWFSANITLEFDIEFKLPFNSNIIKTHACMGLTAESWLEKDEFGRRELVMG
FT                   RCRMEPSSGGASMSTEETSPKMKHFLHNLRESLGKVIPNLVESQVCPLIGEILRQLDVK
FT                   LLKGLVGACS"
FT   mRNA            join(<2807571..2807629,2810524..2810674,2812418..2812525,
FT                   2813162..2813311,2814010..2814094,2814469..2814532,
FT                   2815026..2815142)
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, transcript variant
FT                   mCT189880"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT189880.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2807572..2807629,2810524..2810674,2812418..2812525,
FT                   2813162..2813311,2814010..2814094,2814469..2814532,
FT                   2815026..2815060)
FT                   /codon_start=1
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, isoform CRA_a"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT189880.0
FT                   protein_id=mCP110851.0 isoform=CRA_a"
FT                   /protein_id="EDL06055.1"
FT                   /translation="QPWPGLTKAHKDGRSTLARIIAQGLLKLNAEGRIQSMRLLDRLNV
FT                   SGTVAPGMVGWLIGGMNFQQQQEISINITNVQLDCGGIQMAFPKEWFSANITLEFDIEF
FT                   KLPFNSNIIKTHACMGLTAESWLEKDEFGRRELVMGRCRMEPSSGGASMSTEETSPKMK
FT                   HFLHNLRESLGKVIPNLVESQVCPLIGEILRQLDVKLLKGLVEQVPAHNLGQP"
FT   mRNA            join(<2812434..2812525,2813162..2813311,2813650..2813729,
FT                   2814010..2814094,2814469..2814532,2815026..2815239)
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, transcript variant
FT                   mCT171810"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT171810.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(<2812434..2812525,2813162..2813311,2813650..2813722)
FT                   /codon_start=1
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, isoform CRA_b"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT171810.0
FT                   protein_id=mCP94729.0 isoform=CRA_b"
FT                   /protein_id="EDL06056.1"
FT                   /translation="VQLDCGGIQMAFPKEWFSANITLEFDIEFKLPFNSNIIKTHACMG
FT                   LTAESWLEKDEFGRRELVMGRCRMEPSSGGASMSTEGVLISLCNFQTLNHDTFHGCLPS
FT                   "
FT   gene            2819777..2826094
FT                   /gene="Plunc"
FT                   /locus_tag="mCG_1238"
FT                   /note="gene_id=mCG1238.1"
FT   mRNA            join(2819777..2819819,2820648..2820894,2821119..2821278,
FT                   2822554..2822661,2822969..2823118,2824162..2824240,
FT                   2824542..2824605,2824922..2824997,2825923..2826094)
FT                   /gene="Plunc"
FT                   /locus_tag="mCG_1238"
FT                   /product="palate, lung, and nasal epithelium carcinoma
FT                   associated"
FT                   /note="gene_id=mCG1238.1 transcript_id=mCT8449.1 created on
FT                   13-AUG-2002"
FT   CDS             join(2820660..2820894,2821119..2821278,2822554..2822661,
FT                   2822969..2823118,2824162..2824240,2824542..2824605,
FT                   2824922..2824962)
FT                   /codon_start=1
FT                   /gene="Plunc"
FT                   /locus_tag="mCG_1238"
FT                   /product="palate, lung, and nasal epithelium carcinoma
FT                   associated"
FT                   /note="gene_id=mCG1238.1 transcript_id=mCT8449.1
FT                   protein_id=mCP23121.1"
FT                   /protein_id="EDL06058.1"
FT                   /translation="MFLVGSLVVLCGLLAHSTAQLAGLPLPLGQGPPLPLNQGPPLPLN
FT                   QGQLLPLAQGLPLAVSPALPSNPTDLLAGKFTDALSGGLLSGGLLGILENIPLLDVIKS
FT                   GGGNSNGLVGGLLGKLTSSVPLLNNILDIKITDPQLLELGLVQSPDGHRLYVTIPLGLT
FT                   LNVNMPVVGSLLQLAVKLNITAEVLAVKDNQGRIHLVLGDCTHSPGSLKISLLNGVTPV
FT                   QSFLDNLTGILTKVLPELIQGKVCPLVNGILSGLDVTLVHNIAELLIHGLQFVIKV"
FT   assembly_gap    2829890..2830742
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    2833873..2834360
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    2838364..2838383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2839641..2845484
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /note="gene_id=mCG51428.1"
FT   mRNA            join(2839641..2839692,2840523..2840748,2841143..2841299,
FT                   2842546..2842653,2842954..2843103,2843953..2844031,
FT                   2844291..2844354,2844696..2844770,2845312..2845484)
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /product="RIKEN cDNA 2310021H06, transcript variant
FT                   mCT51611"
FT                   /note="gene_id=mCG51428.1 transcript_id=mCT51611.2 created
FT                   on 13-AUG-2002"
FT   mRNA            join(2839646..2839692,2840523..2840748,2841143..2841299,
FT                   2842546..2842653,2842954..2843103,2844291..2844354,
FT                   2844696..2844770,2845312..2845484)
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /product="RIKEN cDNA 2310021H06, transcript variant
FT                   mCT171815"
FT                   /note="gene_id=mCG51428.1 transcript_id=mCT171815.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(2840535..2840748,2841143..2841299,2842546..2842653,
FT                   2842954..2843103,2843953..2844031,2844291..2844354,
FT                   2844696..2844736)
FT                   /codon_start=1
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /product="RIKEN cDNA 2310021H06, isoform CRA_b"
FT                   /note="gene_id=mCG51428.1 transcript_id=mCT51611.2
FT                   protein_id=mCP42850.2 isoform=CRA_b"
FT                   /protein_id="EDL06060.1"
FT                   /translation="MFLAGSFIVLCGLLAQSTAQLAGLPYPLGQDLPMSMGHCRSLHVG
FT                   QTLPYYGVTPVVSTYPSDHLDRNFRDAFRHGLLSGGILSFLEHIPLLNYVRPTGSNAGG
FT                   LVGVLGKVISSIPLLNNILDIRVTNPQLLEIGLVQSYDFHHLYVTIPLGFDLRVNTLVV
FT                   GSLLELSVKLDVTAEVYAVRDSYGRSRLVIGDCIYPPGSLRISLLNRLGPLQNLIDSLT
FT                   DILTRVIPGLVQGVVCPLVNGVLSLLDVTLAHDVADALLRGVQFVIKA"
FT   CDS             join(2840535..2840748,2841143..2841299,2842546..2842653,
FT                   2842954..2843103,2844291..2844339)
FT                   /codon_start=1
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /product="RIKEN cDNA 2310021H06, isoform CRA_a"
FT                   /note="gene_id=mCG51428.1 transcript_id=mCT171815.0
FT                   protein_id=mCP94734.0 isoform=CRA_a"
FT                   /protein_id="EDL06059.1"
FT                   /translation="MFLAGSFIVLCGLLAQSTAQLAGLPYPLGQDLPMSMGHCRSLHVG
FT                   QTLPYYGVTPVVSTYPSDHLDRNFRDAFRHGLLSGGILSFLEHIPLLNYVRPTGSNAGG
FT                   LVGVLGKVISSIPLLNNILDIRVTNPQLLEIGLVQSYDFHHLYVTIPLGFDLRVNTLVV
FT                   GSLLELSVKLDVTAEVYAVRDSYGRSRLVIGDCIYPPGSLRISLLNRCVLWSMGFSASW
FT                   TSP"
FT   assembly_gap    2847776..2850467
FT                   /estimated_length=2692
FT                   /gap_type="unknown"
FT   assembly_gap    2851151..2851403
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    2854255..2855152
FT                   /estimated_length=898
FT                   /gap_type="unknown"
FT   assembly_gap    2857298..2857631
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    2862871..2863091
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   gene            <2870445..2892637
FT                   /gene="U46068"
FT                   /locus_tag="mCG_3683"
FT                   /note="gene_id=mCG3683.2"
FT   mRNA            join(<2870445..2870485,2872635..2872791,2874677..2874815,
FT                   2875419..2875526,2876415..2876564,2877097..2877178,
FT                   2881159..2881222,2882799..2882884,2884249..2884428,
FT                   2884780..2884833,2885309..2885467,2886576..2886643,
FT                   2887115..2887160,2890489..2890566,2892475..2892637)
FT                   /gene="U46068"
FT                   /locus_tag="mCG_3683"
FT                   /product="cDNA sequence U46068"
FT                   /note="gene_id=mCG3683.2 transcript_id=mCT2870.2 created on
FT                   13-AUG-2002"
FT   CDS             join(<2870447..2870485,2872635..2872791,2874677..2874815,
FT                   2875419..2875526,2876415..2876564,2877097..2877178,
FT                   2881159..2881222,2882799..2882884,2884249..2884428,
FT                   2884780..2884833,2885309..2885467,2886576..2886643,
FT                   2887115..2887160,2890489..2890566,2892475..2892507)
FT                   /codon_start=1
FT                   /gene="U46068"
FT                   /locus_tag="mCG_3683"
FT                   /product="cDNA sequence U46068"
FT                   /note="gene_id=mCG3683.2 transcript_id=mCT2870.2
FT                   protein_id=mCP11593.2"
FT                   /protein_id="EDL06061.1"
FT                   /translation="GEEQADPGLRHIQVLLPATYFSATPRKMAGPWIITLLCGLLGATL
FT                   VQANGYPPAVLNLGPEVIQKHLTQALKDHDATAILQELPLLRAMQDKSGSIPILDSFVH
FT                   TVLKYIIWMKVTSANILQLDVQPSTYDQELVVRIPLDMVAGLNTPLIKTIVEFQMSTEV
FT                   QALIRVERSKSGPAHLNLSDCSSNESTLRLSLLHKLSFVVNSLAKNVMNLLVPALPQIV
FT                   KNHLCPMIQQAFDDMYEDFLRLTTAPIALSPGALEFGLLSPAIQDSNILLNLKAKLLDS
FT                   QARVTNWFNNSATSLMETTPDGAPFSLTVRQDLVNAIVTTLVPKEELVILLRFVIPDVA
FT                   RQLQMDIKEINAEAANKLGPTQMLKIFTHSTPHIVLNEGSARAAQSVVLEVFPTNTDVR
FT                   PFFSLGIEASYEAQFFTEDNRLMLNFNNVSIERIKLMISDIKLFDGKLRTGVPMSMSKA
FT                   LGYEKAMWSVSKGALKLTPASS"
FT   assembly_gap    2878924..2880746
FT                   /estimated_length=1823
FT                   /gap_type="unknown"
FT   assembly_gap    2886921..2886940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2887961..2887980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2889299..2889956
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    2895539..2898138
FT                   /estimated_length=2600
FT                   /gap_type="unknown"
FT   gene            <2899144..2913192
FT                   /gene="BC018465"
FT                   /locus_tag="mCG_140852"
FT                   /note="gene_id=mCG140852.0"
FT   mRNA            join(<2899144..2899254,2900121..2900252,2900912..2900996,
FT                   2901089..2901152,2901525..2901610,2902231..2902413,
FT                   2906007..2906074,2906204..2906249,2907045..2907076,
FT                   2907231..2907276,2908802..2908865,2911120..2911199,
FT                   2913050..2913192)
FT                   /gene="BC018465"
FT                   /locus_tag="mCG_140852"
FT                   /product="cDNA sequence BC018465"
FT                   /note="gene_id=mCG140852.0 transcript_id=mCT171814.0
FT                   created on 04-FEB-2003"
FT   CDS             join(<2899145..2899254,2900121..2900252,2900912..2900996,
FT                   2901089..2901152,2901525..2901610,2902231..2902413,
FT                   2906007..2906074,2906204..2906249,2907045..2907076,
FT                   2907231..2907276,2908802..2908865,2911120..2911199,
FT                   2913050..2913079)
FT                   /codon_start=1
FT                   /gene="BC018465"
FT                   /locus_tag="mCG_140852"
FT                   /product="cDNA sequence BC018465"
FT                   /note="gene_id=mCG140852.0 transcript_id=mCT171814.0
FT                   protein_id=mCP94733.0"
FT                   /protein_id="EDL06062.1"
FT                   /translation="HRLVIEDAKGPEVTLQILSDSLLQITLRCKLYLSFLEILWLEAIK
FT                   NIRIGVRLEQIGNKTQVAFEECHTPPGSLNIEILKRSDTLLPNQLLKLVTNTLEKSLPF
FT                   LLQKIVCPVATNLINFLLEDILHIILPPIISGPDDFQYYVTTTEFTEGAILMRVELVTP
FT                   CGPHQRAPRSEHMVPPPLPGLSQNSMADLAFWLEIYNDILACLYTSQEISVEPQDSSQL
FT                   LCRGEFSLRSQKQQLQFAPHGAVVTLGPYPTIIKEQQKQQLQFAPHGAVVTLGPYPTII
FT                   KEQEERLKTLLLAVLKRWFLPHHNEWLREHSLPLPNIKGVSFSLAQMDFSEDYILLTVP
FT                   E"
FT   assembly_gap    2904669..2904929
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    2907025..2907044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2909191..2909427
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    2915642..2922926
FT                   /estimated_length=7285
FT                   /gap_type="unknown"
FT   assembly_gap    2925466..2932737
FT                   /estimated_length=7272
FT                   /gap_type="unknown"
FT   gene            <2932780..2934438
FT                   /locus_tag="mCG_116891"
FT                   /note="gene_id=mCG116891.0"
FT   mRNA            join(<2932780..2932849,2933095..2933125,2934366..2934438)
FT                   /locus_tag="mCG_116891"
FT                   /product="mCG116891, transcript variant mCT118019"
FT                   /note="gene_id=mCG116891.0 transcript_id=mCT118019.0
FT                   created on 13-AUG-2002"
FT   mRNA            join(<2932781..2932849,2934366..>2934433)
FT                   /locus_tag="mCG_116891"
FT                   /product="mCG116891, transcript variant mCT171809"
FT                   /note="gene_id=mCG116891.0 transcript_id=mCT171809.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<2932781..2932849,2934366..>2934433)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116891"
FT                   /product="mCG116891, isoform CRA_b"
FT                   /note="gene_id=mCG116891.0 transcript_id=mCT171809.0
FT                   protein_id=mCP94728.0 isoform=CRA_b"
FT                   /protein_id="EDL06064.1"
FT                   /translation="EIIHLPWQQDFKLHTDTRCQAHKKEEVEGILSEVGKVAWSNFNGM
FT                   "
FT   CDS             join(<2932782..2932849,2933095..2933125,2934366..2934434)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116891"
FT                   /product="mCG116891, isoform CRA_a"
FT                   /note="gene_id=mCG116891.0 transcript_id=mCT118019.0
FT                   protein_id=mCP72748.0 isoform=CRA_a"
FT                   /protein_id="EDL06063.1"
FT                   /translation="KLFISHGSKISNSTLIPDVKLIRSEHSVVPPEAKEEVEGILSEVG
FT                   KVAWSNFNGM"
FT   assembly_gap    2934659..2936559
FT                   /estimated_length=1901
FT                   /gap_type="unknown"
FT   assembly_gap    2939103..2939397
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    2946168..2946187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2961310..2961329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2972512..>2976838
FT                   /locus_tag="mCG_116886"
FT                   /note="gene_id=mCG116886.0"
FT   mRNA            join(<2972512..2972618,2974677..2974956,2976616..>2976838)
FT                   /locus_tag="mCG_116886"
FT                   /product="mCG116886"
FT                   /note="gene_id=mCG116886.0 transcript_id=mCT118014.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<2972514..2972618,2974677..2974956,2976616..>2976838)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116886"
FT                   /product="mCG116886"
FT                   /note="gene_id=mCG116886.0 transcript_id=mCT118014.0
FT                   protein_id=mCP72694.0"
FT                   /protein_id="EDL06065.1"
FT                   /translation="GTGWAIKGDTCFRKTAEAGAGEAAPEDSKPSTRGKVSATKMWVLQ
FT                   ALAIMLSIQAGTLDLVETPPVVGNLPVAVPAPLNLPVGGLSPPVLKGPVNHQMLPPKRP
FT                   VPPPKGGKCAPAARYFLSSDKLHDYLMSTLPPQIEDMVKCDEVNLEGMLADVLNTVESS
FT                   DLLSLLDGISLLKAGEGGGLGIGGLLGNEGNGDSSKPSSG"
FT   assembly_gap    2976839..2980732
FT                   /estimated_length=3894
FT                   /gap_type="unknown"
FT   gene            <2980741..2983447
FT                   /locus_tag="mCG_116895"
FT                   /note="gene_id=mCG116895.0"
FT   mRNA            join(<2980741..2980901,2981507..2981629,2981787..2981854,
FT                   2982100..2982130,2983375..2983447)
FT                   /locus_tag="mCG_116895"
FT                   /product="mCG116895"
FT                   /note="gene_id=mCG116895.0 transcript_id=mCT118023.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<2980743..2980901,2981507..2981629,2981787..2981854,
FT                   2982100..2982130,2983375..2983443)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116895"
FT                   /product="mCG116895"
FT                   /note="gene_id=mCG116895.0 transcript_id=mCT118023.0
FT                   protein_id=mCP73041.0"
FT                   /protein_id="EDL06066.1"
FT                   /translation="LPSLAKANIGNKTVPVPGGRLPPDPKNASIAVTISSTTLKTLVKE
FT                   VAKNSSVQMDGLEAQITHIAFASQENNTLRVVYKVDITKNGEHFATGETKLFISHGSKI
FT                   SNSTLIPDVKLIRSEHSVVPPEAKEEVEGILSEVGKAAWSNFNGM"
FT   assembly_gap    2984155..2985231
FT                   /estimated_length=1077
FT                   /gap_type="unknown"
FT   assembly_gap    2988781..2988800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2992028..2992047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2997229..2997450
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   gene            complement(3000001..3031650)
FT                   /gene="Cdk5rap1"
FT                   /locus_tag="mCG_3682"
FT                   /note="gene_id=mCG3682.1"
FT   mRNA            complement(join(3000001..3000147,3007021..3007161,
FT                   3010606..3010755,3013391..3013521,3015558..3015613,
FT                   3016922..3017019,3017930..3018160,3018830..3018950,
FT                   3019966..3020176,3024747..3024847,3026990..3027024,
FT                   3027588..3027691,3029412..3029731,3031612..3031650))
FT                   /gene="Cdk5rap1"
FT                   /locus_tag="mCG_3682"
FT                   /product="CDK5 regulatory subunit associated protein 1"
FT                   /note="gene_id=mCG3682.1 transcript_id=mCT2869.1 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(3000061..3000147,3007021..3007161,
FT                   3010606..3010755,3013391..3013521,3015558..3015613,
FT                   3016922..3017019,3017930..3018160,3018830..3018950,
FT                   3019966..3020176,3024747..3024847,3026990..3027024,
FT                   3027588..3027691,3029412..3029712))
FT                   /codon_start=1
FT                   /gene="Cdk5rap1"
FT                   /locus_tag="mCG_3682"
FT                   /product="CDK5 regulatory subunit associated protein 1"
FT                   /note="gene_id=mCG3682.1 transcript_id=mCT2869.1
FT                   protein_id=mCP11592.1"
FT                   /protein_id="EDL06067.1"
FT                   /translation="MHPLRCVLQVQRLSAPFTSMCWVLLRTCRAQSSVSSTPCPSPEAK
FT                   SSEAQKDFSSRLATGPTFQHFLRSASVPQEKPSSPEVEDPPPYLSGDELLGRQRKVYLE
FT                   TYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVILLVTCSIREKAEQTIWNRLHQLKV
FT                   LKTKRPRSRVPLRIGILGCMAERLKGEILNREKMVDLLAGPDAYRDLPRLLAVVESGQQ
FT                   AANVLLSLDETYADIMPVQTSPSATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPVASI
FT                   LDEVRKLSEQGLKEVTLLGQNVNSFRDNSEVQFNNAGSANLSRGFTTNYKPKQGGLRFS
FT                   HLLDQVSRIDPEMRIRFTSPHPKDFPDEVLQLIRERHNICKQIHLPAQSGSSRVLDAMR
FT                   RGYSREAYVALVHHVRETIPGVSLSSDFITGFCGETEDDHRQTVSLLREVQYNTGFLFA
FT                   YSMRQKTRAYHRLKDDVPEEVKLRRLEELITVFREEASKANKTSVGCSQLVLVEGFSKR
FT                   STTDLCGRNDANLKVIFPDAEVEDITNPGLKVRAQPGDYVLVKITSASSQTLKGHILCR
FT                   TTMKDSLTYCTT"
FT   assembly_gap    3000969..3000988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3003296..3003344
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3022806..3022825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3030773..3030950
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            complement(3035269..3068325)
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /note="gene_id=mCG3681.2"
FT   mRNA            complement(join(3035269..3035856,3035955..3036142,
FT                   3036956..3037206,3039632..3039762,3039869..3040076,
FT                   3042738..3042942,3063966..3064151,3067924..3068325))
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /product="syntrophin, acidic 1, transcript variant mCT2872"
FT                   /note="gene_id=mCG3681.2 transcript_id=mCT2872.2 created on
FT                   13-AUG-2002"
FT   mRNA            complement(join(3035276..3035856,3035955..3036142,
FT                   3036956..3037152,3039632..3039762,3039869..3040076,
FT                   3042738..3042942,3063966..3064151,3067924..>3068276))
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /product="syntrophin, acidic 1, transcript variant
FT                   mCT189873"
FT                   /note="gene_id=mCG3681.2 transcript_id=mCT189873.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3035764..3035856,3035955..3036142,
FT                   3036956..3037152,3039632..3039762,3039869..3040076,
FT                   3042738..3042942,3063966..3064151,3067924..>3068275))
FT                   /codon_start=1
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /product="syntrophin, acidic 1, isoform CRA_a"
FT                   /note="gene_id=mCG3681.2 transcript_id=mCT189873.0
FT                   protein_id=mCP110884.0 isoform=CRA_a"
FT                   /protein_id="EDL06068.1"
FT                   /translation="GAGRVRRDRASAVYWDFEAKMASGRRAPRTGLLELRCGAGSGAGG
FT                   ERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTV
FT                   RKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHD
FT                   EAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRN
FT                   LSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQ
FT                   IGTFIPWVKDELQALLTATGTAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLFYCS
FT                   LPQSREALSRPTRTAPLIATRLVHSGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVES
FT                   PQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAM
FT                   LLRQPFEKLQMSSDDGTSLLFLDFGGAEGEIQLDLHSCPKTMVFIIHSFLSAKVTRLGL
FT                   LA"
FT   CDS             complement(join(3035764..3035856,3035955..3036142,
FT                   3036956..3037206,3039632..3039762,3039869..3040076,
FT                   3042738..3042942,3063966..3064151,3067924..3068215))
FT                   /codon_start=1
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /product="syntrophin, acidic 1, isoform CRA_b"
FT                   /note="gene_id=mCG3681.2 transcript_id=mCT2872.2
FT                   protein_id=mCP11591.2 isoform=CRA_b"
FT                   /protein_id="EDL06069.1"
FT                   /translation="MASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPA
FT                   DGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKM
FT                   PILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM
FT                   KEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTP
FT                   TDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGTFIPWVKDELQALLTATG
FT                   TAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLFYCSLPQSREALSRPTRTAPLIAT
FT                   RSLPRPHPAPCLALCSAHRLVHSGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQ
FT                   ELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAMLL
FT                   RQPFEKLQMSSDDGTSLLFLDFGGAEGEIQLDLHSCPKTMVFIIHSFLSAKVTRLGLLA
FT                   "
FT   assembly_gap    3044607..3045357
FT                   /estimated_length=751
FT                   /gap_type="unknown"
FT   assembly_gap    3046478..3046830
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    3047588..3047821
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    3069534..3070482
FT                   /estimated_length=949
FT                   /gap_type="unknown"
FT   assembly_gap    3076447..3082924
FT                   /estimated_length=6478
FT                   /gap_type="unknown"
FT   assembly_gap    3084542..3084561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3085722..3087420
FT                   /locus_tag="mCG_1027983"
FT                   /note="gene_id=mCG1027983.0"
FT   mRNA            join(<3085722..3085851,3086848..3087420)
FT                   /locus_tag="mCG_1027983"
FT                   /product="mCG1027983"
FT                   /note="gene_id=mCG1027983.0 transcript_id=mCT145687.0
FT                   created on 13-AUG-2002"
FT   gene            complement(<3086847..>3088489)
FT                   /locus_tag="mCG_140851"
FT                   /note="gene_id=mCG140851.0"
FT   mRNA            complement(join(<3086847..3087467,3088447..>3088489))
FT                   /locus_tag="mCG_140851"
FT                   /product="mCG140851"
FT                   /note="gene_id=mCG140851.0 transcript_id=mCT171806.0
FT                   created on 13-AUG-2002"
FT   CDS             complement(<3086847..>3087030)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140851"
FT                   /product="mCG140851"
FT                   /note="gene_id=mCG140851.0 transcript_id=mCT171806.0
FT                   protein_id=mCP94725.0"
FT                   /protein_id="EDL06071.1"
FT                   /translation="LWVVKSRKENSGAKELALCSPHSPLPPFLSFFLFFFKIDCFITCK
FT                   YSVAIFRHTRRGHQIS"
FT   CDS             <3086969..3087232
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027983"
FT                   /product="mCG1027983"
FT                   /note="gene_id=mCG1027983.0 transcript_id=mCT145687.0
FT                   protein_id=mCP72922.0"
FT                   /protein_id="EDL06070.1"
FT                   /translation="GEQRANSLAPEFSFLLFTTQSQGLPKSLPLVTHTAPPFCGSPHIH
FT                   TARTQASARATLFLFLADVSHGLFFTQKFPQKHSLVIFPKSQ"
FT   gene            <3103579..3208364
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /note="gene_id=mCG3688.2"
FT   mRNA            join(<3103579..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200239..3200426,3203898..3204768)
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), transcript variant
FT                   mCT189876"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT189876.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3103580..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200239..3200426,3203898..3204194)
FT                   /codon_start=1
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), isoform CRA_a"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT189876.0
FT                   protein_id=mCP110885.0 isoform=CRA_a"
FT                   /protein_id="EDL06072.1"
FT                   /translation="RRRWCGRVRRVQVPACACGGLRQRVEASGARDRLRSAMVGVPGAA
FT                   AFQLGCEKRVPAMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTALSNGINHS
FT                   PPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISP
FT                   EIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCAR
FT                   AAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERDTVPP
FT                   EPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKML
FT                   EHREVRERHHNLSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAV
FT                   LRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPAT
FT                   GYVPVEFWKKTEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAA
FT                   EDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHG
FT                   HSPHSQSRPLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL"
FT   mRNA            join(<3103594..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200236..3200426,3203898..3204085,3205332..3208364)
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), transcript variant
FT                   mCT2866"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT2866.2 created on
FT                   13-AUG-2002"
FT   CDS             join(<3103595..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200236..3200426,3203898..3204085,3205332..3205443)
FT                   /codon_start=1
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), isoform CRA_c"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT2866.2
FT                   protein_id=mCP11588.2 isoform=CRA_c"
FT                   /protein_id="EDL06074.1"
FT                   /translation="GRVRRVQVPACACGGLRQRVEASGARDRLRSAMVGVPGAAAFQLG
FT                   CEKRVPAMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLN
FT                   GAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEK
FT                   VRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQT
FT                   PSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERDTVPPEPPAK
FT                   RVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREV
FT                   RERHHNLSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVLRRCQ
FT                   ESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPATGYVPV
FT                   EFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAAEDAF
FT                   LVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHGHSPH
FT                   SQSRPLLPGGRGSARNFSNYLILQIEFGDIDLVIIGPIDQAKYCSHLFLAI"
FT   mRNA            join(<3103612..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200236..3200426,3203898..3204796)
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), transcript variant
FT                   mCT189877"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT189877.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3103613..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200236..3200426,3203898..3204194)
FT                   /codon_start=1
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), isoform CRA_b"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT189877.0
FT                   protein_id=mCP110886.0 isoform=CRA_b"
FT                   /protein_id="EDL06073.1"
FT                   /translation="QVPACACGGLRQRVEASGARDRLRSAMVGVPGAAAFQLGCEKRVP
FT                   AMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLNGAPSPP
FT                   QRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVL
FT                   ALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLA
FT                   QHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERDTVPPEPPAKRVCTIS
FT                   PAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREVRERHHN
FT                   LSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVLRRCQESDREE
FT                   LNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPATGYVPVEFWKKT
FT                   EEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAAEDAFLVINEQ
FT                   EESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHGHSPHSQSRPL
FT                   LPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL"
FT   assembly_gap    3106132..3106151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3130122..3466344)
FT                   /locus_tag="mCG_147175"
FT                   /note="gene_id=mCG147175.0"
FT   mRNA            complement(join(3130122..3130899,3466314..3466344))
FT                   /locus_tag="mCG_147175"
FT                   /product="mCG147175"
FT                   /note="gene_id=mCG147175.0 transcript_id=mCT187438.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3130405..3130530)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147175"
FT                   /product="mCG147175"
FT                   /note="gene_id=mCG147175.0 transcript_id=mCT187438.0
FT                   protein_id=mCP109235.0"
FT                   /protein_id="EDL06075.1"
FT                   /translation="MKTRDLATDRTHFVVVVVWLVGWFWFFLHPQGLEAIPSPRI"
FT   assembly_gap    3151808..3151827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3153434..3156352)
FT                   /locus_tag="mCG_147184"
FT                   /note="gene_id=mCG147184.0"
FT   mRNA            complement(join(3153434..3155287,3155537..3156352))
FT                   /locus_tag="mCG_147184"
FT                   /product="mCG147184"
FT                   /note="gene_id=mCG147184.0 transcript_id=mCT187447.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3155955..3156332)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147184"
FT                   /product="mCG147184"
FT                   /note="gene_id=mCG147184.0 transcript_id=mCT187447.0
FT                   protein_id=mCP109245.0"
FT                   /protein_id="EDL06076.1"
FT                   /translation="MRGTLSCILGSKKSFTSHHHIPGHTTQIFSFYTYLSNSDRACQPP
FT                   LGFHLVVCPLIFEKLCSYGPQKDTVSGLEWEKAHTHKQQRTWGSGVERPKTKTAMRSFW
FT                   QYANCNSIWYGTSDIEHGALR"
FT   assembly_gap    3174603..3174622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3213273..3227766)
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /note="gene_id=mCG3680.3"
FT   mRNA            complement(join(3213273..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3225937..3225968,
FT                   3227626..3227766))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT185429"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185429.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3213279..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3225944..3225968,3227626..3227740))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT2876"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT2876.1 created on
FT                   12-JUN-2003"
FT   mRNA            complement(join(3213279..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3226269..3226365))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT185426"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185426.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3213279..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215196,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3225944..3226168))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT185428"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185428.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3213280..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215196,3215684..3215763,
FT                   3215920..3216038,3216308..3216444,3223534..3223631,
FT                   3223787..3223812,3224474..3224582,3225944..3225968,
FT                   3227626..3227740))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT171811"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT171811.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215196,3215684..3215763,
FT                   3215920..3216038,3216308..3216444,3223534..3223631,
FT                   3223787..3223812,3224474..3224582,3225944..3225968,
FT                   3227626..3227727))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT171811.0
FT                   protein_id=mCP94730.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D6J4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1861721"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D6J4"
FT                   /protein_id="EDL06077.1"
FT                   /translation="MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDG
FT                   KLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAAL
FT                   ESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLEAQAH
FT                   GQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQVNRL
FT                   QELIDQLECKRQVQVAEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAFTLYEF
FT                   WQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3225944..3225968,3227626..3227727))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_e"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT2876.1
FT                   protein_id=mCP11587.1 isoform=CRA_e"
FT                   /db_xref="GOA:Q9D6J4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1861721"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D6J4"
FT                   /protein_id="EDL06081.1"
FT                   /translation="MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDG
FT                   KLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAAL
FT                   ESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLEAQAH
FT                   GQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQVNRL
FT                   QELIDQLECKAPRLEPTHEEDLTKGFDSHILVAQRQVQVAEDALQDFHRALCCYMNFTG
FT                   AQSHCLHVSAQKMLDNAAFTLYEFWQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTT
FT                   VFFPASWWIMNNN"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3225937..3225968,
FT                   3227626..3227727))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_d"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185429.0
FT                   protein_id=mCP106686.0 isoform=CRA_d"
FT                   /protein_id="EDL06080.1"
FT                   /translation="MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNGEC
FT                   NLETEKLCDYFSTHLGVYRPVLAALESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLR
FT                   ETVNQLQALQTSLEGASDTLEAQAHGQRLDEETIKAQSRPCGSRRAGRRALRSISWSPS
FT                   WSPGSSDTGRSSEAEQQWRLQVNRLQELIDQLECKAPRLEPTHEEDLTKGFDSHILVAQ
FT                   RQVQVAEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAFTLYEFWQDEASWRRH
FT                   QQSPCSKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3226269..3226278))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185426.0
FT                   protein_id=mCP106687.0 isoform=CRA_b"
FT                   /protein_id="EDL06078.1"
FT                   /translation="MPKDDGKLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETE
FT                   KLCDYFSTHLGVYRPVLAALESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLRETVNQ
FT                   LQALQTSLEGASDTLEAQAHGQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGS
FT                   SDTGRSSEAEQQWRLQVNRLQELIDQLECKAPRLEPTHEEDLTKGFDSHILVAQRQVQV
FT                   AEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAFTLYEFWQDEASWRRHQQSPC
FT                   SKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215196,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223551))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_c"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185428.0
FT                   protein_id=mCP106684.0 isoform=CRA_c"
FT                   /protein_id="EDL06079.1"
FT                   /translation="MDTTKLEYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLE
FT                   AQAHGQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQ
FT                   VNRLQELIDQLECKAPRLEPTHEEDLTKGFDSRQVQVAEDALQDFHRALCCYMNFTGAQ
FT                   SHCLHVSAQKMLDNAAFTLYEFWQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTTVF
FT                   FPASWWIMNNN"
FT   gene            <3216002..3218890
FT                   /locus_tag="mCG_3690"
FT                   /note="gene_id=mCG3690.2"
FT   mRNA            join(<3216002..3216056,3217839..3217950,3218219..>3218713)
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, transcript variant mCT171813"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT171813.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(<3216025..3216056,3217839..3217950,3218219..>3218713)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, isoform CRA_a"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT171813.0
FT                   protein_id=mCP94732.0 isoform=CRA_a"
FT                   /protein_id="EDL06083.1"
FT                   /translation="FLHPTWKESRSSHKRTKAPNQANKDRPPDMDKARHKQFFSHLKRK
FT                   KPSWREAPDPARVGENPRIKAGKVCSGQWVPVGRQGLRVRGTVGLRRLGRARKKPQAPR
FT                   GHVLPFTPAHPQTKIVLLFPLDKRQQLAEAAAGPFVRPVRPTEDPLGAPTCFPAVAPML
FT                   RGAGDGVDRREGARAREMKRILVLLLQLDARLQEEGRRVGGRPGGGAKVP"
FT   mRNA            join(<3217769..3217950,3218219..3218278,3218423..3218890)
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, transcript variant mCT2863"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT2863.2 created on
FT                   13-AUG-2002"
FT   CDS             join(<3217771..3217950,3218219..3218278,3218423..3218830)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, isoform CRA_b"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT2863.2
FT                   protein_id=mCP11589.2 isoform=CRA_b"
FT                   /protein_id="EDL06084.1"
FT                   /translation="PRQHGQWPLVTSPVTSPIMGNSSSHKRTKAPNQANKDRPPDMDKA
FT                   RHKQFFSHLKRKKPSWREAPDPARVGENPRIKAGKTKIVLLFPLDKRQQLAEAAAGPFV
FT                   RPVRPTEDPLGAPTCFPAVAPMLRGAGDGVDRREGARAREMKRILVLLLQLDARLQEEG
FT                   RRVGGRPGGGAKVPQCWQPLYAHVLTQRDACGEGDPREEQPRKRRRCPRPRP"
FT   mRNA            join(<3217810..3217950,3218180..3218278,3218423..>3218579)
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, transcript variant mCT171812"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT171812.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(<3217810..3217950,3218180..3218278,3218423..>3218579)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, isoform CRA_c"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT171812.0
FT                   protein_id=mCP94731.0 isoform=CRA_c"
FT                   /protein_id="EDL06085.1"
FT                   /translation="VTSPIMGNSSSHKRTKAPNQANKDRPPDMDKARHKQFFSHLKRKK
FT                   PSPMASQHATFPFFQWREAPDPARVGENPRIKAGKTKIVLLFPLDKRQQLAEAAAGPFV
FT                   RPVRPTEDPLGAPTCFPAVAPMLRGAGD"
FT   mRNA            complement(join(3223177..3223631,3223787..3223812,
FT                   3224474..3224582,3225944..3225968,3227626..3227740))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT185427"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185427.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(3223408..3223631,3223787..3223812,
FT                   3224474..3224582,3225944..3225968,3227626..3227727))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_f"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185427.0
FT                   protein_id=mCP106685.0 isoform=CRA_f"
FT                   /protein_id="EDL06082.1"
FT                   /translation="MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDG
FT                   KLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAAL
FT                   ESLNRAVLTAMDTTKLVSAGRGRGEPEVSEPSEAVETRVGFKFWHSYLPTVPFPPEP"
FT   assembly_gap    3227767..3227786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3228664..3240921)
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /note="gene_id=mCG3689.2"
FT   mRNA            complement(join(3228664..3229703,3230099..3230575,
FT                   3230671..3230890,3230987..3231101,3234017..3234169,
FT                   3234968..3235187,3235491..3235581,3240558..3240921))
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /product="E2F transcription factor 1, transcript variant
FT                   mCT2867"
FT                   /note="gene_id=mCG3689.2 transcript_id=mCT2867.2 created on
FT                   21-AUG-2002"
FT   assembly_gap    3229765..3229784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3229785..3230575,3230671..3230890,
FT                   3230987..3231101,3234017..3234169,3234968..3235187,
FT                   3235491..3235581,3240136..3240488))
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /product="E2F transcription factor 1, transcript variant
FT                   mCT172117"
FT                   /note="gene_id=mCG3689.2 transcript_id=mCT172117.0 created
FT                   on 21-AUG-2002"
FT   CDS             complement(join(3230328..3230575,3230671..3230890,
FT                   3230987..3231101,3234017..3234169,3234968..3235187,
FT                   3235491..3235581,3240558..3240803))
FT                   /codon_start=1
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /product="E2F transcription factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG3689.2 transcript_id=mCT2867.2
FT                   protein_id=mCP11586.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q547J6"
FT                   /db_xref="InterPro:IPR003316"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015633"
FT                   /db_xref="InterPro:IPR032198"
FT                   /db_xref="MGI:MGI:101941"
FT                   /db_xref="UniProtKB/TrEMBL:Q547J6"
FT                   /protein_id="EDL06086.1"
FT                   /translation="MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQL
FT                   PAAPPTGPRDSDVLLFATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFR
FT                   GRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIY
FT                   DITNVLEGIQLIAKKSKNHIQWLGSHTMVGIGKRLEGLTQDLQQLQESEQQLDHLMHIC
FT                   TTQLQLLSEDSDTQRLAYVTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSSETFQISL
FT                   KSKQGPIDVFLCPEESADGISPGKTSCQETSSGEDRTADSGPAGPPPSPPSTSPALDPS
FT                   QSLLGLEQEAVLPRMGHLRVPMEEDQLSPLVAADSLLEHVKEDFSGLLPGEFISLSPPH
FT                   EALDYHFGLEEGEGIRDLFDCDFGDLTPLDF"
FT   CDS             complement(join(3230328..3230575,3230671..3230890,
FT                   3230987..3231101,3234017..3234169,3234968..3235187,
FT                   3235491..3235581,3240136..3240246))
FT                   /codon_start=1
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /product="E2F transcription factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG3689.2 transcript_id=mCT172117.0
FT                   protein_id=mCP95036.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CYB4"
FT                   /db_xref="InterPro:IPR003316"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015633"
FT                   /db_xref="InterPro:IPR032198"
FT                   /db_xref="MGI:MGI:101941"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CYB4"
FT                   /protein_id="EDL06087.1"
FT                   /translation="MGKCFTQLQMVGLIFELMSAGLLQNLWLGSAHSCLLEVKRRLDLE
FT                   TDHQYLAGSSGPFRGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLN
FT                   WAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTMVGIGKRLEGLTQDLQQL
FT                   QESEQQLDHLMHICTTQLQLLSEDSDTQRLAYVTCQDLRSIADPAEQMVIVIKAPPETQ
FT                   LQAVDSSETFQISLKSKQGPIDVFLCPEESADGISPGKTSCQETSSGEDRTADSGPAGP
FT                   PPSPPSTSPALDPSQSLLGLEQEAVLPRMGHLRVPMEEDQLSPLVAADSLLEHVKEDFS
FT                   GLLPGEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF"
FT   assembly_gap    3232490..3232509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3256904..3275205)
FT                   /gene="Pxmp4"
FT                   /locus_tag="mCG_3687"
FT                   /note="gene_id=mCG3687.2"
FT   mRNA            complement(join(3256904..3259237,3263299..3263497,
FT                   3267716..3267778,3275033..3275205))
FT                   /gene="Pxmp4"
FT                   /locus_tag="mCG_3687"
FT                   /product="peroxisomal membrane protein 4"
FT                   /note="gene_id=mCG3687.2 transcript_id=mCT2873.2 created on
FT                   21-AUG-2002"
FT   CDS             complement(join(3258974..3259237,3263299..3263497,
FT                   3267716..3267778,3275033..3275145))
FT                   /codon_start=1
FT                   /gene="Pxmp4"
FT                   /locus_tag="mCG_3687"
FT                   /product="peroxisomal membrane protein 4"
FT                   /note="gene_id=mCG3687.2 transcript_id=mCT2873.2
FT                   protein_id=mCP11585.2"
FT                   /protein_id="EDL06088.1"
FT                   /translation="MAAPPQLQALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRA
FT                   PHALVMTFLFRSGSLREKLQAILKATYIHSRNLACFVFAYKSLHALQSHVQGETHQMHS
FT                   FLAAFIGGLLLFGENNNINSQINMYLTSRVLYALCRLGVEKGYIPALKWDPFPLHTAVI
FT                   WGLVLWLFEYHRPTLQPSLQSSMTYLYEDSNVWHDLSDFLIFNKSHPSK"
FT   gene            complement(3283341..3284890)
FT                   /locus_tag="mCG_147174"
FT                   /note="gene_id=mCG147174.0"
FT   mRNA            complement(3283341..3284890)
FT                   /locus_tag="mCG_147174"
FT                   /product="mCG147174"
FT                   /note="gene_id=mCG147174.0 transcript_id=mCT187437.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3284467..3284652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147174"
FT                   /product="mCG147174"
FT                   /note="gene_id=mCG147174.0 transcript_id=mCT187437.0
FT                   protein_id=mCP109234.0"
FT                   /protein_id="EDL06089.1"
FT                   /translation="MIAAHSLLQGCNTNPPHRDCLLHGYPTPCNCATLIGKQPSRRTPI
FT                   SGLNSSVYVRFPQCSS"
FT   assembly_gap    3284891..3284910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3286286..3286305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3287956..3287975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3291030..3292486
FT                   /estimated_length=1457
FT                   /gap_type="unknown"
FT   gene            3295887..3320896
FT                   /gene="Zfp341"
FT                   /locus_tag="mCG_50868"
FT                   /note="gene_id=mCG50868.1"
FT   mRNA            join(3295887..3295997,3299008..3299204,3300931..3301080,
FT                   3302930..3303125,3304532..3304622,3306434..3306624,
FT                   3308211..3308401,3312165..3312373,3315444..3315540,
FT                   3316107..3316239,3317588..3317699,3317886..3317956,
FT                   3319706..3320896)
FT                   /gene="Zfp341"
FT                   /locus_tag="mCG_50868"
FT                   /product="zinc finger protein 341"
FT                   /note="gene_id=mCG50868.1 transcript_id=mCT51051.1 created
FT                   on 21-AUG-2002"
FT   CDS             join(3295889..3295997,3299008..3299204,3300931..3301080,
FT                   3302930..3303125,3304532..3304622,3306434..3306624,
FT                   3308211..3308401,3312165..3312373,3315444..3315540,
FT                   3316107..3316239,3317588..3317699,3317886..3317956,
FT                   3319706..3320220)
FT                   /codon_start=1
FT                   /gene="Zfp341"
FT                   /locus_tag="mCG_50868"
FT                   /product="zinc finger protein 341"
FT                   /note="gene_id=mCG50868.1 transcript_id=mCT51051.1
FT                   protein_id=mCP38964.1"
FT                   /protein_id="EDL06090.1"
FT                   /translation="MDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCG
FT                   KCKKQFNSLPAFMTHKREQCQANAPALATVSLATNSIYTPSAAPAAVQQAPPPANRQIS
FT                   TYITVPPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPPGPPPVQVPSQCVEAPVY
FT                   PTPPVYSPGKQEFKPKGPSSTAPMTNATGSTVATFDSPPTLKTRRAKGASGLPEAAGKP
FT                   KAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFAQKSNVKKHMQTHKVWP
FT                   PGRSGGTVSRNSVTVQVMALNPNRQEEEDTGLGQSLSSTTQPQALPTAGEDEGDKPEAK
FT                   QVVLIGSSYLCQFCPSKFSTYFQLKSHMIQHKKEQVYKCVVKSCAQMFPKLDTFLEHIR
FT                   SHQEELSYRCHLCSKDFPSLYDLGVHQYSHSLLPQHSPKKDSTVYKCVKCVNKYSTPEA
FT                   LEHHVQTATHSFPCPHCQKVFPCERYLRRHLPTHGSGGRFRCQICKKFFRKEHYLKLHA
FT                   HIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSMHTGCSKEFNRQDKLKA
FT                   HILSHAGLKLHKCGLCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGFSRHKYLKDHRC
FT                   RLGSTKDKDLQARRPPRRRATARGGGSIASGHKEENPMPDPLGLEELKAAGPSPEAAPG
FT                   KPPFEQDAVLSIVVGGDPELVVPGHTEGLGSNLALAELQAGTEGGCAMLAVPVYIQASE
FT                   "
FT   assembly_gap    3302078..3302097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3304555..>3306789)
FT                   /locus_tag="mCG_140921"
FT                   /note="gene_id=mCG140921.0"
FT   mRNA            complement(join(3304555..3304701,3306421..>3306789))
FT                   /locus_tag="mCG_140921"
FT                   /product="mCG140921"
FT                   /note="gene_id=mCG140921.0 transcript_id=mCT172118.0
FT                   created on 21-AUG-2002"
FT   CDS             complement(join(3304677..3304701,3306421..>3306776))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140921"
FT                   /product="mCG140921"
FT                   /note="gene_id=mCG140921.0 transcript_id=mCT172118.0
FT                   protein_id=mCP95037.0"
FT                   /protein_id="EDL06091.1"
FT                   /translation="GWVCWDRACIAEIELSSRIQETLDLVPTTIRQLSKASEGMRGESG
FT                   SPSPLTRVFLFLPVGVQSHDLYGHRVSGDCAATSPWRPHLMSLHVLLDVRLLGKGTATR
FT                   NALEGLLPCVAIGTRLMDGQRA"
FT   assembly_gap    3307148..3307178
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            <3331010..3377006
FT                   /gene="Chmp4b"
FT                   /locus_tag="mCG_3685"
FT                   /note="gene_id=mCG3685.1"
FT   mRNA            join(<3331010..3331149,3331345..3331476,3371749..3371926,
FT                   3373441..3373555,3374779..3374905,3376171..3377006)
FT                   /gene="Chmp4b"
FT                   /locus_tag="mCG_3685"
FT                   /product="chromatin modifying protein 4B"
FT                   /note="gene_id=mCG3685.1 transcript_id=mCT2868.1 created on
FT                   21-AUG-2002"
FT   CDS             join(<3331011..3331149,3331345..3331476,3371749..3371926,
FT                   3373441..3373555,3374779..3374905,3376171..3376235)
FT                   /codon_start=1
FT                   /gene="Chmp4b"
FT                   /locus_tag="mCG_3685"
FT                   /product="chromatin modifying protein 4B"
FT                   /note="gene_id=mCG3685.1 transcript_id=mCT2868.1
FT                   protein_id=mCP11584.1"
FT                   /protein_id="EDL06092.1"
FT                   /translation="AAGPSCGAEVEARPAAAGSGRPGVGAGAEPSRAGVGAGGRRGEQQ
FT                   PSTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEK
FT                   QLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIA
FT                   DQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVP
FT                   SVALPSKPAKKKEEEDDDMKELENWAGSM"
FT   assembly_gap    3331150..3331344
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    3335935..3335954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3339020..3339039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3340900..3340919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3342359..3342378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3352009..3352028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3382502..3383144
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   gene            3386304..3387233
FT                   /pseudo
FT                   /locus_tag="mCG_48857"
FT                   /note="gene_id=mCG48857.2"
FT   mRNA            3386304..3387233
FT                   /pseudo
FT                   /locus_tag="mCG_48857"
FT                   /note="gene_id=mCG48857.2 transcript_id=mCT49040.2 created
FT                   on 21-AUG-2002"
FT   assembly_gap    3387556..3387641
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    3394051..3394413
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   gene            complement(3405109..>3421367)
FT                   /locus_tag="mCG_1027985"
FT                   /note="gene_id=mCG1027985.1"
FT   mRNA            complement(join(3405109..3405324,3416287..3416478,
FT                   3421286..>3421367))
FT                   /locus_tag="mCG_1027985"
FT                   /product="mCG1027985"
FT                   /note="gene_id=mCG1027985.1 transcript_id=mCT145689.1
FT                   created on 21-AUG-2002"
FT   CDS             complement(join(3405181..3405324,3416287..>3416400))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027985"
FT                   /product="mCG1027985"
FT                   /note="gene_id=mCG1027985.1 transcript_id=mCT145689.1
FT                   protein_id=mCP72935.0"
FT                   /protein_id="EDL06093.1"
FT                   /translation="KWLKWVKHLPYVCEDLHLSLQHSSWDVGSGESIPWSRQLSTRMGM
FT                   WRSRDNLERSLTPSMWDPGIKLTSSALDSKCLYFAPEPSH"
FT   assembly_gap    3409563..3409920
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    3411099..3411691
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    3414770..3414789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3421518..3422929
FT                   /locus_tag="mCG_147186"
FT                   /note="gene_id=mCG147186.0"
FT   mRNA            3421518..3422929
FT                   /locus_tag="mCG_147186"
FT                   /product="mCG147186"
FT                   /note="gene_id=mCG147186.0 transcript_id=mCT187449.0
FT                   created on 13-JAN-2004"
FT   CDS             3422113..3422418
FT                   /codon_start=1
FT                   /locus_tag="mCG_147186"
FT                   /product="mCG147186"
FT                   /note="gene_id=mCG147186.0 transcript_id=mCT187449.0
FT                   protein_id=mCP109247.0"
FT                   /protein_id="EDL06094.1"
FT                   /translation="MNKPLMKHLLARETGQMPCSKWCLLGFSWLWFCCCCCFVVFAFCP
FT                   LLCVYVYVVCVSIWVLFLRSHPAYLFETGSRPDVLYQMWCSWAGNLSGYMLAPDWA"
FT   assembly_gap    3425136..3425228
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    3428600..3428619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3449561..3450347
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   gene            complement(3451834..3452658)
FT                   /pseudo
FT                   /locus_tag="mCG_50388"
FT                   /note="gene_id=mCG50388.2"
FT   mRNA            complement(3451834..3452658)
FT                   /pseudo
FT                   /locus_tag="mCG_50388"
FT                   /note="gene_id=mCG50388.2 transcript_id=mCT50571.2 created
FT                   on 21-AUG-2002"
FT   assembly_gap    3466442..3466461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3473691..3550572
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /note="gene_id=mCG3684.2"
FT   mRNA            join(3473691..3474146,3503609..3503691,3539920..3540184,
FT                   3542329..3542401,3544491..3544657,3546201..3546314,
FT                   3546465..3546700,3548559..3548607,3549545..3550572)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT2871"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT2871.3 created on
FT                   18-JUN-2003"
FT   mRNA            join(<3473704..3473829,3503609..3503691,3539920..3540184,
FT                   3542329..3542401,3544491..3544657,3546201..3546314,
FT                   3546465..3546700,3548559..3548607,3549545..3550572)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT173581"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT173581.1 created
FT                   on 18-JUN-2003"
FT   mRNA            join(<3473947..3474146,3503609..3503691,3527031..3527083,
FT                   3529900..3531142)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172112"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172112.0 created
FT                   on 18-JUN-2003"
FT   mRNA            join(3473963..3474146,3503609..3503691,3539920..3540184,
FT                   3542329..3542401,3544491..3544655,3546201..3546314,
FT                   3546465..3546700,3548559..3548607,3549545..3550572)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT177788"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT177788.1 created
FT                   on 18-JUN-2003"
FT   mRNA            join(<3473967..3474146,3539920..3540184,3542329..3542401,
FT                   3544491..3544657,3546201..>3546314)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172116"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172116.1 created
FT                   on 18-JUN-2003"
FT   CDS             join(<3473967..3474146,3539920..3540184,3542329..3542401,
FT                   3544491..3544657,3546201..>3546314)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172116.1
FT                   protein_id=mCP95031.1 isoform=CRA_c"
FT                   /protein_id="EDL06097.1"
FT                   /translation="RERRGVRSRGKPRGRKRSRLSRVCSGSSRGGQGRLFPPALREQTR
FT                   RRPSVPRGFLQTSARVNTMSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETI
FT                   FSKYGRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKG
FT                   LKRAATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTT
FT                   GSAKIKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANP"
FT   mRNA            join(3473969..3474146,3503609..3503691,3539920..3540184,
FT                   3542329..3542401,3542562..3542609,3544491..3544657,
FT                   3546201..3546223,3546465..3546700,3548559..3548607,
FT                   3549545..3550572)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172113"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172113.1 created
FT                   on 18-JUN-2003"
FT   mRNA            join(3473969..3474146,3539920..3540059,3542329..3542401,
FT                   3544491..3544657,3546201..>3546281)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172114"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172114.0 created
FT                   on 18-JUN-2003"
FT   mRNA            join(<3474016..3474080,3542349..3542401,3544491..3544657,
FT                   3546201..3546314,3546465..>3546481)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172115"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172115.0 created
FT                   on 18-JUN-2003"
FT   CDS             join(<3474018..3474080,3542349..3542401,3544491..3544657,
FT                   3546201..3546314,3546465..>3546481)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_h"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172115.0
FT                   protein_id=mCP95035.0 isoform=CRA_h"
FT                   /protein_id="EDL06102.1"
FT                   /translation="SRLSRVCSGSSRGGQGRLFPPPKPNRPKGLKRAATAIYRLFDYRG
FT                   RLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAKIKLKSSELQTIK
FT                   TELTQIKSNIDALLGRLEQIAEEQKANPDGKKKG"
FT   CDS             join(<3503650..3503691,3539920..3540184,3542329..3542401,
FT                   3544491..3544657,3546201..3546314,3546465..3546700,
FT                   3548559..3548603)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT173581.1
FT                   protein_id=mCP96500.0 isoform=CRA_d"
FT                   /protein_id="EDL06098.1"
FT                   /translation="LKGQTSWLNSFLVLVNTMSLKIQTSNVTNKNDPKSINSRVFIGNL
FT                   NTAVVKKSDVETIFSKYGRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDI
FT                   NMAGEPKPNRPKGLKRAATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTI
FT                   PVKLFARSTAVTTGSAKIKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANPDG
FT                   KKKGDSSSGGGGGSSGGGGSSNVGGGSSGGSGSCSSSSRLPAPQEDTASEAGTPQGEVQ
FT                   TRDDGDEEGLLTHSEEELEHSQDTDAEDGALQ"
FT   assembly_gap    3528071..3528311
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   CDS             <3530754..3531092
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172112.0
FT                   protein_id=mCP95034.0 isoform=CRA_a"
FT                   /protein_id="EDL06095.1"
FT                   /translation="LLPSTCAHLSEHTSYTHTHTHTIYICTSIKKLGHGLSILSGFLIL
FT                   LVPREPSHKYHSSGICPLLRPLAPEQPFWSLLNLNCLPLYMAYTVDNQDILPLKEHILS
FT                   LPIFLTLR"
FT   CDS             join(3539929..3540184,3542329..3542401,3544491..3544657,
FT                   3546201..3546314,3546465..3546700,3548559..3548603)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT2871.3
FT                   protein_id=mCP11583.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q3U3F6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017347"
FT                   /db_xref="MGI:MGI:97850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3F6"
FT                   /protein_id="EDL06100.1"
FT                   /translation="MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKY
FT                   GRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRA
FT                   ATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAK
FT                   IKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANPDGKKKGDSSSGGGGGSSGG
FT                   GGSSNVGGGSSGGSGSCSSSSRLPAPQEDTASEAGTPQGEVQTRDDGDEEGLLTHSEEE
FT                   LEHSQDTDAEDGALQ"
FT   CDS             join(3539929..3540184,3542329..3542401,3542562..3542609,
FT                   3544491..3544657,3546201..3546223,3546465..3546680)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172113.1
FT                   protein_id=mCP95033.0 isoform=CRA_g"
FT                   /protein_id="EDL06101.1"
FT                   /translation="MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKY
FT                   GRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRA
FT                   ATAIYSGYSFDYDYYQDYFCARLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIP
FT                   VKLFARSTAVTTGSAKIKLKSSELQTMARRRVTAAVVEEEAAVVEAAVAMLVVAAAAAA
FT                   GAAAAAAGYQRPKKTRLLRQAHPKEKSKLEMMVMRRDC"
FT   CDS             join(3539929..3540184,3542329..3542401,3544491..3544655,
FT                   3546201..3546213)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT177788.1
FT                   protein_id=mCP100710.0 isoform=CRA_e"
FT                   /protein_id="EDL06099.1"
FT                   /translation="MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKY
FT                   GRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRA
FT                   ATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAK
FT                   INKEQ"
FT   CDS             join(3540038..3540059,3542329..3542401,3544491..3544657,
FT                   3546201..>3546281)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172114.0
FT                   protein_id=mCP95032.0 isoform=CRA_b"
FT                   /protein_id="EDL06096.1"
FT                   /translation="MWRPSFPNINMAGEPKPNRPKGLKRAATAIYRLFDYRGRLSPVPV
FT                   PRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAKIKLKSSELQTIKTELTQIK
FT                   SNIDALLGRL"
FT   gene            complement(3554778..3575548)
FT                   /gene="Eif2s2"
FT                   /locus_tag="mCG_3686"
FT                   /note="gene_id=mCG3686.4"
FT   mRNA            complement(join(3554778..3555543,3556192..3556277,
FT                   3559223..3559279,3560278..3560426,3561077..3561171,
FT                   3566918..3567053,3570311..3570414,3570790..3570967,
FT                   3575297..3575548))
FT                   /gene="Eif2s2"
FT                   /locus_tag="mCG_3686"
FT                   /product="eukaryotic translation initiation factor 2,
FT                   subunit 2 (beta)"
FT                   /note="gene_id=mCG3686.4 transcript_id=mCT2865.4 created on
FT                   18-JUN-2003"
FT   CDS             complement(join(3555368..3555543,3556192..3556277,
FT                   3559223..3559279,3560278..3560426,3561077..3561171,
FT                   3566918..3567053,3570311..3570414,3570790..3570967,
FT                   3575297..3575311))
FT                   /codon_start=1
FT                   /gene="Eif2s2"
FT                   /locus_tag="mCG_3686"
FT                   /product="eukaryotic translation initiation factor 2,
FT                   subunit 2 (beta)"
FT                   /note="gene_id=mCG3686.4 transcript_id=mCT2865.4
FT                   protein_id=mCP11582.1"
FT                   /db_xref="GOA:Q3ULL5"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="MGI:MGI:1914454"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ULL5"
FT                   /protein_id="EDL06103.1"
FT                   /translation="MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDAQTEETQPSETKEVE
FT                   PEPTEEKDVDADEEDSRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEAIKDVKIE
FT                   SDAQEPAEPEDDLDIMLGNKKKKKKNVKFPEEDEILEKDEALEDEDSKKDDGISFSSQT
FT                   AWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTD
FT                   ICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHT
FT                   CRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN"
FT   assembly_gap    3557720..3557739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3579902..3579921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3588328..3588375
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    3600421..3600440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3601581..3609620
FT                   /estimated_length=8040
FT                   /gap_type="unknown"
FT   assembly_gap    3611282..3611301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3611961..3611980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3613277..3615947
FT                   /estimated_length=2671
FT                   /gap_type="unknown"
FT   gene            <3631591..3732610
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /note="gene_id=mCG21069.2"
FT   mRNA            join(<3631591..3631705,3632947..3632985,3727204..3727373,
FT                   3729268..>3729319)
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, transcript variant mCT172101"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT172101.0 created
FT                   on 21-AUG-2002"
FT   CDS             join(<3631593..3631705,3632947..3632985,3727204..3727373,
FT                   3729268..>3729319)
FT                   /codon_start=1
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, isoform CRA_a"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT172101.0
FT                   protein_id=mCP95021.0 isoform=CRA_a"
FT                   /protein_id="EDL06104.1"
FT                   /translation="RNWHQSTISHQSESLSPCSLRRGSHQLKPPGTTGDPRRERFLMNP
FT                   GTCPVLLLRMDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSLDFSSV
FT                   SIVALNKKSKKISRKEAEKR"
FT   assembly_gap    3639444..3639809
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    3652174..3652353
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    3682150..3682169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(3695219..3695329,3727204..3727373,3729268..3729332,
FT                   3732220..3732610)
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, transcript variant mCT20233"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT20233.2 created
FT                   on 21-AUG-2002"
FT   mRNA            join(3695263..3695326,3727204..3727373,3729268..3729332,
FT                   3732220..3732580)
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, transcript variant mCT172102"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT172102.0 created
FT                   on 21-AUG-2002"
FT   CDS             join(3727214..3727373,3729268..3729332,3732220..3732390)
FT                   /codon_start=1
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, isoform CRA_b"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT172102.0
FT                   protein_id=mCP95020.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q03288"
FT                   /db_xref="InterPro:IPR007733"
FT                   /db_xref="InterPro:IPR027300"
FT                   /db_xref="MGI:MGI:87853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03288"
FT                   /protein_id="EDL06105.1"
FT                   /translation="MDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSL
FT                   DFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAP
FT                   ACCDPCASCQCRFFGSACTCRVLNPNC"
FT   CDS             join(3727214..3727373,3729268..3729332,3732220..3732390)
FT                   /codon_start=1
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, isoform CRA_b"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT20233.2
FT                   protein_id=mCP23001.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q03288"
FT                   /db_xref="InterPro:IPR007733"
FT                   /db_xref="InterPro:IPR027300"
FT                   /db_xref="MGI:MGI:87853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03288"
FT                   /protein_id="EDL06106.1"
FT                   /translation="MDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSL
FT                   DFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAP
FT                   ACCDPCASCQCRFFGSACTCRVLNPNC"
FT   gene            complement(3740900..3756049)
FT                   /locus_tag="mCG_21063"
FT                   /note="gene_id=mCG21063.2"
FT   mRNA            complement(join(3740900..3741902,3741955..3742172,
FT                   3743741..3743935,3745372..3745489,3745581..3745668,
FT                   3745746..3745953,3746406..3746518,3747129..3747278,
FT                   3748915..3748990,3750420..3750610,3755958..3755990))
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, transcript variant mCT20227"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT20227.2 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(3741316..3741482,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..3756049))
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, transcript variant mCT172095"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT172095.0 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(3741324..3742172,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..>3756020))
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, transcript variant mCT189893"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT189893.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3741435..3741482,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..3755985))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, isoform CRA_a"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT172095.0
FT                   protein_id=mCP95014.0 isoform=CRA_a"
FT                   /protein_id="EDL06107.1"
FT                   /translation="MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPL
FT                   KGARIAGCLHMTVETAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKG
FT                   ETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNLIHTKYPQLLSGIRGISEETTTGVHN
FT                   LYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYG
FT                   DVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCVDI
FT                   ILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYWLKNGRRIILLA
FT                   EGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKGLEKQRGKGL
FT                   SLLYS"
FT   CDS             complement(join(3742041..3742172,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..>3756018))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, isoform CRA_b"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT189893.0
FT                   protein_id=mCP110881.0 isoform=CRA_b"
FT                   /protein_id="EDL06108.1"
FT                   /translation="EFISPSGSAASMSDKLPYKVADIGLAAWGRKALDIAENEMPGLMR
FT                   MREMYSASKPLKGARIAGCLHMTVETAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIA
FT                   KAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNLIHTKYPQLLSGIRG
FT                   ISEETTTGVHNLYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMI
FT                   AGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKEGN
FT                   IFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYW
FT                   LKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPK
FT                   KLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY"
FT   CDS             complement(join(3742041..3742172,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..3755985))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, isoform CRA_c"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT20227.2
FT                   protein_id=mCP22986.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TF14"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="MGI:MGI:3643647"
FT                   /db_xref="MGI:MGI:87968"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TF14"
FT                   /protein_id="EDL06109.1"
FT                   /translation="MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPL
FT                   KGARIAGCLHMTVETAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKG
FT                   ETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNLIHTKYPQLLSGIRGISEETTTGVHN
FT                   LYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYG
FT                   DVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCVDI
FT                   ILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYWLKNGRRIILLA
FT                   EGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHL
FT                   GKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY"
FT   assembly_gap    3768272..3768291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3781868..>3784226)
FT                   /locus_tag="mCG_1027988"
FT                   /note="gene_id=mCG1027988.0"
FT   mRNA            complement(join(3781868..3783086,3783190..3783314,
FT                   3784107..>3784226))
FT                   /locus_tag="mCG_1027988"
FT                   /product="mCG1027988"
FT                   /note="gene_id=mCG1027988.0 transcript_id=mCT145692.0
FT                   created on 21-AUG-2002"
FT   CDS             complement(3782597..>3782878)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027988"
FT                   /product="mCG1027988"
FT                   /note="gene_id=mCG1027988.0 transcript_id=mCT145692.0
FT                   protein_id=mCP72956.0"
FT                   /protein_id="EDL06110.1"
FT                   /translation="CSLSRITQPVGVRVCGEKVKFLFWSLFQSLLQSNLLVPAHHTLCR
FT                   VWFVCIGATSACSLPTPSKEVMFCNSLFLLSPKLRIFTIWVLVDLMVD"
FT   assembly_gap    3788313..3788332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3798858..3799012
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    3801492..3801511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3806353..3808631
FT                   /estimated_length=2279
FT                   /gap_type="unknown"
FT   assembly_gap    3810190..3810209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3811338..3812486
FT                   /estimated_length=1149
FT                   /gap_type="unknown"
FT   gene            3813580..3913766
FT                   /locus_tag="mCG_119620"
FT                   /note="gene_id=mCG119620.1"
FT   mRNA            join(3813580..3813616,3821560..3821636,3846774..3846864,
FT                   3852065..3852206,3855838..3855962,3857315..3857452,
FT                   3864620..3864665,3866136..3866293,3867756..3867951,
FT                   3869333..3869428,3871028..3871202,3875941..3876010,
FT                   3878630..3878714,3885839..3885967,3888711..3888783,
FT                   3889785..3889856,3892797..3892885,3895563..3895722,
FT                   3896487..3896620,3896940..3897080,3898837..3898957,
FT                   3899498..3899602,3904793..3904889,3907007..3907079,
FT                   3911285..3913766)
FT                   /locus_tag="mCG_119620"
FT                   /product="mCG119620, transcript variant mCT120795"
FT                   /note="gene_id=mCG119620.1 transcript_id=mCT120795.1
FT                   created on 22-AUG-2002"
FT   mRNA            join(3816899..3816949,3821560..3821636,3846774..3846864,
FT                   3852065..3852206,3855838..3855962,3857315..3857452,
FT                   3864620..3864665,3866136..3866293,3867756..3867951,
FT                   3869333..3869428,3871028..3871202,3875941..3876010,
FT                   3878630..3878714,3885839..3885967,3888711..3888783,
FT                   3889785..3889856,3892797..3892885,3895563..3895722,
FT                   3896487..3896620,3896940..3897080,3898837..3898957,
FT                   3899498..3899602,3904793..3904889,3907007..3907079,
FT                   3911285..3913764)
FT                   /locus_tag="mCG_119620"
FT                   /product="mCG119620, transcript variant mCT172093"
FT                   /note="gene_id=mCG119620.1 transcript_id=mCT172093.0
FT                   created on 22-AUG-2002"
FT   assembly_gap    3825441..3825509
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3840857..3840883
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   CDS             join(3846795..3846864,3852065..3852206,3855838..3855962,
FT                   3857315..3857452,3864620..3864665,3866136..3866293,
FT                   3867756..3867951,3869333..3869428,3871028..3871202,
FT                   3875941..3876010,3878630..3878714,3885839..3885967,
FT                   3888711..3888783,3889785..3889856,3892797..3892885,
FT                   3895563..3895722,3896487..3896620,3896940..3897080,
FT                   3898837..3898957,3899498..3899602,3904793..3904889,
FT                   3907007..3907079,3911285..3911384)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119620"
FT                   /product="mCG119620, isoform CRA_b"
FT                   /note="gene_id=mCG119620.1 transcript_id=mCT172093.0
FT                   protein_id=mCP95012.0 isoform=CRA_b"
FT                   /protein_id="EDL06112.1"
FT                   /translation="MSDSGPQLDSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEV
FT                   TVDGQSKKTEKCNNTNSPKWKQPLTVIVTPTSKLCFRVWSHQTLKSDVLLGTAGLDIYE
FT                   TLKSNNMKLEEVVMTLQLVGDKEPTETMGDLSVCLDGLQVEAEVVTNGETSCSESTTQN
FT                   DDGCRTRDDTRVSTNGSEDPEVAASGENKRANGNNSPSLSNGGFKPSRPPRPSRPPPPT
FT                   PRRPASVNGSPSTNSDSDGSSTGSLPPTNTNVNTSTSEGATSGLIIPLTISGGSGPRPL
FT                   NTVSQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDH
FT                   FTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIYGNQDLFATSQNKEFDPLG
FT                   PLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFV
FT                   DHNRRATTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKT
FT                   LFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYA
FT                   GKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGL
FT                   KDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEEN
FT                   KEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLND
FT                   WQRHAIYRHYTRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGP
FT                   QKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE"
FT   CDS             join(3846825..3846864,3852065..3852206,3855838..3855962,
FT                   3857315..3857452,3864620..3864665,3866136..3866293,
FT                   3867756..3867951,3869333..3869428,3871028..3871202,
FT                   3875941..3876010,3878630..3878714,3885839..3885967,
FT                   3888711..3888783,3889785..3889856,3892797..3892885,
FT                   3895563..3895722,3896487..3896620,3896940..3897080,
FT                   3898837..3898957,3899498..3899602,3904793..3904889,
FT                   3907007..3907079,3911285..3911384)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119620"
FT                   /product="mCG119620, isoform CRA_a"
FT                   /note="gene_id=mCG119620.1 transcript_id=mCT120795.1
FT                   protein_id=mCP72787.1 isoform=CRA_a"
FT                   /protein_id="EDL06111.1"
FT                   /translation="MGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTE
FT                   KCNNTNSPKWKQPLTVIVTPTSKLCFRVWSHQTLKSDVLLGTAGLDIYETLKSNNMKLE
FT                   EVVMTLQLVGDKEPTETMGDLSVCLDGLQVEAEVVTNGETSCSESTTQNDDGCRTRDDT
FT                   RVSTNGSEDPEVAASGENKRANGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS
FT                   PSTNSDSDGSSTGSLPPTNTNVNTSTSEGATSGLIIPLTISGGSGPRPLNTVSQAPLPP
FT                   GWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRP
FT                   TLESVRNYEQWQLQRSQLQGAMQQFNQRFIYGNQDLFATSQNKEFDPLGPLPPGWEKRT
FT                   DSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRATTYI
FT                   DPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIM
FT                   SFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQIN
FT                   PASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEF
FT                   YNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAE
FT                   WRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHY
FT                   TRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGK
FT                   ENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE"
FT   assembly_gap    3861118..3861137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3863057..3863076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3871953..3872999
FT                   /estimated_length=1047
FT                   /gap_type="unknown"
FT   gene            complement(3885120..3885780)
FT                   /pseudo
FT                   /locus_tag="mCG_21071"
FT                   /note="gene_id=mCG21071.0"
FT   mRNA            complement(3885120..3885780)
FT                   /pseudo
FT                   /locus_tag="mCG_21071"
FT                   /note="gene_id=mCG21071.0 transcript_id=mCT20234.0 created
FT                   on 22-AUG-2002"
FT   assembly_gap    3907800..3908006
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   gene            <3923428..3937321
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /note="gene_id=mCG21072.1"
FT   mRNA            join(<3923428..3923532,3929798..3929873,3934815..3934982,
FT                   3936965..3937321)
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, transcript
FT                   variant mCT20235"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT20235.2 created
FT                   on 22-AUG-2002"
FT   CDS             join(<3923428..3923532,3929798..3929873,3934815..3934982,
FT                   3936965..3937008)
FT                   /codon_start=1
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT20235.2
FT                   protein_id=mCP23008.2 isoform=CRA_c"
FT                   /protein_id="EDL06115.1"
FT                   /translation="AARSVRLHKGLCAGSEGRGTRLSVGDSELQDPSEMAEVEETLKRL
FT                   QSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLR
FT                   IRSKKNEIMVAPDKDYFLIVIQNPTE"
FT   mRNA            join(<3923723..3923851,3929798..3929873,3934815..3934982,
FT                   3936965..3937276)
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, transcript
FT                   variant mCT172104"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT172104.0 created
FT                   on 22-AUG-2002"
FT   mRNA            join(<3923767..3923855,3929798..3929873,3934815..3934982,
FT                   3936965..3937124)
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, transcript
FT                   variant mCT172105"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT172105.0 created
FT                   on 22-AUG-2002"
FT   CDS             join(<3923813..3923851,3929798..3929873,3934815..3934982,
FT                   3936965..3937008)
FT                   /codon_start=1
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT172104.0
FT                   protein_id=mCP95024.0 isoform=CRA_a"
FT                   /protein_id="EDL06113.1"
FT                   /translation="ALTCMAFPPPLWEAEVEETLKRLQSQKGVQGIIVVNTEGIPIKST
FT                   MDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQ
FT                   NPTE"
FT   assembly_gap    3928951..3929254
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   CDS             join(<3929798..3929873,3934815..3934982,3936965..3937008)
FT                   /codon_start=1
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT172105.0
FT                   protein_id=mCP95023.0 isoform=CRA_b"
FT                   /protein_id="EDL06114.1"
FT                   /translation="AEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLM
FT                   HNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE"
FT   assembly_gap    3945128..3945346
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    3948214..3948445
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    3956374..3956639
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   gene            <3963571..3965297
FT                   /gene="Map1lc3a"
FT                   /locus_tag="mCG_21085"
FT                   /note="gene_id=mCG21085.2"
FT   mRNA            join(<3963571..3963872,3964184..3964239,3964324..3964430,
FT                   3964701..3965297)
FT                   /gene="Map1lc3a"
FT                   /locus_tag="mCG_21085"
FT                   /product="microtubule-associated protein 1 light chain 3
FT                   alpha"
FT                   /note="gene_id=mCG21085.2 transcript_id=mCT20249.2 created
FT                   on 22-AUG-2002"
FT   CDS             <3964812..3965276
FT                   /codon_start=1
FT                   /gene="Map1lc3a"
FT                   /locus_tag="mCG_21085"
FT                   /product="microtubule-associated protein 1 light chain 3
FT                   alpha"
FT                   /note="gene_id=mCG21085.2 transcript_id=mCT20249.2
FT                   protein_id=mCP22968.2"
FT                   /protein_id="EDL06116.1"
FT                   /translation="RRIPLHGLRLPRNLRLLSQEEGRGVAGSSGQVLPREVLAPKLSYF
FT                   SPQWIRQRCDTHSPPQVGATSQPTTSWVGPGPVMFGLLFWVLAGLGVGGEQHPCSVGFV
FT                   ILLGPCLSAHLAPHPPEALPPARTCPTPERLAPLVLTRCMDLWSFPLQKE"
FT   gene            complement(3965471..>4044620)
FT                   /gene="Cdc91l1"
FT                   /locus_tag="mCG_140914"
FT                   /note="gene_id=mCG140914.0"
FT   mRNA            complement(join(3965471..3965875,3979892..3980034,
FT                   3984285..3984409,3986248..3986391,3988403..3988557,
FT                   4001682..4001779,4015840..4015940,4018408..4018517,
FT                   4022606..4022668,4023927..4023986,4032850..4032914,
FT                   4044462..>4044620))
FT                   /gene="Cdc91l1"
FT                   /locus_tag="mCG_140914"
FT                   /product="CDC91 cell division cycle 91-like 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG140914.0 transcript_id=mCT172094.0
FT                   created on 22-AUG-2002"
FT   CDS             complement(join(3965762..3965875,3979892..3980034,
FT                   3984285..3984409,3986248..3986391,3988403..3988557,
FT                   4001682..4001779,4015840..4015940,4018408..4018517,
FT                   4022606..4022668,4023927..4023986,4032850..4032914,
FT                   4044462..>4044618))
FT                   /codon_start=1
FT                   /gene="Cdc91l1"
FT                   /locus_tag="mCG_140914"
FT                   /product="CDC91 cell division cycle 91-like 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG140914.0 transcript_id=mCT172094.0
FT                   protein_id=mCP95013.0"
FT                   /protein_id="EDL06117.1"
FT                   /translation="IACAPASVIMAAPLALVLVVAVTVRAALFRSSLAEFISERVEVVS
FT                   PLSSWKRVVEGLALLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIAL
FT                   YFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSC
FT                   VAKSTCAINNTLIAFFILTTIKGSVFLSAVFLALATYQSLYPVTLFAPGLLYLLQRQYI
FT                   PVKVKSKAFWIFSWEYAMMYTGSLVVIVCLSFFLLSSWDFIPAVYGFILSVPDLTPNIG
FT                   LFWYFFAEMFEHFSLFFVCVFQINVFFYTVPLAIKLKEHPIFFMFIQIAIISIFKSYPT
FT                   VGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAI
FT                   TLTFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK"
FT   gene            4004721..4005110
FT                   /pseudo
FT                   /locus_tag="mCG_140920"
FT                   /note="gene_id=mCG140920.0"
FT   mRNA            4004721..4005110
FT                   /pseudo
FT                   /locus_tag="mCG_140920"
FT                   /note="gene_id=mCG140920.0 transcript_id=mCT172111.0
FT                   created on 22-AUG-2002"
FT   assembly_gap    4012407..4012530
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    4038888..4038907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4048372..4049060
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    4058344..4058859
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    4068586..4068605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4069036..4077035
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /note="gene_id=mCG21070.1"
FT   mRNA            join(<4069036..4069213,4072484..4072658,4073075..4073363,
FT                   4073734..4077035)
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /product="tumor protein p53 inducible nuclear protein 2,
FT                   transcript variant mCT20236"
FT                   /note="gene_id=mCG21070.1 transcript_id=mCT20236.2 created
FT                   on 22-AUG-2002"
FT   mRNA            join(<4069039..4069213,4072484..4072658,4073195..>4073335)
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /product="tumor protein p53 inducible nuclear protein 2,
FT                   transcript variant mCT172103"
FT                   /note="gene_id=mCG21070.1 transcript_id=mCT172103.0 created
FT                   on 22-AUG-2002"
FT   CDS             join(<4072502..4072658,4073075..4073363,4073734..4073986)
FT                   /codon_start=1
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /product="tumor protein p53 inducible nuclear protein 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21070.1 transcript_id=mCT20236.2
FT                   protein_id=mCP22952.1 isoform=CRA_b"
FT                   /protein_id="EDL06119.1"
FT                   /translation="GAPLRLLHPLTMFQRFTSLFFNTPAPPEDSNCPGAFVSEEDEVDG
FT                   WLIIDLQDSYTAPPDPGASPAPAGRPPPAPSLMDESWFVTPPACFTAEGPGLGPARLQS
FT                   NPLEDLLIEHPSMSVYVTGSTIVLESGPPSPHPEAALPDQDLSDGELAPALREPRALHH
FT                   AAAPMPARAVLLEKAGQVRRLQRARQRAERHTLSAKVLQRQNRARESRSRRPKHQGSFI
FT                   YQPCQRQFNY"
FT   CDS             join(<4072502..4072658,4073195..>4073335)
FT                   /codon_start=1
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /product="tumor protein p53 inducible nuclear protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21070.1 transcript_id=mCT172103.0
FT                   protein_id=mCP95022.0 isoform=CRA_a"
FT                   /protein_id="EDL06118.1"
FT                   /translation="GAPLRLLHPLTMFQRFTSLFFNTPAPPEDSNCPGAFVSEEDEVDG
FT                   WLIIDLQEGPGLGPARLQSNPLEDLLIEHPSMSVYVTGSTIVLESGPPSPHPEA"
FT   gene            complement(4074858..>4077033)
FT                   /locus_tag="mCG_140918"
FT                   /note="gene_id=mCG140918.0"
FT   mRNA            complement(join(4074858..4075165,4076231..>4077033))
FT                   /locus_tag="mCG_140918"
FT                   /product="mCG140918"
FT                   /note="gene_id=mCG140918.0 transcript_id=mCT172108.0
FT                   created on 22-AUG-2002"
FT   CDS             complement(4076557..>4076784)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140918"
FT                   /product="mCG140918"
FT                   /note="gene_id=mCG140918.0 transcript_id=mCT172108.0
FT                   protein_id=mCP95027.0"
FT                   /protein_id="EDL06120.1"
FT                   /translation="GKKVLEAGCGLSAFSPLTQSHPGALVGSLLHLRRYRSQQVDQRVP
FT                   GWGAGTLQNSTKPHSHTRCPAGARLAKVRK"
FT   gene            complement(4077851..4136464)
FT                   /gene="Ncoa6"
FT                   /locus_tag="mCG_21081"
FT                   /note="gene_id=mCG21081.2"
FT   mRNA            complement(join(4077851..4078414,4082914..4083065,
FT                   4086712..4086748,4089797..4089865,4092600..4095575,
FT                   4098650..4098771,4101937..4103053,4106003..4106149,
FT                   4108092..4108994,4109936..4110064,4119925..4120047,
FT                   4121042..4121197,4124969..4125248,4127797..4127894,
FT                   4136392..4136464))
FT                   /gene="Ncoa6"
FT                   /locus_tag="mCG_21081"
FT                   /product="nuclear receptor coactivator 6"
FT                   /note="gene_id=mCG21081.2 transcript_id=mCT20241.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(4078371..4078414,4082914..4083065,
FT                   4086712..4086748,4089797..4089865,4092600..4095575,
FT                   4098650..4098771,4101937..4103053,4106003..4106149,
FT                   4108092..4108994,4109936..4110064,4119925..4120047,
FT                   4121042..4121197,4124969..4125203))
FT                   /codon_start=1
FT                   /gene="Ncoa6"
FT                   /locus_tag="mCG_21081"
FT                   /product="nuclear receptor coactivator 6"
FT                   /note="gene_id=mCG21081.2 transcript_id=mCT20241.2
FT                   protein_id=mCP23026.2"
FT                   /db_xref="GOA:Q5XJV5"
FT                   /db_xref="InterPro:IPR026638"
FT                   /db_xref="InterPro:IPR032715"
FT                   /db_xref="MGI:MGI:1929915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XJV5"
FT                   /protein_id="EDL06121.1"
FT                   /translation="MVLDDLPNFEDIYTSLCSSTMGDSEVEFDSGLEDDDTKSDSILED
FT                   STIFVAFKGNIDDKDFKWKLDAILKNVPNLLHMESSKLKVQKVEPWNSVRVTFNIPREA
FT                   AERLRILAQSNNQQLRDLGILSVQIEGEGAINLALGQNRSQDVRMNGPVASGNSVRMEA
FT                   GFPMASGPGLIRMTSPAAVMTPQGGNMSSSMMAPGPNPELQPRTPRPASQSDAMDPLLS
FT                   GLHIQQQSHPSGSLPPAHHSMQPVPVNRQMNPANFPQLQQQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQQQQQQLQTRPLQQHQQQPQGIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGS
FT                   LGTMTTNQGWKKAPLPSPMQAQLQARPSLATVQTPSHPPPPYPFGSQQASQAHTNFPQM
FT                   SNPGQFTAPQMKGLQGGPSRVPTPLQQPHLTNKSPASSPSSFQQGSPASSPTVNQTQQQ
FT                   MGPRPPQNNPLSQGFQQPVSSPGRNPMVQQGNVPPNFMVMQQQPPNQGPQSLHPGLGGM
FT                   PKRLPPGFSAGQANPNFMQGQVPSTTAATPGNSGALQLQANQNVQHAGGQGAGPPQNQM
FT                   QVSHGPPNMMQPSLMGIHGNINNQQAGSSGVPQVTLGNMQGQPQQGPPSQLMGMHQQIV
FT                   PSQGQMAQQQGTLNPQNPMILSRAQLMPQGQMMVNAQNQNLGPSPQRMTPPKQMLPQQG
FT                   PQMMAPHNQMMGPQGQVLLQQNPMIEQIMTNQMQGNKAQFNSQNQSNVMPGPAQIMRGP
FT                   TPNMQGNMVQFTGQMSGQMLPQQGPVNNSPSQVMGIQGQVLRPPGPSPHMAQQHNDPVT
FT                   TANNDVNLSQMMPDVSMQQASMVPPHVQSMQGNSASGSHFSGHGVSFNAPFGGAPNGSQ
FT                   MSCGQNPGFPVNKDVTLTSPLLVNLLQSDISAGHFGVNNKQNNTNANKPKKKKPPRKKK
FT                   NCHQDLNTPDNRPTGLEEVDQQSLPGEQGINLDTTGPKLPDFSNRPPGYPTQPVEQRPL
FT                   PQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQPQSQQQQQQQQMMMMLMMQQDP
FT                   KSIRLPVSQNVHPPRGPLNPDSQRMPVQQSGNVPVMVGLQGPASVPPSPDKQRMPMSVN
FT                   TPMGSNSRKMVYQENPQNSSSSPLGEMSSLPEASGSEVPSVAGGPNNMPSHLVVSQNQL
FT                   MMTGPKPGPSPLSATQGATPQQPPVNSLPSSHGHHFPNVAAPTQTSRPKTPNRASPRPY
FT                   YPQTPNNRPPSTEPSEISLSPERLNASIAGLFPPQINIPLPPRPNLNRGFDQQGLNPTT
FT                   LKAIGQAPSNLTITNPPNFAAPQAHKLDSVVVNSGKQSNPGTTKRASPSNSRRSSPGSS
FT                   RKTTPSPGRQNSKAPKLTLASQTSTTMLQNMELPRNVLVGPTPLANPPLPGSFPNNTGL
FT                   NPQNPTVPVPAMGTVLEDNKESVNIPQDSDCQNAQGRKEQVNTELKVVPTQEAKMAVPE
FT                   DQSKKDGQPLDPNKLPSVEENKNLMSPAMREAPTSLSQLLDNSGAPNVTIKPPGLTDLE
FT                   VTPPVVSGEDLRKASVIPTLQDPPSKEPSTSLSSPHSSEPCSTLARSELSEVSSNTAPS
FT                   IPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSSNTSAALPTHLQSALMSTVVTMPN
FT                   VGNKVMVSEGQSAAQSNARPQFITPVFINSSSIIQVMKGSQPSTIPATPLTTNSGLMPP
FT                   SVAVVGPLHIPQNIKFSSAPVTPNVPSSSPAPNIQTGRPLVLSSRATPVQLPSPPCTSS
FT                   PVVAPNPSVQQVKELNPDEASPQTNTSADQSTLPPSQPTTVVSPLLTNSPGSSANRRSP
FT                   VSSSKGKGKVDKIGQILLTKACKKVTGSLEKGEEQYGADGETEGPGLEITTPGLMGTEQ
FT                   CSTELDSKTPTPSAPTLLKMTSSPMGPSSTSTGPILPGGALPTSVRSIVTTLVPSELIS
FT                   TAPTTKGNHGGVTSEPLAGGLVEEKVGSHPELLPSIAPSQNLAPKETPATALQGSVARP
FT                   ELEANAAIASGQSCEPKEIVEKSKTLTSRRNSRTEEPTMASESVENGHRKRSSRPASAS
FT                   SSTKDITGAVQSKRRKSK"
FT   assembly_gap    4087656..4087841
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   gene            <4093213..>4095228
FT                   /locus_tag="mCG_140919"
FT                   /note="gene_id=mCG140919.0"
FT   mRNA            join(<4093213..4093535,4094829..>4095228)
FT                   /locus_tag="mCG_140919"
FT                   /product="mCG140919"
FT                   /note="gene_id=mCG140919.0 transcript_id=mCT172109.0
FT                   created on 22-AUG-2002"
FT   CDS             <4095023..>4095228
FT                   /codon_start=1
FT                   /locus_tag="mCG_140919"
FT                   /product="mCG140919"
FT                   /note="gene_id=mCG140919.0 transcript_id=mCT172109.0
FT                   protein_id=mCP95028.0"
FT                   /protein_id="EDL06122.1"
FT                   /translation="ETTKCEGMLFGPPATDGTSLPLASGSEDISPSGELEEFCGFSWYT
FT                   IFLELLPIGVFTDIGILCLSGDGG"
FT   assembly_gap    4113640..4113909
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   gene            complement(4114558..4115196)
FT                   /pseudo
FT                   /locus_tag="mCG_140917"
FT                   /note="gene_id=mCG140917.0"
FT   mRNA            complement(4114558..4115196)
FT                   /pseudo
FT                   /locus_tag="mCG_140917"
FT                   /note="gene_id=mCG140917.0 transcript_id=mCT172107.0
FT                   created on 22-AUG-2002"
FT   assembly_gap    4118477..4118508
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4142576..4142595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4145663..>4147965)
FT                   /locus_tag="mCG_49846"
FT                   /note="gene_id=mCG49846.2"
FT   mRNA            complement(join(4145663..4146716,4147426..>4147965))
FT                   /locus_tag="mCG_49846"
FT                   /product="mCG49846"
FT                   /note="gene_id=mCG49846.2 transcript_id=mCT50029.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(4147480..4147965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49846"
FT                   /product="mCG49846"
FT                   /note="gene_id=mCG49846.2 transcript_id=mCT50029.2
FT                   protein_id=mCP42747.2"
FT                   /protein_id="EDL06123.1"
FT                   /translation="MAEFEERSLDNFFAKRDKKKEQSSQAANKKRDSGSLGSGARLGDG
FT                   GSTGLASKTITKDENEWKEFQQKEFNFSGLRVQTMQISEKEDDDNEKREDPEDNWEEGR
FT                   GGSGAEKSPGPWNKTAPVQAPPAPVTVTETPEPAVPSDVYRPPGARLTTTRTTRNTQ"
FT   assembly_gap    4160482..4160900
FT                   /estimated_length=419
FT                   /gap_type="unknown"
FT   assembly_gap    4164685..4164995
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   gene            complement(4172884..>4173353)
FT                   /locus_tag="mCG_1027895"
FT                   /note="gene_id=mCG1027895.1"
FT   mRNA            complement(4172884..>4173353)
FT                   /locus_tag="mCG_1027895"
FT                   /product="mCG1027895"
FT                   /note="gene_id=mCG1027895.1 transcript_id=mCT145599.1
FT                   created on 22-AUG-2002"
FT   CDS             complement(4173049..>4173273)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027895"
FT                   /product="mCG1027895"
FT                   /note="gene_id=mCG1027895.1 transcript_id=mCT145599.1
FT                   protein_id=mCP73210.0"
FT                   /protein_id="EDL06124.1"
FT                   /translation="GEHKTGPNLHRLFGWNTGQPDRFSYTDANKNRGITSGEDTLMEYL
FT                   ENPKKYIPGTKMIFAGIKKGERADLIAYL"
FT   assembly_gap    4173799..4173898
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            complement(4177407..>4205125)
FT                   /gene="Ggtl3"
FT                   /locus_tag="mCG_21084"
FT                   /note="gene_id=mCG21084.1"
FT   mRNA            complement(join(4177407..4178139,4180632..4180731,
FT                   4181869..4182006,4182665..4182782,4182897..4183046,
FT                   4185786..4185874,4186037..4186164,4187726..4187813,
FT                   4189659..4189855,4190151..4190259,4191601..4191730,
FT                   4192864..4193015,4193235..4193470,4201530..4201727,
FT                   4204875..>4205125))
FT                   /gene="Ggtl3"
FT                   /locus_tag="mCG_21084"
FT                   /product="gamma-glutamyltransferase-like 3, transcript
FT                   variant mCT20248"
FT                   /note="gene_id=mCG21084.1 transcript_id=mCT20248.1 created
FT                   on 22-AUG-2002"
FT   mRNA            complement(join(4177411..4178139,4180632..4180744,
FT                   4201645..4201727,4204136..4204259,4204900..>4205098))
FT                   /gene="Ggtl3"
FT                   /locus_tag="mCG_21084"
FT                   /product="gamma-glutamyltransferase-like 3, transcript
FT                   variant mCT172110"
FT                   /note="gene_id=mCG21084.1 transcript_id=mCT172110.0 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(4177976..4178139,4180632..4180731,
FT                   4181869..4182006,4182665..4182782,4182897..4183046,
FT                   4185786..4185874,4186037..4186164,4187726..4187813,
FT                   4189659..4189855,4190151..4190259,4191601..4191730,
FT                   4192864..4193015,4193235..4193470,4201530..4201727,
FT                   4204875..>4205124))
FT                   /codon_start=1
FT                   /gene="Ggtl3"
FT                   /locus_tag="mCG_21084"
FT                   /product="gamma-glutamyltransferase-like 3, isoform CRA_a"
FT                   /note="gene_id=mCG21084.1 transcript_id=mCT20248.1
FT                   protein_id=mCP22958.1 isoform=CRA_a"
FT                   /protein_id="EDL06125.1"
FT                   /translation="TPVQLAVALQRGDVRRASDLRRRGPTPHPALGAGLLTSPASTAAL
FT                   APLLGKPHRIKFRTPCPPLRSLRVPGRGKQVDPRGGASGAALLGVRARMAAENEASQES
FT                   ALGAYSPVDYMSITSFPRLPEDEPAPAAPLRGRKDEDAFLGDPDTDPDSFLKSARLQRL
FT                   PSSSSEMGSQDGSPLRETRKDPFSAAAAECSCRQDGLTVIVTACLTFATGVTVALVMQI
FT                   YFGDPQIFQQGAVVTDASSCTALGMEVLSKQGSSVDAAVAAALCLGIVAPHSSGLGGGG
FT                   VMLVHDIRRNESHLIDFRESAPGALREEALQRSWDTKVGTLDLLHPLLSGPLRLPWSQV
FT                   LAFAAAVAQDGFNVTHDLAHALAEQLPPNASDRFLDTFLPLGHPPLPGSLLRRPDLAEV
FT                   LDILGTSGPAAFYNGGNLTLEMVAEAQHAGGVITEEDFSNYSALTEKPVCGVYRGHLVL
FT                   SPPPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALASRLGDPVYDSTI
FT                   TESMDDMLSKVEAANFRGHISDSQAAPAPLLPVYELDGAPTAAQVLVMGPDDFIVAMVS
FT                   SLNRPFGSGLLTPSGILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVR
FT                   PAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDLQSNLLQVD
FT                   SEFTEEEIEFLEARGHHVEKVDVLSWVHGSRRTNTFIIGVKDPRSPDAAGATIL"
FT   CDS             complement(join(4177976..4178139,4180632..4180744,
FT                   4201645..>4201658))
FT                   /codon_start=1
FT                   /gene="Ggtl3"
FT                   /locus_tag="mCG_21084"
FT                   /product="gamma-glutamyltransferase-like 3, isoform CRA_b"
FT                   /note="gene_id=mCG21084.1 transcript_id=mCT172110.0
FT                   protein_id=mCP95029.0 isoform=CRA_b"
FT                   /protein_id="EDL06126.1"
FT                   /translation="APTHHACPQVLLNVLTLNRNLSDSLARGRLHPDLQSNLLQVDSEF
FT                   TEEEIEFLEARGHHVEKVDVLSWVHGSRRTNTFIIGVKDPRSPDAAGATIL"
FT   assembly_gap    4190318..4190553
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    4193527..4194072
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    4202708..4202727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4204916..4249664
FT                   /gene="Acss2"
FT                   /locus_tag="mCG_21064"
FT                   /note="gene_id=mCG21064.2"
FT   mRNA            join(<4204916..4205143,4208842..4209037,4236110..4236201,
FT                   4236395..4236498,4236718..4236790,4237022..4237097,
FT                   4237274..4237388,4242773..4242910,4243252..4243422,
FT                   4243697..4243830,4244016..4244148,4244229..4244285,
FT                   4244468..4244548,4245510..4245618,4247541..4247609,
FT                   4247949..4248125,4248665..4248739,4248872..4249664)
FT                   /gene="Acss2"
FT                   /locus_tag="mCG_21064"
FT                   /product="acyl-CoA synthetase short-chain family member 2"
FT                   /note="gene_id=mCG21064.2 transcript_id=mCT20229.1 created
FT                   on 22-AUG-2002"
FT   CDS             join(<4204918..4205143,4208842..4209037,4236110..4236201,
FT                   4236395..4236498,4236718..4236790,4237022..4237097,
FT                   4237274..4237388,4242773..4242910,4243252..4243422,
FT                   4243697..4243830,4244016..4244148,4244229..4244285,
FT                   4244468..4244548,4245510..4245618,4247541..4247609,
FT                   4247949..4248125,4248665..4248739,4248872..4248999)
FT                   /codon_start=1
FT                   /gene="Acss2"
FT                   /locus_tag="mCG_21064"
FT                   /product="acyl-CoA synthetase short-chain family member 2"
FT                   /note="gene_id=mCG21064.2 transcript_id=mCT20229.1
FT                   protein_id=mCP22985.1"
FT                   /protein_id="EDL06127.1"
FT                   /translation="HPQRPQRRTRCSELDAMGLPEERRKSGSGSRAREETGAEGRVRGW
FT                   SPPPEVRRSAHVPSLQRYRELHRRSVEEPREFWGNIAKEFYWKTACPGPFLQYNFDVTK
FT                   GKIFTEWMKGATTNICYNVLDRNVHEKKLGDKVAFYWEGNEPGETTKITYRELLVQVCQ
FT                   FSNVLRKQGIQKGDRVAIYMPMILELVVAMLACARLGALHSIVFAGFSAESLCERILDS
FT                   SCCLLITTDAFYRGEKLVNLKELADESLEKCREKGFPVRCCIVVKHLGRAELGMNDSPS
FT                   QSPPVKRPCPDVQICWNEGVDLWWHELMQQAGDECEPEWCDAEDPLFILYTSGSTGKPK
FT                   GVVHTIGGYMLYVATTFKYVFDFHPEDVFWCTADIGWITGHSYVTYGPLANGATSVLFE
FT                   GIPTYPDEGRLWSIVDKYKVTKFYTAPTAIRMLMKFGDDPVTKHSRASLQVLGTVGEPI
FT                   NPEAWLWYHRVVGSQRCPIVDTFWQTETGGHMLTPLPGATPMKPGSASFPFFGVAPAIL
FT                   NESGEELEGEAEGYLVFKQPWPGIMRTVYGNHTRFETTYFKKFPGYYVTGDGCRRDQDG
FT                   YYWITGRIDDMLNVSGHLLSTAEVESALVEHEAVAEAAVVGHPHPVKGECLYCFVTLCD
FT                   GHTFSPTLTEELKKQIREKIGPIATPDYIQNAPGLPKTRSGKIMRRVLRKIAQNDHDLG
FT                   DTSTVADPSVINHLFSHRCLTTQ"
FT   assembly_gap    4217215..4218786
FT                   /estimated_length=1572
FT                   /gap_type="unknown"
FT   assembly_gap    4232860..4232879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4233968..>4243851)
FT                   /locus_tag="mCG_140915"
FT                   /note="gene_id=mCG140915.0"
FT   mRNA            complement(join(4233968..4234123,4238056..4238277,
FT                   4242422..4242539,4243718..>4243851))
FT                   /locus_tag="mCG_140915"
FT                   /product="mCG140915"
FT                   /note="gene_id=mCG140915.0 transcript_id=mCT172096.0
FT                   created on 22-AUG-2002"
FT   CDS             complement(join(4238102..4238277,4242422..>4242488))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140915"
FT                   /product="mCG140915"
FT                   /note="gene_id=mCG140915.0 transcript_id=mCT172096.0
FT                   protein_id=mCP95015.0"
FT                   /protein_id="EDL06128.1"
FT                   /translation="HPHPSCCYYSSHLVYSLQHIFSGTSRGPGTKEPGLALAVNSVEQT
FT                   DREQMSKHTEAVFKSSEEVDTWGRMHLDFSLSLPC"
FT   gene            complement(4250102..>4279651)
FT                   /gene="Gss"
FT                   /locus_tag="mCG_21066"
FT                   /note="gene_id=mCG21066.3"
FT   mRNA            complement(join(4250102..4250638,4251679..4251868,
FT                   4253746..4253827,4254636..4254830,4258451..4258517,
FT                   4259856..4259933,4260027..4260107,4264454..4264570,
FT                   4265221..4265360,4265644..4265719,4268820..4268965,
FT                   4274375..4274509,4278950..4279121))
FT                   /gene="Gss"
FT                   /locus_tag="mCG_21066"
FT                   /product="glutathione synthetase, transcript variant
FT                   mCT20228"
FT                   /note="gene_id=mCG21066.3 transcript_id=mCT20228.2 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(4250106..4250638,4251679..4251868,
FT                   4253746..4253827,4254636..4254830,4258451..4258517,
FT                   4259856..4259933,4260027..4260107,4264454..4264570,
FT                   4265221..4265360,4265644..4265719,4268820..4268965,
FT                   4279627..>4279651))
FT                   /gene="Gss"
FT                   /locus_tag="mCG_21066"
FT                   /product="glutathione synthetase, transcript variant
FT                   mCT173578"
FT                   /note="gene_id=mCG21066.3 transcript_id=mCT173578.0 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(4250122..4250638,4251679..4251868,
FT                   4253746..4253827,4254636..4254830,4258451..4258517,
FT                   4259856..4259933,4260027..4260107,4264454..4264570,
FT                   4265221..4265360,4265644..4265719,4268820..4268965,
FT                   4274375..4274509,4279627..4279649))
FT                   /gene="Gss"
FT                   /locus_tag="mCG_21066"
FT                   /product="glutathione synthetase, transcript variant
FT                   mCT172098"
FT                   /note="gene_id=mCG21066.3 transcript_id=mCT172098.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4250515..4250638,4251679..4251868,
FT                   4253746..4253827,4254636..4254830,4258451..4258517,
FT                   4259856..4259933,4260027..4260107,4264454..4264570,
FT                   4265221..4265360,4265644..4265719,4268820..4268965,
FT                   4279627..>4279650))
FT                   /codon_start=1
FT                   /gene="Gss"
FT                   /locus_tag="mCG_21066"
FT                   /product="glutathione synthetase, isoform CRA_b"
FT                   /note="gene_id=mCG21066.3 transcript_id=mCT173578.0
FT                   protein_id=mCP96497.0 isoform=CRA_b"
FT                   /protein_id="EDL06130.1"
FT                   /translation="GEQLDNERVVTYAPFTLFPSPVPSALLEQAYAVQMDFNILVDAVS
FT                   QNPAFLEQTLSSTIKKDDYTARLFDIYKQVLKEGIAQTVFLGLNRSDYMFQCGADGSKA
FT                   LKQIEINTISASFGGLASRTPAVHRHVLNVLNKTKEASKILSNNPSKGLALGIAKAWEL
FT                   YGSANAVVLLIAQEKERNIFDQRAVENELLDRKIHVIRGRFEDVSERGSLDQNRRLFMD
FT                   DQEVAVVYFRDGYMPSQYNSQNWEARLMLERSRAAKCPDIAIQLAGTKKVQQELSRVGL
FT                   LEALLPGQPEAVARLRATFAGLYSLDMGEEGDQAIAEALAAPSHFVLKPQREGGGNNLY
FT                   GEEMVQALEQLKDSEERASYILMEKIEPEPFRNCLLRPGSPAQVVQCISELGIFGVYVR
FT                   QGTTLVMNKHVGHLLRTKAVEHADGGVAAGVAVLDNPYPV"
FT   CDS             complement(join(4250515..4250638,4251679..4251868,
FT                   4253746..4253827,4254636..4254830,4258451..4258517,
FT                   4259856..4259933,4260027..4260107,4264454..4264570,
FT                   4265221..4265360,4265644..4265719,4268820..4268965,
FT                   4274375..4274503))
FT                   /codon_start=1
FT                   /gene="Gss"
FT                   /locus_tag="mCG_21066"
FT                   /product="glutathione synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG21066.3 transcript_id=mCT172098.0
FT                   protein_id=mCP95017.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q541E2"
FT                   /db_xref="InterPro:IPR004887"
FT                   /db_xref="InterPro:IPR005615"
FT                   /db_xref="InterPro:IPR014042"
FT                   /db_xref="InterPro:IPR014049"
FT                   /db_xref="InterPro:IPR014709"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="MGI:MGI:95852"
FT                   /db_xref="UniProtKB/TrEMBL:Q541E2"
FT                   /protein_id="EDL06129.1"
FT                   /translation="MATSWGSILQDEKQLEELAKQAIDRALAEGVLLRSAQHPSSSDVV
FT                   TYAPFTLFPSPVPSALLEQAYAVQMDFNILVDAVSQNPAFLEQTLSSTIKKDDYTARLF
FT                   DIYKQVLKEGIAQTVFLGLNRSDYMFQCGADGSKALKQIEINTISASFGGLASRTPAVH
FT                   RHVLNVLNKTKEASKILSNNPSKGLALGIAKAWELYGSANAVVLLIAQEKERNIFDQRA
FT                   VENELLDRKIHVIRGRFEDVSERGSLDQNRRLFMDDQEVAVVYFRDGYMPSQYNSQNWE
FT                   ARLMLERSRAAKCPDIAIQLAGTKKVQQELSRVGLLEALLPGQPEAVARLRATFAGLYS
FT                   LDMGEEGDQAIAEALAAPSHFVLKPQREGGGNNLYGEEMVQALEQLKDSEERASYILME
FT                   KIEPEPFRNCLLRPGSPAQVVQCISELGIFGVYVRQGTTLVMNKHVGHLLRTKAVEHAD
FT                   GGVAAGVAVLDNPYPV"
FT   CDS             complement(join(4250515..4250638,4251679..4251868,
FT                   4253746..4253827,4254636..4254830,4258451..4258517,
FT                   4259856..4259933,4260027..4260107,4264454..4264570,
FT                   4265221..4265360,4265644..4265719,4268820..4268965,
FT                   4274375..4274503))
FT                   /codon_start=1
FT                   /gene="Gss"
FT                   /locus_tag="mCG_21066"
FT                   /product="glutathione synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG21066.3 transcript_id=mCT20228.2
FT                   protein_id=mCP22993.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q541E2"
FT                   /db_xref="InterPro:IPR004887"
FT                   /db_xref="InterPro:IPR005615"
FT                   /db_xref="InterPro:IPR014042"
FT                   /db_xref="InterPro:IPR014049"
FT                   /db_xref="InterPro:IPR014709"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="MGI:MGI:95852"
FT                   /db_xref="UniProtKB/TrEMBL:Q541E2"
FT                   /protein_id="EDL06131.1"
FT                   /translation="MATSWGSILQDEKQLEELAKQAIDRALAEGVLLRSAQHPSSSDVV
FT                   TYAPFTLFPSPVPSALLEQAYAVQMDFNILVDAVSQNPAFLEQTLSSTIKKDDYTARLF
FT                   DIYKQVLKEGIAQTVFLGLNRSDYMFQCGADGSKALKQIEINTISASFGGLASRTPAVH
FT                   RHVLNVLNKTKEASKILSNNPSKGLALGIAKAWELYGSANAVVLLIAQEKERNIFDQRA
FT                   VENELLDRKIHVIRGRFEDVSERGSLDQNRRLFMDDQEVAVVYFRDGYMPSQYNSQNWE
FT                   ARLMLERSRAAKCPDIAIQLAGTKKVQQELSRVGLLEALLPGQPEAVARLRATFAGLYS
FT                   LDMGEEGDQAIAEALAAPSHFVLKPQREGGGNNLYGEEMVQALEQLKDSEERASYILME
FT                   KIEPEPFRNCLLRPGSPAQVVQCISELGIFGVYVRQGTTLVMNKHVGHLLRTKAVEHAD
FT                   GGVAAGVAVLDNPYPV"
FT   gene            <4255490..4272657
FT                   /locus_tag="mCG_140916"
FT                   /note="gene_id=mCG140916.0"
FT   mRNA            join(<4255490..4255551,4260088..4260177,4261532..4261621,
FT                   4271983..4272657)
FT                   /locus_tag="mCG_140916"
FT                   /product="mCG140916, transcript variant mCT172099"
FT                   /note="gene_id=mCG140916.0 transcript_id=mCT172099.0
FT                   created on 22-AUG-2002"
FT   mRNA            join(4259794..4260177,4261532..4261621,4263741..4263912)
FT                   /locus_tag="mCG_140916"
FT                   /product="mCG140916, transcript variant mCT172100"
FT                   /note="gene_id=mCG140916.0 transcript_id=mCT172100.0
FT                   created on 22-AUG-2002"
FT   CDS             join(4259980..4260177,4261532..4261591)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140916"
FT                   /product="mCG140916, isoform CRA_b"
FT                   /note="gene_id=mCG140916.0 transcript_id=mCT172100.0
FT                   protein_id=mCP95019.0 isoform=CRA_b"
FT                   /protein_id="EDL06133.1"
FT                   /translation="MGLSPGATPESPPSLTCLAARSLRHAGQICSFPSLEQSVAPPHCR
FT                   KSTSEPGSPQTSPFLLLLQRELPTWLNTLPACLRESRGQI"
FT   CDS             <4272246..4272467
FT                   /codon_start=1
FT                   /locus_tag="mCG_140916"
FT                   /product="mCG140916, isoform CRA_a"
FT                   /note="gene_id=mCG140916.0 transcript_id=mCT172099.0
FT                   protein_id=mCP95018.0 isoform=CRA_a"
FT                   /protein_id="EDL06132.1"
FT                   /translation="LHLSPPIDQPCLSAAFFEHFCPLRTLGVSPICLFSSVCLSFTILP
FT                   LIKMNRYFYRVSQERPAGWECAEPALRA"
FT   gene            <4279251..4281888
FT                   /locus_tag="mCG_140913"
FT                   /note="gene_id=mCG140913.0"
FT   mRNA            join(<4279251..4279699,4281621..4281888)
FT                   /locus_tag="mCG_140913"
FT                   /product="mCG140913"
FT                   /note="gene_id=mCG140913.0 transcript_id=mCT172092.0
FT                   created on 22-AUG-2002"
FT   CDS             join(<4279408..4279699,4281621..4281646)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140913"
FT                   /product="mCG140913"
FT                   /note="gene_id=mCG140913.0 transcript_id=mCT172092.0
FT                   protein_id=mCP95011.0"
FT                   /protein_id="EDL06134.1"
FT                   /translation="QCPSWEPAIWKSRFSTPSTSPSLDTSFPVLAAFPATASSARSPRS
FT                   NRSQTPPSPLSSQGNLTLASRRREAPTYSLVVQLLAKLKLRTPLPGLGGRGFDMAAEPE
FT                   R"
FT   gene            complement(4280498..>4281408)
FT                   /locus_tag="mCG_1027990"
FT                   /note="gene_id=mCG1027990.0"
FT   mRNA            complement(join(4280498..4281152,4281299..>4281408))
FT                   /locus_tag="mCG_1027990"
FT                   /product="mCG1027990"
FT                   /note="gene_id=mCG1027990.0 transcript_id=mCT145694.0
FT                   created on 22-AUG-2002"
FT   CDS             complement(join(4280997..4281152,4281299..>4281337))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027990"
FT                   /product="mCG1027990"
FT                   /note="gene_id=mCG1027990.0 transcript_id=mCT145694.0
FT                   protein_id=mCP72964.0"
FT                   /protein_id="EDL06135.1"
FT                   /translation="DPPASAFQRLELKVSDHKHYSGNSQITSLPTLSHSYETSGGLSFL
FT                   DWREAPALSKELEGFWSLG"
FT   gene            <4298565..4321988
FT                   /locus_tag="mCG_21082"
FT                   /note="gene_id=mCG21082.1"
FT   mRNA            join(<4298565..4298681,4300081..4300187,4300366..4300509,
FT                   4300972..4301128,4301401..4301428,4302334..4302430,
FT                   4304457..4304480,4304581..4304673,4304795..4304858,
FT                   4305669..4305767,4307025..4307128,4307322..4307460,
FT                   4307716..4307834,4307927..4308076,4308201..4308371,
FT                   4309103..4309282,4309369..4309501,4309580..4309656,
FT                   4310138..4310225,4310379..4310496,4312575..4312698,
FT                   4312786..4312922,4313272..4313527,4314507..4314749,
FT                   4315428..4315834,4316054..4316144,4316226..4316615,
FT                   4317193..4317319,4317410..4317528,4317616..4317812,
FT                   4317946..4318295,4318414..4318538,4318649..4318764,
FT                   4319083..4319479,4319562..4319687,4319783..4319953,
FT                   4320100..4320204,4320288..4320383,4320798..4320935,
FT                   4321015..4321988)
FT                   /locus_tag="mCG_21082"
FT                   /product="mCG21082"
FT                   /note="gene_id=mCG21082.1 transcript_id=mCT20242.2 created
FT                   on 22-AUG-2002"
FT   CDS             join(<4298567..4298681,4300081..4300187,4300366..4300509,
FT                   4300972..4301128,4301401..4301428,4302334..4302430,
FT                   4304457..4304480,4304581..4304673,4304795..4304858,
FT                   4305669..4305767,4307025..4307128,4307322..4307460,
FT                   4307716..4307834,4307927..4308076,4308201..4308371,
FT                   4309103..4309282,4309369..4309501,4309580..4309656,
FT                   4310138..4310225,4310379..4310496,4312575..4312698,
FT                   4312786..4312922,4313272..4313527,4314507..4314749,
FT                   4315428..4315834,4316054..4316144,4316226..4316615,
FT                   4317193..4317319,4317410..4317528,4317616..4317812,
FT                   4317946..4318295,4318414..4318538,4318649..4318764,
FT                   4319083..4319479,4319562..4319687,4319783..4319953,
FT                   4320100..4320204,4320288..4320383,4320798..4320935,
FT                   4321015..4321026)
FT                   /codon_start=1
FT                   /locus_tag="mCG_21082"
FT                   /product="mCG21082"
FT                   /note="gene_id=mCG21082.1 transcript_id=mCT20242.2
FT                   protein_id=mCP23007.2"
FT                   /protein_id="EDL06136.1"
FT                   /translation="PPFAPLATMMDMSELGESACYLRQGYQEMMKVHTVPWDGKKRVWV
FT                   PDEQDAYVEAEVKTEATGGKVTVETKDQKVLTVRETEMQPMNPPRFDLLEDMAMMTHLN
FT                   EAAVLHNLRQRYARWMIYTYSGLFCVTINPYKWLPVYTAAVVAAYKGKRRSEAPPHIYA
FT                   VADNAYNDMLRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGDGPGKKAQFLATK
FT                   TGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDSYLLEK
FT                   SRVIFQLPGERGYHVYYQILSGKKPELQDMLLLSMNPYDYHFCSQGVTTVDNMDDGEEL
FT                   IATDHAMDILGFSVDEKCACYKIVGALLHFGNMKFKQKQREEQAEADGTESADKAAYLM
FT                   GVSSGDLLKGLLHPRVRVGNEYVTKGQSVEQVVFAVGALAKATYDRLFRWLVSRINQTL
FT                   DTKLPRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNQHMFVLEQEEYKREGI
FT                   DWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDASFRAKLYDNHSGKSPNFQQ
FT                   PRPDKKRKYQAHFEVVHYAGVVPYSIVGWLEKNKDPLNETVVPIFQKSQNRLLATLYEN
FT                   YAGSCSTEPPKSGVKEKRKKAASFQTVSQLHKENLNKLMTNLRATQPHFVRCIVPNENK
FT                   TPGVMDSFLVLHQLRCNGVLEGIRICRQGFPNRLLYADFRQRYRILNPSAIPDDTFVDS
FT                   RKATEKLLGSLDIDHTQYQFGHTKVFFKAGLLGILEELRDQRLAKVLTLLQARSRGRLM
FT                   RLEYQRMLGGRDALFTIQWNIRAFNAVKNWSWMKLFFKMKPLLRSAQAEEELAALRAEL
FT                   RGLRGALATAEAKRQELEETQVSVTQEKNDLALQLQAEQDNLADAEERCHLLIKSKVQL
FT                   EAKVKELSERLEDEEEVNADLAARRRKLEDECTELKKDIDDLELTLAKAEKEKQATENK
FT                   VKNLTEEMAALDEAVVRLTKEKKALQEAHQQALGDLQAEEDRVSALAKAKIRLEQQVED
FT                   VSWSPLGDPQGGDSYTGLLEAEPYSTPQLECSLEQEKKLRMDTERAKRKLEGDLKLTQE
FT                   TVTDTTQDKQQLEEKLKKKDSELSQLNLRVEDEQLVGVQLQKKIKELQARAEELEEELE
FT                   AERAARARVEKQRAEAARELEELSERLEEAGGASAGQREGCRKREAELGRLRRELEEAV
FT                   LRHEATVAALRRKQADSAAELSEQVDSLQRIRQKLEKEKSELRMEVDDLGASVETLARG
FT                   KASAEKLCRTYEDQLSEAKIKVEELQRQLADASTQRGRLQTENGELGRLLEEKESMISQ
FT                   LSRGKTSAAQSLEELRRQLEEESKAKGALAHAVQALRHDCDLLREQHEEESEAQAELQR
FT                   LLSKANAEVAQWRSKYEADAIQRTEELEEAKKKLALRLQEAEEGVEAANAKCSSLEKAK
FT                   LRLQTESEDVTLELERATSAAAALDKKQRHLERALEERRRQEEEMQRELEAAQREARGL
FT                   GTELFRLRHSHEEALEALETLKRENKNLQEEISDLTDQVSLSGKSIQELEKAKKALEGE
FT                   KSELQAALEEAEGALELEETKTLRIQLELSQVKAEVDRKLAEKDEECTNLRRNHQRAVE
FT                   SLQASLDAETRARNEALRLKKKMEGDLNDLELQLGHATRQAMEAQAATRLLQAQLKEEQ
FT                   AGRDEEQRLAAELREQGQALERRAALLAAELEELRAALEQGERSRRLAEQELLEATERL
FT                   NLLHSQNTGLLNQKKKLEVDLAQLSGEVEEAAQERREAEEKAKKAITDAAMMAEELKKE
FT                   QDTSAHLERMKKTLEQTVRELQARLEEAEQAALRGGKKQVQKLEAKVRELEAELDAEQK
FT                   KHAEALKGVRKHERRVKELVYQTEEDRKNLARMQDLVDKLQSKVKSYKRQFEEAEQQAS
FT                   TNLAKYRKAQHELDDAEERADMAETQANKLRARSRDALGPKHKE"
FT   gene            complement(4321221..4379294)
FT                   /gene="Trpc4ap"
FT                   /locus_tag="mCG_21065"
FT                   /note="gene_id=mCG21065.3"
FT   mRNA            complement(join(4321221..4322075,4322171..4322377,
FT                   4323131..4323243,4324593..4324701,4324983..4325123,
FT                   4326408..4326498,4327410..4327493,4328525..4328626,
FT                   4330328..4330386,4331864..4331995,4337357..4337523,
FT                   4340403..4340588,4344676..4344883,4350580..4350708,
FT                   4353125..4353180,4355335..4355392,4357963..4358079,
FT                   4359913..4360041,4379088..>4379255))
FT                   /gene="Trpc4ap"
FT                   /locus_tag="mCG_21065"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 4 associated protein, transcript
FT                   variant mCT173577"
FT                   /note="gene_id=mCG21065.3 transcript_id=mCT173577.0 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(4321229..4322075,4322171..4322377,
FT                   4323131..4323243,4324593..4324701,4324983..4325123,
FT                   4326408..4326498,4327410..4327493,4328525..4328626,
FT                   4330328..4330386,4331864..4331995,4337357..4337499,
FT                   4340403..4340588,4344676..4344883,4350580..4350708,
FT                   4353125..4353180,4355335..4355392,4357963..4358079,
FT                   4359913..4360041,4379088..4379294))
FT                   /gene="Trpc4ap"
FT                   /locus_tag="mCG_21065"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 4 associated protein, transcript
FT                   variant mCT20230"
FT                   /note="gene_id=mCG21065.3 transcript_id=mCT20230.2 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(4321229..4322075,4322171..4322377,
FT                   4323131..4323243,4324593..4324701,4324983..4325123,
FT                   4326408..4326498,4327410..4327493,4328525..4328626,
FT                   4330328..4330386,4331864..4331995,4337357..4337523,
FT                   4340403..4340588,4344676..4344883,4350580..4350708,
FT                   4353125..4353169,4355335..4355392,4357963..4358030))
FT                   /gene="Trpc4ap"
FT                   /locus_tag="mCG_21065"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 4 associated protein, transcript
FT                   variant mCT172097"
FT                   /note="gene_id=mCG21065.3 transcript_id=mCT172097.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4321938..4322075,4322171..4322377,
FT                   4323131..4323243,4324593..4324701,4324983..4325123,
FT                   4326408..4326498,4327410..4327493,4328525..4328626,
FT                   4330328..4330386,4331864..4331995,4337357..4337499,
FT                   4340403..4340588,4344676..4344883,4350580..4350708,
FT                   4353125..4353180,4355335..4355392,4357963..4358079,
FT                   4359913..4360041,4379088..4379255))
FT                   /codon_start=1
FT                   /gene="Trpc4ap"
FT                   /locus_tag="mCG_21065"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 4 associated protein, isoform CRA_c"
FT                   /note="gene_id=mCG21065.3 transcript_id=mCT20230.2
FT                   protein_id=mCP22989.2 isoform=CRA_c"
FT                   /protein_id="EDL06139.1"
FT                   /translation="MAAAPAAAGAGASRGRRLAATAAAWGGWGGRPRPGNILLQLRQGQ
FT                   LTGRGLVRAVQFTETFLTERDKLSKWSGIPQLLLKLYATSHLHSDFVECQSILKEISPL
FT                   LSMEAMAFVTEDRKFTQEATYPNTYIFDLFGGVDLLVEILMRPTISIRGQKLKISDEMS
FT                   KDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATLIEDILGVKKEMI
FT                   RLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGNDDKHTLLAKNAQQKKSLSLGP
FT                   SAAEINQAALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMR
FT                   VANEESEHNQGTSEEGGLPHTSARAQLPQSMKIMHEIMYKLEVLYVLCVLLMGRQRNQV
FT                   HRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQFLRLLQSFS
FT                   DHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGKRGLLTRLLQVMKKE
FT                   PAESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFD
FT                   LLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRCVTLSLDRFENQVD
FT                   MKVAEVLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLVILMLARRK
FT                   ERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQHYLHKDKDSTCLENSSCISFSYW
FT                   KETVSILLNPDRQSPSALVSYIEEPYMDIDRDFTEE"
FT   CDS             complement(join(4321938..4322075,4322171..4322377,
FT                   4323131..4323243,4324593..4324701,4324983..4325123,
FT                   4326408..4326498,4327410..4327493,4328525..4328626,
FT                   4330328..4330386,4331864..4331995,4337357..4337523,
FT                   4340403..4340588,4344676..4344883,4350580..4350708,
FT                   4353125..4353180,4355335..4355392,4357963..4358079,
FT                   4359913..4360041,4379088..4379255))
FT                   /codon_start=1
FT                   /gene="Trpc4ap"
FT                   /locus_tag="mCG_21065"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 4 associated protein, isoform CRA_b"
FT                   /note="gene_id=mCG21065.3 transcript_id=mCT173577.0
FT                   protein_id=mCP96496.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TDP6"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022162"
FT                   /db_xref="MGI:MGI:1930751"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TDP6"
FT                   /protein_id="EDL06138.1"
FT                   /translation="MAAAPAAAGAGASRGRRLAATAAAWGGWGGRPRPGNILLQLRQGQ
FT                   LTGRGLVRAVQFTETFLTERDKLSKWSGIPQLLLKLYATSHLHSDFVECQSILKEISPL
FT                   LSMEAMAFVTEDRKFTQEATYPNTYIFDLFGGVDLLVEILMRPTISIRGQKLKISDEMS
FT                   KDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQTATLIEDILGVKKEMI
FT                   RLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGNDDKHTLLAKNAQQKKSLSLGP
FT                   SAAEINQAALLSIPGFVERLCKLATRKVSESTGTASFLQELEEWYTWLDNALVLDALMR
FT                   VANEESEHNQAPTVFPSLGTSEEGGLPHTSARAQLPQSMKIMHEIMYKLEVLYVLCVLL
FT                   MGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGHNQNCDCSPDITLKIQF
FT                   LRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLNTDRSLVCDGKRGLLTR
FT                   LLQVMKKEPAESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSR
FT                   DVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINSSLVDSNMLVRCVTLSL
FT                   DRFENQVDMKVAEVLSECRLLAYISQVPTQMSFLFRLINIIHVQTLTQENVSCLNTSLV
FT                   ILMLARRKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQQHYLHKDKDSTCLENS
FT                   SCISFSYWKETVSILLNPDRQSPSALVSYIEEPYMDIDRDFTEE"
FT   CDS             complement(join(4321938..4322075,4322171..4322377,
FT                   4323131..4323243,4324593..4324701,4324983..4325123,
FT                   4326408..4326498,4327410..4327493,4328525..4328626,
FT                   4330328..4330386,4331864..4331995,4337357..4337523,
FT                   4340403..4340588,4344676..4344883,4350580..4350708,
FT                   4353125..4353169))
FT                   /codon_start=1
FT                   /gene="Trpc4ap"
FT                   /locus_tag="mCG_21065"
FT                   /product="transient receptor potential cation channel,
FT                   subfamily C, member 4 associated protein, isoform CRA_a"
FT                   /note="gene_id=mCG21065.3 transcript_id=mCT172097.0
FT                   protein_id=mCP95016.0 isoform=CRA_a"
FT                   /protein_id="EDL06137.1"
FT                   /translation="MSKDCLSILYNTCVCTEGVTKRLAEKNDFVIFLFTLMTSKKTFLQ
FT                   TATLIEDILGVKKEMIRLDEVPNLSSLVSNFDQQQLANFCRILAVTISEMDTGNDDKHT
FT                   LLAKNAQQKKSLSLGPSAAEINQAALLSIPGFVERLCKLATRKVSESTGTASFLQELEE
FT                   WYTWLDNALVLDALMRVANEESEHNQAPTVFPSLGTSEEGGLPHTSARAQLPQSMKIMH
FT                   EIMYKLEVLYVLCVLLMGRQRNQVHRMIAEFKLIPGLNNLFDKLIWRKHSASALVLHGH
FT                   NQNCDCSPDITLKIQFLRLLQSFSDHHENKYLLLNNQELNELSAISLKANIPEVEAVLN
FT                   TDRSLVCDGKRGLLTRLLQVMKKEPAESSFRFWQARAVESFLRGTTSYADQMFLLKRGL
FT                   LEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINS
FT                   SLVDSNMLVRCVTLSLDRFENQVDMKVAEVLSECRLLAYISQVPTQMSFLFRLINIIHV
FT                   QTLTQENVSCLNTSLVILMLARRKERLPLYLRLLQRMEHSKKYPGFLLNNFHNLLRFWQ
FT                   QHYLHKDKDSTCLENSSCISFSYWKETVSILLNPDRQSPSALVSYIEEPYMDIDRDFTE
FT                   E"
FT   assembly_gap    4344451..4344521
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    4360488..4360507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4368750..4369285
FT                   /estimated_length=536
FT                   /gap_type="unknown"
FT   assembly_gap    4375095..4375356
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    4380562..4381010
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   gene            complement(4388690..4416484)
FT                   /gene="Edem2"
FT                   /locus_tag="mCG_21080"
FT                   /note="gene_id=mCG21080.1"
FT   mRNA            complement(join(4388690..4389606,4392669..4392790,
FT                   4395950..4396094,4397854..4397978,4400348..4400489,
FT                   4403020..4403231,4405275..4405400,4409443..4409548,
FT                   4413646..4413685,4415902..4416012,4416242..4416484))
FT                   /gene="Edem2"
FT                   /locus_tag="mCG_21080"
FT                   /product="ER degradation enhancer, mannosidase alpha-like
FT                   2"
FT                   /note="gene_id=mCG21080.1 transcript_id=mCT20246.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(4389109..4389606,4392669..4392790,
FT                   4395950..4396094,4397854..4397978,4400348..4400489,
FT                   4403020..4403231,4405275..4405400,4409443..4409548,
FT                   4413646..4413685,4415902..4416012,4416242..4416348))
FT                   /codon_start=1
FT                   /gene="Edem2"
FT                   /locus_tag="mCG_21080"
FT                   /product="ER degradation enhancer, mannosidase alpha-like
FT                   2"
FT                   /note="gene_id=mCG21080.1 transcript_id=mCT20246.2
FT                   protein_id=mCP22999.2"
FT                   /db_xref="GOA:Q8BJT9"
FT                   /db_xref="InterPro:IPR001382"
FT                   /db_xref="MGI:MGI:1915540"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BJT9"
FT                   /protein_id="EDL06140.1"
FT                   /translation="MPFRLLIPLGLVCVLLPLHHGAPGPDGTAPDPAHYRERVKAMFYH
FT                   AYDSYLENAFPYDELRPLTCDGHDTWGSFSLTLIDALDTLLILGNTSEFQRVVEVLQDN
FT                   VDFDIDVNASVFETNIRVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLP
FT                   AFQTPTGMPYGTVNLLHGVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVAL
FT                   MRLWESRSDIGLVGNHIDVLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFL
FT                   EYNKAIRNYTHFDDWYLWVQMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYY
FT                   TVWKQFGGLPEFYNIPQGYTVEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVES
FT                   IEKISKVECGFATIKDLRDHKLDNRMESFFLAETVKYLYLLFHPNNFIHNNGSTFDSVM
FT                   TPHGECILGAGGYIFNTEAHPIDPAALHCCRRLKEEQWEVEDLIKEFYSLKQSRPKRAQ
FT                   RKTVRSGPWEPQSGPATLSSPANQPREKQPAQQRTPLLSCPSQPFTSKLALLGQVFLDS
FT                   S"
FT   gene            4438134..4442454
FT                   /gene="Procr"
FT                   /locus_tag="mCG_21074"
FT                   /note="gene_id=mCG21074.3"
FT   mRNA            join(4438134..4438174,4438359..4438475,4440331..4440588,
FT                   4441226..>4441314)
FT                   /gene="Procr"
FT                   /locus_tag="mCG_21074"
FT                   /product="protein C receptor, endothelial, transcript
FT                   variant mCT172106"
FT                   /note="gene_id=mCG21074.3 transcript_id=mCT172106.1 created
FT                   on 15-NOV-2002"
FT   mRNA            join(4438277..4438475,4440331..4440588,4441226..4441513,
FT                   4441755..4442454)
FT                   /gene="Procr"
FT                   /locus_tag="mCG_21074"
FT                   /product="protein C receptor, endothelial, transcript
FT                   variant mCT20238"
FT                   /note="gene_id=mCG21074.3 transcript_id=mCT20238.1 created
FT                   on 15-NOV-2002"
FT   mRNA            join(4438313..4438475,4440331..4440588,4441226..4442444)
FT                   /gene="Procr"
FT                   /locus_tag="mCG_21074"
FT                   /product="protein C receptor, endothelial, transcript
FT                   variant mCT173579"
FT                   /note="gene_id=mCG21074.3 transcript_id=mCT173579.0 created
FT                   on 15-NOV-2002"
FT   CDS             join(4438409..4438475,4440331..4440588,4441226..4441513,
FT                   4441755..4441870)
FT                   /codon_start=1
FT                   /gene="Procr"
FT                   /locus_tag="mCG_21074"
FT                   /product="protein C receptor, endothelial, isoform CRA_c"
FT                   /note="gene_id=mCG21074.3 transcript_id=mCT20238.1
FT                   protein_id=mCP23012.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q64695"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR015669"
FT                   /db_xref="MGI:MGI:104596"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q64695"
FT                   /protein_id="EDL06143.1"
FT                   /translation="MLTKFLPLLLLLLPGCALCNSDGSQSLHMLQISYFQDNHHVRHQG
FT                   NASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERK
FT                   ENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSK
FT                   AANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTSLVLGILMG
FT                   CFIIAGVAVGIFMCTSGRRC"
FT   CDS             join(4438409..4438475,4440331..4440588,4441226..4441671)
FT                   /codon_start=1
FT                   /gene="Procr"
FT                   /locus_tag="mCG_21074"
FT                   /product="protein C receptor, endothelial, isoform CRA_b"
FT                   /note="gene_id=mCG21074.3 transcript_id=mCT173579.0
FT                   protein_id=mCP96498.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8K357"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR015669"
FT                   /db_xref="MGI:MGI:104596"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K357"
FT                   /protein_id="EDL06142.1"
FT                   /translation="MLTKFLPLLLLLLPGCALCNSDGSQSLHMLQISYFQDNHHVRHQG
FT                   NASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERK
FT                   ENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSK
FT                   AANFTLKQLNAYNRTRYELQEFLQDTCVEFLENHITTQNMKGLRGFWPCLCVGEGMTAR
FT                   QMKGHEGSLEQQNEEAGDSGEGTSTKPKSLGDVL"
FT   CDS             join(4438409..4438475,4440331..4440588,4441226..>4441314)
FT                   /codon_start=1
FT                   /gene="Procr"
FT                   /locus_tag="mCG_21074"
FT                   /product="protein C receptor, endothelial, isoform CRA_a"
FT                   /note="gene_id=mCG21074.3 transcript_id=mCT172106.1
FT                   protein_id=mCP95025.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2AUV5"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR015669"
FT                   /db_xref="MGI:MGI:104596"
FT                   /db_xref="UniProtKB/TrEMBL:A2AUV5"
FT                   /protein_id="EDL06141.1"
FT                   /translation="MLTKFLPLLLLLLPGCALCNSDGSQSLHMLQISYFQDNHHVRHQG
FT                   NASLGKLLTHTLEGPSQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERK
FT                   ENVFFPLTVSCSLGCELPEEEEEGSEPHVFFDVA"
FT   assembly_gap    4454029..4454265
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    4462039..4462663
FT                   /estimated_length=625
FT                   /gap_type="unknown"
FT   gene            <4462664..4505871
FT                   /gene="Mmp24"
FT                   /locus_tag="mCG_21078"
FT                   /note="gene_id=mCG21078.2"
FT   mRNA            join(<4462664..4462686,4479613..4479761,4485198..4485314,
FT                   4486817..4487121,4494533..4494694,4497469..4497683,
FT                   4499414..4499552,4501093..4501359,4502908..4505871)
FT                   /gene="Mmp24"
FT                   /locus_tag="mCG_21078"
FT                   /product="matrix metallopeptidase 24"
FT                   /note="gene_id=mCG21078.2 transcript_id=mCT20244.1 created
FT                   on 23-AUG-2002"
FT   CDS             join(<4462666..4462686,4479613..4479761,4485198..4485314,
FT                   4486817..4487121,4494533..4494694,4497469..4497683,
FT                   4499414..4499552,4501093..4501359,4502908..4503245)
FT                   /codon_start=1
FT                   /gene="Mmp24"
FT                   /locus_tag="mCG_21078"
FT                   /product="matrix metallopeptidase 24"
FT                   /note="gene_id=mCG21078.2 transcript_id=mCT20244.1
FT                   protein_id=mCP23018.1"
FT                   /protein_id="EDL06144.1"
FT                   /translation="DAPFAGQNWLKSYGYLLPYESRASALHSGKALQSAVSTMQQFYGI
FT                   PVTGVLDQTTIEWMKKPRCGVPDHPHLSRRRRNKRYALTGQKWRQKHITYSIHNYTPKV
FT                   GELDTRKAIRQAFDVWQKVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGE
FT                   GGFLAHAYFPGPGIGGDTHFDSDEPWTLGNANHDGNDLFLVAVHELGHALGLEHSNDPS
FT                   AIMAPFYQYMETHNFKLPQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSPSERKHE
FT                   RHPRPPRPPLGDRPSTPGAKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYP
FT                   MQIEQFWKGLPARIDAAYERADGRFVFFKGDKYWVFKEVTVEPGYPHSLGELGSCLPRE
FT                   GIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVWKGIPQAPQGAFISKEG
FT                   YYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWMGCKQKEVERRKERRLPQDDVDIMVT
FT                   IDDVPGSVNAVAVVVPCTLSLCLLVLLYTIFQFKNKAGPQPVTYYKRPVQEWV"
FT   assembly_gap    4472231..4472250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4480463..4480557
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   gene            complement(4504931..>4506423)
FT                   /locus_tag="mCG_140975"
FT                   /note="gene_id=mCG140975.0"
FT   mRNA            complement(join(4504931..4506280,4506363..>4506423))
FT                   /locus_tag="mCG_140975"
FT                   /product="mCG140975"
FT                   /note="gene_id=mCG140975.0 transcript_id=mCT172500.0
FT                   created on 27-AUG-2002"
FT   CDS             complement(4505138..>4505428)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140975"
FT                   /product="mCG140975"
FT                   /note="gene_id=mCG140975.0 transcript_id=mCT172500.0
FT                   protein_id=mCP95419.0"
FT                   /protein_id="EDL06145.1"
FT                   /translation="YFAPLTALTWADGQTDDRRQKNPRLEASRLSPLWARPCVPHICSL
FT                   GCLPPSPALSQLALECQEPTGSLRGLELSRSEHQPEERDQGTGGGRPRGED"
FT   gene            complement(4507033..4514005)
FT                   /locus_tag="mCG_21067"
FT                   /note="gene_id=mCG21067.1"
FT   mRNA            complement(join(4507033..4507308,4510022..4510203,
FT                   4510377..4510553,4511050..4511225,4513206..4513291,
FT                   4513408..4514005))
FT                   /locus_tag="mCG_21067"
FT                   /product="mCG21067, transcript variant mCT20231"
FT                   /note="gene_id=mCG21067.1 transcript_id=mCT20231.0 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(4507299..4507308,4510022..4510203,
FT                   4510377..4510553,4511050..4511225,4513206..4513291,
FT                   4513408..4513514))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21067"
FT                   /product="mCG21067, isoform CRA_a"
FT                   /note="gene_id=mCG21067.1 transcript_id=mCT20231.0
FT                   protein_id=mCP22947.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q545K4"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="MGI:MGI:1196288"
FT                   /db_xref="UniProtKB/TrEMBL:Q545K4"
FT                   /protein_id="EDL06146.1"
FT                   /translation="MAVRASFENNCEVGCFAKLTNAYCLVAIGGSENFYSVFEGELSDA
FT                   IPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDSVQIRRVEERLSAL
FT                   GNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHP
FT                   KTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVF
FT                   KLNEAKPSTIATSMRDSLIDSLT"
FT   assembly_gap    4511857..4511876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4512247..4513291,4513408..>4513771))
FT                   /locus_tag="mCG_21067"
FT                   /product="mCG21067, transcript variant mCT172499"
FT                   /note="gene_id=mCG21067.1 transcript_id=mCT172499.0 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(4513161..4513291,4513408..>4513771))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21067"
FT                   /product="mCG21067, isoform CRA_b"
FT                   /note="gene_id=mCG21067.1 transcript_id=mCT172499.0
FT                   protein_id=mCP95418.0 isoform=CRA_b"
FT                   /protein_id="EDL06147.1"
FT                   /translation="VTGEVVAACRHWSRLVSCWDSGRQKSVPGRRARGLGAGEPGGIRP
FT                   HARASEGPERAGFEEARLVDPAPEWICRPRTRSRAAPQPLSWRSERRSRTTVRSVVLPN
FT                   SQTPTAWWPSEAQRTSIVCSRVSSPMPFPWCTHPSPAAESSGACVWVRRVEDAEGHSEA
FT                   L"
FT   gene            <4513869..>4515032
FT                   /locus_tag="mCG_140976"
FT                   /note="gene_id=mCG140976.0"
FT   mRNA            join(<4513869..4514305,4514676..>4515032)
FT                   /locus_tag="mCG_140976"
FT                   /product="mCG140976"
FT                   /note="gene_id=mCG140976.0 transcript_id=mCT172501.0
FT                   created on 27-AUG-2002"
FT   CDS             join(<4514246..4514305,4514676..>4515032)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140976"
FT                   /product="mCG140976"
FT                   /note="gene_id=mCG140976.0 transcript_id=mCT172501.0
FT                   protein_id=mCP95420.0"
FT                   /protein_id="EDL06148.1"
FT                   /translation="RRQWRRGNVLRRDWRRKGSRSPAGAKFRRKTHDQLQPELPETFSK
FT                   VVCVFVSKCSTTCSAYLPQLTPDPLIEPHTTLWLTLPRTLNSPPPGSPPVLQDQPPSQP
FT                   LSDKLCRSLYYLHDPLSLIQFSSNTSVLFSEVCAF"
FT   gene            complement(4515929..>4521915)
FT                   /locus_tag="mCG_21075"
FT                   /note="gene_id=mCG21075.1"
FT   mRNA            complement(join(4515929..4517693,4518016..4518140,
FT                   4518572..4518739,4521305..>4521915))
FT                   /locus_tag="mCG_21075"
FT                   /product="mCG21075"
FT                   /note="gene_id=mCG21075.1 transcript_id=mCT20243.1 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(4516262..4517693,4518016..4518140,
FT                   4518572..4518739,4521305..>4521913))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21075"
FT                   /product="mCG21075"
FT                   /note="gene_id=mCG21075.1 transcript_id=mCT20243.1
FT                   protein_id=mCP23025.0"
FT                   /protein_id="EDL06149.1"
FT                   /translation="HMQGCQAGASIFFLIAANPDANHGASGGLGSRWIRTFSRIAPAGT
FT                   QGMAGPLRSRVEELKRPWWRESSPLVLQHSEAARLAADALLERGEAAYLQVISEERELP
FT                   FLSALDVDYMISHVRGVPELSEAQGSETLGQDLSMLSEVTSGTYFPMASDLDPPDLDLG
FT                   WPEVPQATGFSPTQAVVHFQRDKGKSIKDLLRFLFSQAQTVVAVVMDVFTDMELLCDLM
FT                   EASSRRGVPVYLLLAQEHLKYFLEMCYKMDLNGGHLVNMRVRSTCGDTYCSKAGRRFTG
FT                   QALEKFVIIDCEQVVAGSYSFTWLCSQAHTSMVLQLRGHIVEDFDREFRCLYAESQPVE
FT                   GFCSNEDPLMPQVPRPPPVTLAFGPAVPSATGSSPSSNSLSSIKHSPLLARSSYLALPG
FT                   GGGRNDMGMGSSSPGPAYHEAGGQPSLYRQLSDPNHISPPGPYRANLSKLGASPWSQSS
FT                   PALNHSSTSPLTLAVGSPLLPSSRPLLHFTRGVPALSRLPENGLPASQDPSLPRGRWVP
FT                   GTALETVEEKKVSLSQSHDHLDRLSPFSKAGEAGGPNSRVTPDSSSLQHRELALDDRRL
FT                   SLSHSHSQLDLLSQGQGVLESGSLRPGELSLENRKLSLNHNHGQLDLLPQNPKPQAPKI
FT                   PSDAYSSAGPSKPSLDDRRQTLGHSQLDLITKFGPFRSEGPGPSCPPEPSPVRMAGVGS
FT                   ADEKRLTLGHSKLDLITKYHQLQGARQKPEPGIPGAPVSGHQNGSSNDLFAPEKRLTLG
FT                   HSKLDLITKYNKSKFKQLRSRFES"
FT   assembly_gap    4527000..4527343
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   gene            <4529758..4550457
FT                   /locus_tag="mCG_145064"
FT                   /note="gene_id=mCG145064.0"
FT   mRNA            join(<4529758..4531001,4531230..4533001,4549594..4550457)
FT                   /locus_tag="mCG_145064"
FT                   /product="mCG145064"
FT                   /note="gene_id=mCG145064.0 transcript_id=mCT184488.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    4531190..4531209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <4532576..4532887
FT                   /codon_start=1
FT                   /locus_tag="mCG_145064"
FT                   /product="mCG145064"
FT                   /note="gene_id=mCG145064.0 transcript_id=mCT184488.0
FT                   protein_id=mCP105615.0"
FT                   /protein_id="EDL06150.1"
FT                   /translation="VFRGQLDTMSIYQNNVRLCPKARDLSHGVLTRFTEPGMDLLLWVS
FT                   NPTRKQLHKWGHLARHCSLQGSQLGRNVDFSPDPTSLHSTSTRWELACRKDAASSALT"
FT   gene            complement(4534320..>4617994)
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /note="gene_id=mCG125372.1"
FT   mRNA            complement(join(4534320..4535949,4538826..4538939,
FT                   4545534..4545611,4574535..4574643,4588724..4588781,
FT                   4596779..4596851,4597783..4597890,4599167..4599262,
FT                   4609568..4609660,4617946..>4617984))
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, transcript variant
FT                   mCT172496"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT172496.0
FT                   created on 27-AUG-2002"
FT   mRNA            complement(join(4534326..4535949,4538826..4538939,
FT                   4545534..4545611,4574535..4574643,4588724..4588781,
FT                   4596779..4596851,4597783..4597890,4599167..4599262,
FT                   4608079..4608171,4617946..4617982))
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, transcript variant
FT                   mCT126632"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT126632.0
FT                   created on 27-AUG-2002"
FT   mRNA            complement(join(4535378..4535949,4538826..4538939,
FT                   4545534..4545611,4574535..4574643,4588724..4588781,
FT                   4596779..4596851,4597783..4597893,4599167..4599262,
FT                   4609568..4609660,4617946..4617994))
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, transcript variant
FT                   mCT172495"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT172495.0
FT                   created on 27-AUG-2002"
FT   mRNA            complement(join(4535382..4535949,4538826..4538939,
FT                   4545534..4545553,4599172..4599262,4609568..4609658,
FT                   4617946..>4617994))
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, transcript variant
FT                   mCT172497"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT172497.0
FT                   created on 27-AUG-2002"
FT   CDS             complement(join(4535815..4535949,4538826..4538939,
FT                   4545534..4545553,4599172..4599262,4609568..4609658,
FT                   4617946..>4617992))
FT                   /codon_start=1
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, isoform CRA_b"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT172497.0
FT                   protein_id=mCP95415.0 isoform=CRA_b"
FT                   /protein_id="EDL06152.1"
FT                   /translation="PGNDCGGTWRCWCESLNQTSISQWVPVCSQLVSVSPTQRQWSSTS
FT                   QWLQKNQSRVCLGSEQTVGADTAQNRKYHNTTILGYDEGILSDDHGLAAALWRTFFNQK
FT                   CEDPRQLELLVEYVRKQMQYLDSMNGEDLLLTGEVRWRPLVEKNPQSILKPHAPTYNDE
FT                   GL"
FT   CDS             complement(join(4535815..4535949,4538826..4538939,
FT                   4545534..4545611,4574535..4574643,4588724..4588781,
FT                   4596779..4596851,4597783..4597890,4599167..4599262,
FT                   4609568..4609660,4617946..>4617981))
FT                   /codon_start=1
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, isoform CRA_d"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT172496.0
FT                   protein_id=mCP95414.0 isoform=CRA_d"
FT                   /protein_id="EDL06155.1"
FT                   /translation="LWRNMALLVRVLRNQTSISQWVPVCSQLVSVSPTQRQWSSTSQWL
FT                   QKNQSRVCLGSEQTVGADTAQNRKYHNTSKLLTTQDFPQPVEEKVGPFTKIIEAMGFTG
FT                   PLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMPDTFNSWFLITLLHVWMCLVRMKQ
FT                   EGRTGKYMCRIIVHFMWEDVEQRGRVMGVNSYILKKNMALMTNNFYAAILGYDEGILSD
FT                   DHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQMQYLDSMNGEDLLLTGEVRWRPLVEK
FT                   NPQSILKPHAPTYNDEGL"
FT   CDS             complement(join(4535815..4535949,4538826..4538939,
FT                   4545534..4545611,4574535..4574643,4588724..4588781,
FT                   4596779..4596851,4597783..4597818))
FT                   /codon_start=1
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, isoform CRA_a"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT172495.0
FT                   protein_id=mCP95416.0 isoform=CRA_a"
FT                   /protein_id="EDL06151.1"
FT                   /translation="MGFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMPDTFN
FT                   SWFLITLLHVWMCLVRMKQEGRTGKYMCRIIVHFMWEDVEQRGRVMGVNSYILKKNMAL
FT                   MTNNFYAAILGYDEGILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQMQYLDSM
FT                   NGEDLLLTGEVRWRPLVEKNPQSILKPHAPTYNDEGL"
FT   CDS             complement(join(4535815..4535949,4538826..4538939,
FT                   4545534..4545611,4574535..4574643,4588724..4588781,
FT                   4596779..4596851,4597783..4597818))
FT                   /codon_start=1
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, isoform CRA_a"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT126632.0
FT                   protein_id=mCP72751.1 isoform=CRA_a"
FT                   /protein_id="EDL06154.1"
FT                   /translation="MGFTGPLKYSKWKIKIAALRMYTSCVEKTDFEEFFLRCQMPDTFN
FT                   SWFLITLLHVWMCLVRMKQEGRTGKYMCRIIVHFMWEDVEQRGRVMGVNSYILKKNMAL
FT                   MTNNFYAAILGYDEGILSDDHGLAAALWRTFFNQKCEDPRQLELLVEYVRKQMQYLDSM
FT                   NGEDLLLTGEVRWRPLVEKNPQSILKPHAPTYNDEGL"
FT   assembly_gap    4536151..4536170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(<4538856..4538939,4545534..4545611,
FT                   4574535..4574643,4588724..4588781,4596779..4596851,
FT                   4597783..4597893,4599167..4599262,4608079..>4608171))
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, transcript variant
FT                   mCT189884"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT189884.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<4538856..4538939,4545534..4545611,
FT                   4574535..4574643,4588724..4588781,4596779..4596851,
FT                   4597783..>4597890))
FT                   /codon_start=1
FT                   /gene="2410003P15Rik"
FT                   /locus_tag="mCG_125372"
FT                   /product="RIKEN cDNA 2410003P15, isoform CRA_c"
FT                   /note="gene_id=mCG125372.1 transcript_id=mCT189884.0
FT                   protein_id=mCP110853.0 isoform=CRA_c"
FT                   /protein_id="EDL06153.1"
FT                   /translation="LLTTQDFPQPVEEKVGPFTKIIEAMGFTGPLKYSKWKIKIAALRM
FT                   YTSCVEKTDFEEFFLRCQMPDTFNSWFLITLLHVWMCLVRMKQEGRTGKYMCRIIVHFM
FT                   WEDVEQRGRVMGVNSYILKKNMALMTNNFYAAILGYDEGILSDDHGLAAALWRTFFNQK
FT                   CEDPRQL"
FT   assembly_gap    4608230..4608249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4628960..4633273)
FT                   /gene="Gdf5"
FT                   /locus_tag="mCG_5218"
FT                   /note="gene_id=mCG5218.1"
FT   mRNA            complement(join(4628960..4630350,4632349..4633273))
FT                   /gene="Gdf5"
FT                   /locus_tag="mCG_5218"
FT                   /product="growth differentiation factor 5"
FT                   /note="gene_id=mCG5218.1 transcript_id=mCT3767.0 created on
FT                   27-AUG-2002"
FT   CDS             complement(join(4629476..4630350,4632349..4632961))
FT                   /codon_start=1
FT                   /gene="Gdf5"
FT                   /locus_tag="mCG_5218"
FT                   /product="growth differentiation factor 5"
FT                   /note="gene_id=mCG5218.1 transcript_id=mCT3767.0
FT                   protein_id=mCP22991.1"
FT                   /db_xref="GOA:P43027"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:95688"
FT                   /db_xref="UniProtKB/Swiss-Prot:P43027"
FT                   /protein_id="EDL06156.1"
FT                   /translation="MRLPKLLTLLLWHLAWLDLELICTVLGAPDLGQRTPGAKPGLTKA
FT                   EAKERPPLARNVFRPGGHIYGVGATNARAKGSSGQTQAKKDEPRKMPPRSGGPETKPGP
FT                   SSQTRQAAARTVTPKGQLPGGKASSKAGSAPSSFLLKKTREPGTPREPKEPFRPPPITP
FT                   HEYMLSLYRTLSDADRKGGNSSVKLEAGLANTITSFIDKGQDDRGPAVRKQRYVFDISA
FT                   LEKDGLLGAELRILRKKPLDVAKPAVPSSGRVAQLKLSSCPSGRQPAALLDVRSVPGLD
FT                   GSGWEVFDIWKLFRNFKNSAQLCLELEAWERGRAVDLRGLGFERTARQVHEKALFLVFG
FT                   RTKKRDLFFNEIKARSGQDDKTVYEYLFSQRRKRRAPLANRQGKRPSKNLKARCSRKAL
FT                   HVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPT
FT                   CCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR"
FT   assembly_gap    4643919..4643938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4644975..4687431
FT                   /locus_tag="mCG_5221"
FT                   /note="gene_id=mCG5221.2"
FT   mRNA            join(<4644975..4645180,4650396..4650678,4651424..4651480,
FT                   4652237..4652319,4652634..4652799,4653513..4653619,
FT                   4653837..4654088,4656082..4656178,4657279..4657386,
FT                   4657810..4657968,4658519..4658760,4659237..4659419,
FT                   4660472..4660616,4661867..4662013,4662777..4663007,
FT                   4664195..4664388,4664608..4664735,4664913..4665082,
FT                   4667668..4667835,4668236..4668370,4669909..4670031,
FT                   4671813..4671946,4673768..4673906,4674353..4674695,
FT                   4675529..4675650,4676846..4676966,4678033..4678154,
FT                   4678750..4681308,4683105..4683218,4683379..4683525,
FT                   4683853..4683954,4684806..4684868,4686702..4687431)
FT                   /locus_tag="mCG_5221"
FT                   /product="mCG5221"
FT                   /note="gene_id=mCG5221.2 transcript_id=mCT3760.2 created on
FT                   27-AUG-2002"
FT   CDS             join(<4645092..4645180,4650396..4650678,4651424..4651480,
FT                   4652237..4652319,4652634..4652799,4653513..4653619,
FT                   4653837..4654088,4656082..4656178,4657279..4657386,
FT                   4657810..4657968,4658519..4658760,4659237..4659419,
FT                   4660472..4660616,4661867..4662013,4662777..4663007,
FT                   4664195..4664388,4664608..4664735,4664913..4665082,
FT                   4667668..4667835,4668236..4668370,4669909..4670031,
FT                   4671813..4671946,4673768..4673906,4674353..4674695,
FT                   4675529..4675650,4676846..4676966,4678033..4678154,
FT                   4678750..4681308,4683105..4683218,4683379..4683525,
FT                   4683853..4683954,4684806..4684868,4686702..4686965)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5221"
FT                   /product="mCG5221"
FT                   /note="gene_id=mCG5221.2 transcript_id=mCT3760.2
FT                   protein_id=mCP22992.2"
FT                   /protein_id="EDL06157.1"
FT                   /translation="GRPQAGPAGCCSGLGSCGALRDPREPTLVSSRGGLRHVGQWLDTL
FT                   LQPASSYTGAADLFCGAPMETGSPGLNMKPQSLQLVLEGQVLALQQQMAENQAASWRKL
FT                   KNSQEAQKRQATLVRKLQAKVLQYRSWCQDLEKRLEATGGLIPQRWESVEEPNLEQLLI
FT                   RLEEEQQRCESLVEVNTELRLHMEKADVVNKALQEDVEKLTVDWSRARDELVRKESQWR
FT                   MEQEFFKGYLRGEHGRLLNLWREVVTFRRHFLKMKSATDRDLTELKAEHARLSGSLLTC
FT                   CLRLTLRAQSRESSGSGRTEESEPARLLLLVAKTQALEKEAHEKSQELMQLKSHGDLEK
FT                   AELQDRVTELSALLTQSQKQNEDYEKMVKALRETMEILETNHAELMEHEASLSRNAQEE
FT                   KLSLQQVIKAITQALASVEEEDTVTQSSGHEDSLQSDCNGLSQFDPQDPDRALTLVQSV
FT                   LTRRQQAVQDLRQQLSGCQEAMSFLQQQHDQWEEEGRALREKLQKLTGERDALAGQTVG
FT                   LQGEVDSLTGERDALAGQTVDLQGEVDSLSRERELLQKARGELQQQLEVLEQEAWRLRR
FT                   MNMELQLQGDSAQGEKLEQQEELHLAVRERERLQETLVGLEAKQSESLSELLTLREALE
FT                   SSRLEGELLKQERVEVAAALARAEQSIVELSGSENSLKAEVADLRAAAVKLGALNEALA
FT                   LDKVELNQQLLQLEQENQSLCSRVEAAEQLRSALQVDLAEAERRREALWEKKTQLETQL
FT                   QKAEEAGAELQAELRGTREEKEELKDKLSEAHHQQETATAHLEQLHQDAERQEETLARA
FT                   VQEKEALVRERAALEVRLQAVERDRQDLTEHVLGLRSAKEQLESNLFEAQQQNSVIQVT
FT                   KGQLEVQIQTIIQAKEVIQGEVKCLKLELDAERTRAEQEWDAVARQLAQAEQEGQASLE
FT                   RQKVAHEEEVNRLQEKWEKERSWLQQELDKTLETLERERAELETKLREQQTEMEAIRAQ
FT                   REEERSQADSALYQMQLETEKERVSLLETLLRTQKELADASQQLERLRQDMKIQKLKEQ
FT                   ETTGMLQAQLQETQQELKEAAQQHRDDLAAFQKDKLDLQKQVEDLMSQLVAHDDSQRLV
FT                   KEEIEEKVKVAQECSRIQKELEKENASLALSLVEKEKRLLILQEADSVRQQELSSLRQD
FT                   IQEAQEGQRELGVQVELLRQEVKEKEADFVAREAQLLEELEASRVAEQQLRASLWAQEA
FT                   KATQLQLQLRSTESQLEALVAEQQPENQAQAQLASLCSVLQQALGSACESRPELRGGGD
FT                   SAPTLWGPDPDQNGASRLFKRWSLPTALSPEAVALALQKLHQDVWKARQARDDLRDQVQ
FT                   KLVQRLTDTEAQKSQVHSELQDLQRQLSQSQEEKSKWEGRQNSLESELRDLHETAASLQ
FT                   SRLRQAELQKMEAQNDRELLQASKEKLSAQVEHLQACVAEAQAQADAAAVLEEDLRTAR
FT                   SALKLKNEELESERERAQALQEQGELKVAQGKALQENLALLAQTLSNREREVETLQAEV
FT                   QELEKQREMQKAALELLSLDLKKRSREVDLQQEQIQELEQCRSVLEHLPMAVQEREQKL
FT                   SVQRDQIRELENDREAQRSVLEHQLLDLEQKAQVIESQRGQIQDLKKQLGTLECLALEL
FT                   EESHHKVESQQKMITELEGQREMQRVALTHLTLDLEERSQELQAQSSQLHELENHSTHL
FT                   AKELQERDQEVTSQRQQIDELQKQQEQLAQALERKGQELVLQKERIQVLEDQRTLQTKI
FT                   LEEDLEQIKHSLRERSQELASQWQLVHERADDGKSPSKGQRGSLEHLKLILRDKEKEVE
FT                   CQQERIQELQGHMGQLEQQLQGLHRKVGETSLLLTHREQETATLQQHLQEAKEQGELRE
FT                   QVLQGQLEEAQRDLAQRDHELETLRQEKQQTQDQEESMKLKTSALQAALEQAHATLKER
FT                   QGELEEHREQVRRLQEELEVEGRQVRALEEVLGDLRAESREHEKAVLALQQRCAEQAQE
FT                   HEAEARTLQDSWLQAQATLTEQEQELAALRAENQYSRRQEEAAVSQAEALQEALSKAQA
FT                   ALQEKEQSLLEQAELSHTLEASTAALQATLDTCQASARQLEEALRIREGEIQAQALQHH
FT                   EVTQHLQQELCQKKEELRQLLEKAGARRSQENGIQEKQSLEQERQEETRRLLESLKELQ
FT                   LTVAQREEEILMLREASSPRHRALPAEKPALQPLPAQQELERLQTALRQTEAREIEWRE
FT                   KAQDLALSLAQSKASISSLQEITMFLQASVLERESEQQRLQEELVLSRQALEEQQSGGP
FT                   HSTSRADQGPKVGQGSQSGEVETEPSPGVEEKERLTQRLERLQQAVAELEVDRSKLQCH
FT                   NAQLRTALEQVERERRKLKRDSVRASRAGSLEARETMTSSPTQQDGRGSQRGSSDSVLV
FT                   VELQREVALLRAQLALERKQRQDYIARSVQTSRELAGLHHSLSHSLLTVAQAPEATVLE
FT                   AETRKLDESLNQSLTSPGPCLLHPSLDTTQNTHR"
FT   gene            complement(4689861..4696513)
FT                   /locus_tag="mCG_58586"
FT                   /note="gene_id=mCG58586.2"
FT   mRNA            complement(join(4689861..4690096,4690971..4691020,
FT                   4691635..4691784,4691859..4692019,4696414..>4696451))
FT                   /locus_tag="mCG_58586"
FT                   /product="mCG58586, transcript variant mCT172533"
FT                   /note="gene_id=mCG58586.2 transcript_id=mCT172533.0 created
FT                   on 27-AUG-2002"
FT   mRNA            complement(join(4690771..4691020,4691635..4692019,
FT                   4696414..>4696457))
FT                   /locus_tag="mCG_58586"
FT                   /product="mCG58586, transcript variant mCT172532"
FT                   /note="gene_id=mCG58586.2 transcript_id=mCT172532.0 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(4691002..4691020,4691635..4691784,
FT                   4691859..4692019,4696414..>4696449))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58586"
FT                   /product="mCG58586, isoform CRA_a"
FT                   /note="gene_id=mCG58586.2 transcript_id=mCT172533.0
FT                   protein_id=mCP95452.0 isoform=CRA_a"
FT                   /protein_id="EDL06158.1"
FT                   /translation="RAVLGCGVTAPVGMNSVSEHGTVWKKPSGVTPNSLLHHFDFHCVS
FT                   CAMLGNSGFSNINQLFYMAFRTNQASNHSSEAEMRSQTAGPFICPRNASHQGFWGQYWL
FT                   LQLADLVPQVTRFWKMV"
FT   CDS             complement(join(4691002..4691020,4691635..>4691936))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58586"
FT                   /product="mCG58586, isoform CRA_b"
FT                   /note="gene_id=mCG58586.2 transcript_id=mCT172532.0
FT                   protein_id=mCP95451.0 isoform=CRA_b"
FT                   /protein_id="EDL06159.1"
FT                   /translation="FPLCVLCHAGEFWLQQYQPIILHGFQVGTGKVVGSRLVLSQIQSV
FT                   SAFVPRTNQASNHSSEAEMRSQTAGPFICPRNASHQGFWGQYWLLQLADLVPQVTRFWK
FT                   MV"
FT   mRNA            complement(join(<4691631..4691784,4691859..4692019,
FT                   4692215..4692519,4696414..4696513))
FT                   /locus_tag="mCG_58586"
FT                   /product="mCG58586, transcript variant mCT58769"
FT                   /note="gene_id=mCG58586.2 transcript_id=mCT58769.1 created
FT                   on 27-AUG-2002"
FT   CDS             complement(join(4691631..4691784,4691859..4692019,
FT                   4692215..4692469))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58586"
FT                   /product="mCG58586, isoform CRA_c"
FT                   /note="gene_id=mCG58586.2 transcript_id=mCT58769.1
FT                   protein_id=mCP42735.0 isoform=CRA_c"
FT                   /protein_id="EDL06160.1"
FT                   /translation="MEHCWVFWGLVLWMIAPCLDLTHELAPQQEWTYMVPQQCNWFCFK
FT                   FGKRGCPSKSPNCSTCHHTAGEACYEKFMGYWRTKALWWLGMNSVSEHGTVWKKPSGVT
FT                   PNSLLHHFDFHCVSCAMLGNSGFSNINQLFYMAFRTNQASNHSSEAEMRSQTAGPFICP
FT                   RNASHQGFWGQYWLLQLADLVPQVTR"
FT   gene            <4696640..4706816
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /note="gene_id=mCG5225.3"
FT   mRNA            join(<4696640..4696762,4696899..4696969,4697098..4697185,
FT                   4697394..4697513,4698974..4699067,4699634..4699799,
FT                   4699883..4699944,4704523..4704554,4705222..4705336,
FT                   4705423..4705487,4706114..4706250,4706331..4706386,
FT                   4706605..4706811)
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /product="ERGIC and golgi 3, transcript variant mCT189866"
FT                   /note="gene_id=mCG5225.3 transcript_id=mCT189866.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<4696640..4696762,4696899..4696969,4697098..4697185,
FT                   4697394..4697513,4698974..4699067,4699634..4699799,
FT                   4699883..4699940,4703911..4703925,4704523..4704554,
FT                   4705222..>4705264)
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /product="ERGIC and golgi 3, transcript variant mCT189865"
FT                   /note="gene_id=mCG5225.3 transcript_id=mCT189865.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4696642..4696762,4696899..4696969,4697098..4697185,
FT                   4697394..4697513,4698974..4699067,4699634..4699799,
FT                   4699883..4699940,4703911..4703925,4704523..4704554,
FT                   4705222..>4705264)
FT                   /codon_start=1
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /product="ERGIC and golgi 3, isoform CRA_b"
FT                   /note="gene_id=mCG5225.3 transcript_id=mCT189865.0
FT                   protein_id=mCP110891.0 isoform=CRA_b"
FT                   /protein_id="EDL06162.1"
FT                   /translation="GRLVSPFRPVPMEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVS
FT                   GLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAG
FT                   EQQLDVEHNLFKKRLDKDGVPVSSEAERHELGKVEVTVFDPNSLDPNRCESCYGAESED
FT                   IKCCNSCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVA
FT                   GNFHFAPGKSFQQSHVHVHAVEIHDLQSFGLDNPSDCLQINMTHYIK"
FT   mRNA            join(4696658..4696762,4696899..4696969,4697098..4697185,
FT                   4697394..4697513,4698974..4699067,4699634..4699799,
FT                   4699883..4699940,4704523..4704554,4705240..4705336,
FT                   4705423..4705487,4706114..4706250,4706331..4706386,
FT                   4706605..4706816)
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /product="ERGIC and golgi 3, transcript variant mCT3763"
FT                   /note="gene_id=mCG5225.3 transcript_id=mCT3763.1 created on
FT                   27-AUG-2002"
FT   CDS             join(4696675..4696762,4696899..4696969,4697098..4697185,
FT                   4697394..4697513,4698974..4699067,4699634..4699799,
FT                   4699883..4699940,4704523..4704554,4705240..4705336,
FT                   4705423..4705487,4706114..4706250,4706331..4706386,
FT                   4706605..4706684)
FT                   /codon_start=1
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /product="ERGIC and golgi 3, isoform CRA_d"
FT                   /note="gene_id=mCG5225.3 transcript_id=mCT3763.1
FT                   protein_id=mCP22998.1 isoform=CRA_d"
FT                   /protein_id="EDL06164.1"
FT                   /translation="MEALGKLKQFDAYPKTLEDFRVKTCGGATVTIVSGLLMLLLFLSE
FT                   LQYYLTTEVHPELYVDKSRGDKLKINIDVLFPHMPCAYLSIDAMDVAGEQQLDVEHNLF
FT                   KKRLDKDGVPVSSEAERHELGKVEVTVFDPNSLDPNRCESCYGAESEDIKCCNSCEDVR
FT                   EAYRRRGWAFKNPDTIEQCRREGFSQKMQEQKNEGCQVYGFLEVNKVAGNFHFAPGKSF
FT                   QQSHVHVHDLQSFGLDNINMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVK
FT                   VVPTVYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRS
FT                   FTHFLTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT"
FT   mRNA            join(<4696894..4696969,4697098..4697185,4697394..4697513,
FT                   4698974..4699067,4699634..4699830,4704523..4704554,
FT                   4705240..>4705346)
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /product="ERGIC and golgi 3, transcript variant mCT189864"
FT                   /note="gene_id=mCG5225.3 transcript_id=mCT189864.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4696895..4696969,4697098..4697185,4697394..4697513,
FT                   4698974..4699067,4699634..4699830,4704523..4704554,
FT                   4705240..>4705346)
FT                   /codon_start=1
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /product="ERGIC and golgi 3, isoform CRA_a"
FT                   /note="gene_id=mCG5225.3 transcript_id=mCT189864.0
FT                   protein_id=mCP110890.0 isoform=CRA_a"
FT                   /protein_id="EDL06161.1"
FT                   /translation="AVTIVSGLLMLLLFLSELQYYLTTEVHPELYVDKSRGDKLKINID
FT                   VLFPHMPCAYLSIDAMDVAGEQQLDVEHNLFKKRLDKDGVPVSSEAERHELGKVEVTVF
FT                   DPNSLDPNRCESCYGAESEDIKCCNSCEDVREAYRRRGWAFKNPDTIEQCRREGFSQKM
FT                   QEQKNEGCQVYGFLEVNKVPGGSKARQLVHDLQSFGLDNINMTHYIKHLSFGEDYPGIV
FT                   NPLDHTNVTAPQGTIL"
FT   CDS             join(<4698995..4699067,4699634..4699799,4699883..4699944,
FT                   4704523..4704554,4705222..4705336,4705423..4705487,
FT                   4706114..4706250,4706331..4706386,4706605..4706684)
FT                   /codon_start=1
FT                   /gene="Ergic3"
FT                   /locus_tag="mCG_5225"
FT                   /product="ERGIC and golgi 3, isoform CRA_c"
FT                   /note="gene_id=mCG5225.3 transcript_id=mCT189866.0
FT                   protein_id=mCP110892.0 isoform=CRA_c"
FT                   /protein_id="EDL06163.1"
FT                   /translation="QCLTPTPWTPIAVRAATALSQKTSSAVTVVKMCGRPIAVEAGPSR
FT                   TRTPLSSVGERASARRCRSRRMKAARCTASWRSTRWLETSTLPLGRASNSLMCMVIHDL
FT                   QSFGLDNPSDCLQINMTHYIKHLSFGEDYPGIVNPLDHTNVTAPQASMMFQYFVKVVPT
FT                   VYMKVDGEVLRTNQFSVTRHEKVANGLLGDQGLPGVFVLYELSPMMVKLTEKHRSFTHF
FT                   LTGVCAIIGGMFTVAGLIDSLIYHSARAIQKKIDLGKTT"
FT   gene            complement(4707673..>4740780)
FT                   /locus_tag="mCG_125376"
FT                   /note="gene_id=mCG125376.0"
FT   mRNA            complement(join(4707673..4708165,4708239..4708519,
FT                   4708876..4709117,4709275..4709373,4711058..4711143,
FT                   4711631..4711791,4712479..4712633,4713167..4713337,
FT                   4713485..4713612,4717696..4717812,4718142..4718276,
FT                   4718353..4718453,4718542..4718581,4719718..4719846,
FT                   4719933..4719979,4720119..4720317,4723457..4723618,
FT                   4723710..4723826,4723969..4724142,4724414..4724548,
FT                   4724893..4725017,4725135..4725275,4725861..4726035,
FT                   4732976..4733096,4733189..4733366,4733550..4733658,
FT                   4733943..4734015,4734160..4734313,4734603..4734789,
FT                   4735478..4735661,4735775..4735934,4736139..4736223,
FT                   4736722..4736853,4737431..4737572,4737969..4738010,
FT                   4738159..4738250,4740510..4740609,4740692..>4740780))
FT                   /locus_tag="mCG_125376"
FT                   /product="mCG125376, transcript variant mCT126636"
FT                   /note="gene_id=mCG125376.0 transcript_id=mCT126636.1
FT                   created on 27-AUG-2002"
FT   mRNA            complement(join(4707674..4707986,4708065..4709117,
FT                   4709275..4709373,4711058..4711143,4711631..4711791,
FT                   4712479..4712633,4713167..>4713410))
FT                   /locus_tag="mCG_125376"
FT                   /product="mCG125376, transcript variant mCT172498"
FT                   /note="gene_id=mCG125376.0 transcript_id=mCT172498.0
FT                   created on 27-AUG-2002"
FT   CDS             complement(join(4707794..4708165,4708239..4708519,
FT                   4708876..4709117,4709275..4709373,4711058..4711143,
FT                   4711631..4711791,4712479..4712633,4713167..4713337,
FT                   4713485..4713612,4717696..4717812,4718142..4718276,
FT                   4718353..4718453,4718542..4718581,4719718..4719846,
FT                   4719933..4719979,4720119..4720317,4723457..4723618,
FT                   4723710..4723826,4723969..4724142,4724414..4724548,
FT                   4724893..4725017,4725135..4725275,4725861..4726035,
FT                   4732976..4733096,4733189..4733366,4733550..4733658,
FT                   4733943..4734015,4734160..4734313,4734603..4734789,
FT                   4735478..4735661,4735775..4735934,4736139..4736223,
FT                   4736722..4736853,4737431..4737572,4737969..4738010,
FT                   4738159..4738250,4740510..4740609,4740692..>4740780))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125376"
FT                   /product="mCG125376, isoform CRA_a"
FT                   /note="gene_id=mCG125376.0 transcript_id=mCT126636.1
FT                   protein_id=mCP72838.1 isoform=CRA_a"
FT                   /protein_id="EDL06165.1"
FT                   /translation="LFRWPHYGSPLAGESLSVQVVNCSRVFSPRPLGTLVISLQQLQSA
FT                   GHLVLREALVDERLRVSPIQVELDLKYQPPEGAAGTWAEEDFGTPIRDSLELIIPNVGF
FT                   QDMEPGEAQLERRAVALGRRLARSLGTQDDEENELELEPELEEEPDVEISGVGVTVLEA
FT                   QKLVGVNINPYVAVRVGDQRKVTATLRGTNCPFYNEAFHSQTLPFMATRIGTFRMDLGM
FT                   ALDQPDGHFHQKWAPLHDPRDTRAGTKGFVKITLSVRARGDLPLPPPPPCPGTSSDIEK
FT                   NLLLPHGVQAERPWARLRVRVYRAEGLPTVRTGLLGSLARALHDQNVLLDPYVRVSFLG
FT                   QQGETSVRGEETAPKWNEQLSFVELFPPLTRSLRLQLRDNAPLVDVALATHVLDLRQIS
FT                   NSGRAAGFNPTFGPAWVPLYGSLPSGRLRDDLQSLNEGLGEGIWFRGRLLVAVSMEVTS
FT                   EDAPEIPSAMEVEVEDLLPLPENALASFEDFLLFGVLFEATMIDPSLAKKPISLEISIG
FT                   HAGRQEEQSGQGSRADEGSESSTLEVQPLLESEDRGAGQEEQELLGTPAQWPEPVDGNG
FT                   PYLCLPLRHRKPCLHVWSCWEDYTWRLQSSNSVCKVAERLPQPPLPDVLVWMFSGQRRV
FT                   AYARIPAQDILYSVVEEERGRDCGKIQSLLLTVRWGWDGAPGEVCAKLELFLWLGLGKQ
FT                   AKACTSELPMDLLPEPSSGLPQSLYRDDFRYFQLRAHLYQARGVLAADDSGLSDPFARV
FT                   LISTQCQTTRVLEQTLSPLWDELLVFDQLIVDGRREHLREEPPLVVINVFDHNKFGPAV
FT                   FLGRAFAAPRVKLIEDPYQRPELQFFPLRKGPQAAGEVIATFELIELDYSGHLEPSVPS
FT                   DVEPRDLASLVEPISGHLSLPPSVRPVLRAFRVEVLFWGLRGLGRVHLFEIEKPQVVLE
FT                   VAGRRVESEVLPNYRENPNFTELVRHVTVDLPEQPYLQPPLSILVIERRAFGRTVLVGS
FT                   HIVPHMLRFILQGHEDPQEEEETEEETRDLVPHGPQGEKSLPEAGTSRQLLKAPLKKLT
FT                   LGLLGQGPELEEDIPDPEEMDWWSKYYASLQEFQGQPSSDDEMDEAGDADGTHLISGDR
FT                   EAQEQGETDSKVSVPRKKAIATLKIYNSSLEDEFSHFEDWLSVFPLYRGQGGQDGEGEG
FT                   ASGHFVGKFKGSFLIYPESEAKSFSEPQISRGVPQNRPIKLLVRVYIVKATNLAPADPN
FT                   GKADPYVVVSAGKEQRDTKERYIPKQLNPIFGEVLELSVSLPAQPELTVAVFDHDLVGS
FT                   DDLIGETHIDLENRFYSHHRANCGLASQYDVNGYNAWRDAFRPSQILAGLCQRCGLPVP
FT                   EYRAGAVKVGSRVFLTPSEAPPPDDRKPKVTSEASEEAQALHVLRRWQEMPGLGIQLVP
FT                   EHVETRPLYHPRSPGLLQGSLHMWIDIFPSDVPAPPPVDIKPRQPISYELRVVIWNTDD
FT                   VALDDVNPLTGERSSDIYVKSWVKGLEQDRQETDVHFNSLTGEGNFNWRFVFRFDYLPT
FT                   EREVSVRRKPGPFALEEAEFRQPAVLVLQVWDYDRISANDFLGSLELQLPDMVRGARDP
FT                   EHCSVRLALDGAGPRCNLFRCHRLRGWWPVVKMKDMEDVEREAREAQAGKKRKRKRRAG
FT                   RPEDLEFTDTGGNVYILTGKVEAEFELLTVEEAEKRPVGKGRKEPEPLEKPKQVAQAWV
FT                   VGVTGRGLLVTVTPPFPNSRPKTSFNWFVNPLKTFIFFIWRRYWRILVLLLLLALITIF
FT                   LLLVFYTIPGQISEVIFSPVHKH"
FT   CDS             complement(join(4708868..4709117,4709275..4709373,
FT                   4711058..4711143,4711631..4711791,4712479..4712633,
FT                   4713167..>4713378))
FT                   /codon_start=1
FT                   /locus_tag="mCG_125376"
FT                   /product="mCG125376, isoform CRA_b"
FT                   /note="gene_id=mCG125376.0 transcript_id=mCT172498.0
FT                   protein_id=mCP95417.0 isoform=CRA_b"
FT                   /protein_id="EDL06166.1"
FT                   /translation="GHGAVVSQFPFLPRVLELSVSLPAQPELTVAVFDHDLVGSDDLIG
FT                   ETHIDLENRFYSHHRANCGLASQYDVNGYNAWRDAFRPSQILAGLCQRCGLPVPEYRAG
FT                   AVKVGSRVFLTPSEAPPPDDRKPKVTSEASEEAQALHVLRRWQEMPGLGIQLVPEHVET
FT                   RPLYHPRSPGLLQGSLHMWIDIFPSDVPAPPPVDIKPRQPISYELRVVIWNTDDVALDD
FT                   VNPLTGERSSDIYVKSWVKGLEQDRQETDVHFNSLTGEGNFNWRFVFRFDYLPTEREVS
FT                   VRRKPGPFALEEAEFRQPAVLVLQVWDYDRISANDFLGT"
FT   assembly_gap    4744707..4744726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4744911..4745742
FT                   /pseudo
FT                   /locus_tag="mCG_5235"
FT                   /note="gene_id=mCG5235.1"
FT   mRNA            4744911..4745742
FT                   /pseudo
FT                   /locus_tag="mCG_5235"
FT                   /note="gene_id=mCG5235.1 transcript_id=mCT3755.2 created on
FT                   27-AUG-2002"
FT   assembly_gap    4746751..4746770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4751032..4751051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4755284..4759576
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /note="gene_id=mCG140983.0"
FT   mRNA            join(<4755284..4755729,4756211..4756943,4757166..4757209,
FT                   4757389..4757414,4757532..4757640,4757824..4757899,
FT                   4758014..4758129,4758448..4758615,4759214..4759303,
FT                   4759397..4759576)
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /product="sperm associated antigen 4, transcript variant
FT                   mCT172526"
FT                   /note="gene_id=mCG140983.0 transcript_id=mCT172526.0
FT                   created on 27-AUG-2002"
FT   mRNA            join(<4755284..4755729,4756211..4756274,4756882..4756943,
FT                   4757166..4757209,4757389..4757414,4757532..4757566)
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /product="sperm associated antigen 4, transcript variant
FT                   mCT172524"
FT                   /note="gene_id=mCG140983.0 transcript_id=mCT172524.0
FT                   created on 27-AUG-2002"
FT   CDS             join(<4755286..4755729,4756211..4756231)
FT                   /codon_start=1
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /product="sperm associated antigen 4, isoform CRA_c"
FT                   /note="gene_id=mCG140983.0 transcript_id=mCT172524.0
FT                   protein_id=mCP95445.0 isoform=CRA_c"
FT                   /protein_id="EDL06169.1"
FT                   /translation="CDGDNSTAAGGSAEPPRGSRRVLPCGARQLRKGRGLWLRRLRLPR
FT                   GVAQVRMRRSPRSGSAASSHNHTPNFYSENSNSSHSATSGDSNGRRSAGPELGEPEGRR
FT                   ARGSSCGEPALSPGMPGGDTWAGSSRPKLAPRSHNGQTACGAATNRLDLL"
FT   mRNA            join(<4755302..4755729,4756211..4756315,4756644..4756710,
FT                   4756882..4756943,4757166..4757209,4757389..4757414,
FT                   4757532..4757640,4757824..4757899,4758014..4759301)
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /product="sperm associated antigen 4, transcript variant
FT                   mCT189869"
FT                   /note="gene_id=mCG140983.0 transcript_id=mCT189869.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<4755439..4755748,4756211..4756315,4756644..4756710,
FT                   4756882..4756943,4757166..4757209,4757389..4757414,
FT                   4757532..4757640,4757824..4757899,4758014..4758129,
FT                   4758448..4758615,4759214..4759303,4759397..4759574)
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /product="sperm associated antigen 4, transcript variant
FT                   mCT172525"
FT                   /note="gene_id=mCG140983.0 transcript_id=mCT172525.0
FT                   created on 27-AUG-2002"
FT   CDS             join(4755439..4755748,4756211..4756315,4756644..4756710,
FT                   4756882..4756943,4757166..4757209,4757389..4757414,
FT                   4757532..4757640,4757824..4757899,4758014..4758129,
FT                   4758448..4758615,4759214..4759303,4759397..4759555)
FT                   /codon_start=1
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /product="sperm associated antigen 4, isoform CRA_a"
FT                   /note="gene_id=mCG140983.0 transcript_id=mCT172525.0
FT                   protein_id=mCP95444.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9JJF2"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="InterPro:IPR027776"
FT                   /db_xref="MGI:MGI:2444120"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9JJF2"
FT                   /protein_id="EDL06167.1"
FT                   /translation="MRRSPRSGSAASSHNHTPNFYSENSNSSHSATSGDSNGRRSAGPE
FT                   LGEPEGRRARGSSCGEPALSPGMPGGDTWAGSSRPKLAPRSHNGQTACGAATVRGGASE
FT                   PSGSSVVLEEQLNLLPILDLRQEMPTPRVSKSFLSLLFQVLSMVLSLAVDGLVCVCREI
FT                   CSIRFLFTAVSLLSIFLAALWWGLLYLIPPLENEPTEMLTLSQYHHRVHSQGQQLQQLQ
FT                   AELNKLHKEVSSVRAAHSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLEKTSSDYED
FT                   QNTAYFWNRLSFWNYARPPSVILEPDVFPGNCWAFEGDKGQVVIRLPGHVQLSDITLQH
FT                   PPPTVAHTGGASSAPRDFAVYGLQADDETEVFLGKFIFDVQKSEIQTFHLQNDPPSAFP
FT                   KVKIQILSNWGHPRFTCLYRVRAHGVRTSEWADDNATGVTGGPH"
FT   CDS             join(<4755621..4755729,4756211..4756315,4756644..4756710,
FT                   4756882..4756943,4757166..4757209,4757389..4757414,
FT                   4757532..4757640,4757824..4757899,4758014..4758279)
FT                   /codon_start=1
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /product="sperm associated antigen 4, isoform CRA_b"
FT                   /note="gene_id=mCG140983.0 transcript_id=mCT189869.0
FT                   protein_id=mCP110862.0 isoform=CRA_b"
FT                   /protein_id="EDL06168.1"
FT                   /translation="ARLKPRNARRRHMGRKLSAEAGASEPQWADRLWRGNQPSGSSVVL
FT                   EEQLNLLPILDLRQEMPTPRVSKSFLSLLFQVLSMVLSLAVDGLVCVCREICSIRFLFT
FT                   AVSLLSIFLAALWWGLLYLIPPLENEPTEMLTLSQYHHRVHSQGQQLQQLQAELNKLHK
FT                   EVSSVRAAHSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLEKTSSDYEDQNTAYFWN
FT                   RLSFWNYARPPSVILEVGLEPEGLGTVPRGKSWGQESAWCREEWSPGQFGSRRHSPLEE
FT                   ESGILW"
FT   CDS             join(<4756790..4756943,4757166..4757209,4757389..4757414,
FT                   4757532..4757640,4757824..4757899,4758014..4758129,
FT                   4758448..4758615,4759214..4759303,4759397..4759555)
FT                   /codon_start=1
FT                   /gene="Spag4"
FT                   /locus_tag="mCG_140983"
FT                   /product="sperm associated antigen 4, isoform CRA_d"
FT                   /note="gene_id=mCG140983.0 transcript_id=mCT172526.0
FT                   protein_id=mCP95443.0 isoform=CRA_d"
FT                   /protein_id="EDL06170.1"
FT                   /translation="VPRNWAGLGPPRSRLEWFRASRQQLPLLFFREICSIRFLFTAVSL
FT                   LSIFLAALWWGLLYLIPPLENEPTEMLTLSQYHHRVHSQGQQLQQLQAELNKLHKEVSS
FT                   VRAAHSERVAKLVFQRLNEDFVRKPDYALSSVGASIDLEKTSSDYEDQNTAYFWNRLSF
FT                   WNYARPPSVILEPDVFPGNCWAFEGDKGQVVIRLPGHVQLSDITLQHPPPTVAHTGGAS
FT                   SAPRDFAVYGLQADDETEVFLGKFIFDVQKSEIQTFHLQNDPPSAFPKVKIQILSNWGH
FT                   PRFTCLYRVRAHGVRTSEWADDNATGVTGGPH"
FT   gene            complement(4761922..4802231)
FT                   /locus_tag="mCG_5227"
FT                   /note="gene_id=mCG5227.3"
FT   mRNA            complement(join(4761922..4763738,4763876..4764112,
FT                   4764253..4764386,4766527..4766578,4767689..4767743,
FT                   4767846..4767979,4768065..4768124,4768219..4768305,
FT                   4768437..4768523,4768622..4768711,4768864..4768944,
FT                   4769042..4769113,4769190..4769264,4769353..4769532,
FT                   4769629..4769754,4802053..4802231))
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, transcript variant mCT3764"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT3764.3 created on
FT                   28-APR-2003"
FT   mRNA            complement(join(4761922..4763738,4763876..4764112,
FT                   4764253..4764386,4766527..4766578,4767689..4767743,
FT                   4767846..4767979,4768065..4768124,4768219..4768305,
FT                   4768437..4768523,4768622..4768711,4768864..4768944,
FT                   4769042..4769113,4769190..4769264,4769353..4769532,
FT                   4769629..4769754,4793616..4793664,4802053..4802231))
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, transcript variant mCT172514"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT172514.1 created
FT                   on 28-APR-2003"
FT   mRNA            complement(join(4761922..4763738,4763876..4764112,
FT                   4764253..4764386,4766527..4766578,4767689..4767743,
FT                   4767846..4767979,4768065..4768124,4768219..4768305,
FT                   4768437..4768523,4768622..4768711,4768864..4768944,
FT                   4769042..4769113,4769190..4769264,4769353..4769532,
FT                   4769629..4769754,4787102..4788648,4793616..4793664,
FT                   4802053..4802231))
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, transcript variant mCT182089"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT182089.0 created
FT                   on 28-APR-2003"
FT   mRNA            complement(join(4761922..4763738,4763876..4764112,
FT                   4764253..4764386,4766527..4766578,4767689..4767743,
FT                   4767846..4767979,4768065..4768124,4768219..4768305,
FT                   4768437..4768523,4768622..4768711,4768864..4768944,
FT                   4769042..4769113,4769190..4769264,4769353..4769532,
FT                   4769629..4769754,4788506..4788648,4793616..4793696,
FT                   4802053..4802231))
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, transcript variant mCT182088"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT182088.0 created
FT                   on 28-APR-2003"
FT   gene            <4761927..4762776
FT                   /locus_tag="mCG_140984"
FT                   /note="gene_id=mCG140984.0"
FT   mRNA            join(<4761927..4762323,4762466..4762548,4762712..4762776)
FT                   /locus_tag="mCG_140984"
FT                   /product="mCG140984"
FT                   /note="gene_id=mCG140984.0 transcript_id=mCT172527.0
FT                   created on 27-AUG-2002"
FT   CDS             join(<4762236..4762323,4762466..4762548,4762712..4762717)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140984"
FT                   /product="mCG140984"
FT                   /note="gene_id=mCG140984.0 transcript_id=mCT172527.0
FT                   protein_id=mCP95446.0"
FT                   /protein_id="EDL06177.1"
FT                   /translation="HCKYHLQSLISILKNQLFKNVCNHSKSNLFVLSDLKLLVYLKFTS
FT                   NSEQPSCLRLLSL"
FT   CDS             complement(join(4763598..4763738,4763876..4764112,
FT                   4764253..4764386,4766527..4766578,4767689..4767743,
FT                   4767846..4767979,4768065..4768124,4768219..4768305,
FT                   4768437..4768523,4768622..4768711,4768864..4768944,
FT                   4769042..4769113,4769190..4769264,4769353..4769532,
FT                   4769629..4769754))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, isoform CRA_b"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT182088.0
FT                   protein_id=mCP105009.0 isoform=CRA_b"
FT                   /protein_id="EDL06173.1"
FT                   /translation="MAHCVTLVQLSVSCEHLIDKDIGSKSDPLCVLLQDVGGAWAELCR
FT                   TERVRNCSSPEFSKTLQIEYHFETVQKLRFGIYDIDNKTPELGDDDFLGGAECSLGQIV
FT                   SSQTLTLPLMLKPGKPAGRGTITVSAQELKDSRVVTMEVEARNLDKKDFLGKSDPFLEF
FT                   FRQGDGKWQLAYRTEVVKNNLNPTWKRFSVSLQHFCGGDLSTPIQVRCSDYDSDGSHDL
FT                   IGTFHTTLAQLQAVPAEFECVHPEKQQRKKNYRNSGTVRVKTCRVETEYSFLDYVMGGC
FT                   QINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLTALWSVGSVVQDYDSDKLFPAFGF
FT                   GAQVPPDWQVSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVAR
FT                   FAAQAAQQRSASQYFVLLLLTDGAVTDVEATCKAVVDASKLPMSVIIVGVGGADFEVME
FT                   QLDADGGPLRTRSGEAAARDIVQFVPYRRFQNAPRETLAQTVLAEVPTQMVSYFRAQGW
FT                   APLKAPPTPGKGPAQAPQA"
FT   CDS             complement(join(4763598..4763738,4763876..4764112,
FT                   4764253..4764386,4766527..4766578,4767689..4767743,
FT                   4767846..4767979,4768065..4768124,4768219..4768305,
FT                   4768437..4768523,4768622..4768711,4768864..4768944,
FT                   4769042..4769113,4769190..4769264,4769353..4769532,
FT                   4769629..4769754))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, isoform CRA_b"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT182089.0
FT                   protein_id=mCP105010.0 isoform=CRA_b"
FT                   /protein_id="EDL06174.1"
FT                   /translation="MAHCVTLVQLSVSCEHLIDKDIGSKSDPLCVLLQDVGGAWAELCR
FT                   TERVRNCSSPEFSKTLQIEYHFETVQKLRFGIYDIDNKTPELGDDDFLGGAECSLGQIV
FT                   SSQTLTLPLMLKPGKPAGRGTITVSAQELKDSRVVTMEVEARNLDKKDFLGKSDPFLEF
FT                   FRQGDGKWQLAYRTEVVKNNLNPTWKRFSVSLQHFCGGDLSTPIQVRCSDYDSDGSHDL
FT                   IGTFHTTLAQLQAVPAEFECVHPEKQQRKKNYRNSGTVRVKTCRVETEYSFLDYVMGGC
FT                   QINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLTALWSVGSVVQDYDSDKLFPAFGF
FT                   GAQVPPDWQVSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVAR
FT                   FAAQAAQQRSASQYFVLLLLTDGAVTDVEATCKAVVDASKLPMSVIIVGVGGADFEVME
FT                   QLDADGGPLRTRSGEAAARDIVQFVPYRRFQNAPRETLAQTVLAEVPTQMVSYFRAQGW
FT                   APLKAPPTPGKGPAQAPQA"
FT   CDS             complement(join(4763598..4763738,4763876..4764112,
FT                   4764253..4764386,4766527..4766578,4767689..4767743,
FT                   4767846..4767979,4768065..4768124,4768219..4768305,
FT                   4768437..4768523,4768622..4768711,4768864..4768944,
FT                   4769042..4769113,4769190..4769264,4769353..4769532,
FT                   4769629..4769754))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, isoform CRA_b"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT172514.1
FT                   protein_id=mCP95433.0 isoform=CRA_b"
FT                   /protein_id="EDL06175.1"
FT                   /translation="MAHCVTLVQLSVSCEHLIDKDIGSKSDPLCVLLQDVGGAWAELCR
FT                   TERVRNCSSPEFSKTLQIEYHFETVQKLRFGIYDIDNKTPELGDDDFLGGAECSLGQIV
FT                   SSQTLTLPLMLKPGKPAGRGTITVSAQELKDSRVVTMEVEARNLDKKDFLGKSDPFLEF
FT                   FRQGDGKWQLAYRTEVVKNNLNPTWKRFSVSLQHFCGGDLSTPIQVRCSDYDSDGSHDL
FT                   IGTFHTTLAQLQAVPAEFECVHPEKQQRKKNYRNSGTVRVKTCRVETEYSFLDYVMGGC
FT                   QINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLTALWSVGSVVQDYDSDKLFPAFGF
FT                   GAQVPPDWQVSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVAR
FT                   FAAQAAQQRSASQYFVLLLLTDGAVTDVEATCKAVVDASKLPMSVIIVGVGGADFEVME
FT                   QLDADGGPLRTRSGEAAARDIVQFVPYRRFQNAPRETLAQTVLAEVPTQMVSYFRAQGW
FT                   APLKAPPTPGKGPAQAPQA"
FT   CDS             complement(join(4763598..4763738,4763876..4764112,
FT                   4764253..4764386,4766527..4766578,4767689..4767743,
FT                   4767846..4767979,4768065..4768124,4768219..4768305,
FT                   4768437..4768523,4768622..4768711,4768864..4768944,
FT                   4769042..4769113,4769190..4769264,4769353..4769532,
FT                   4769629..4769754))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, isoform CRA_b"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT3764.3
FT                   protein_id=mCP23015.3 isoform=CRA_b"
FT                   /protein_id="EDL06176.1"
FT                   /translation="MAHCVTLVQLSVSCEHLIDKDIGSKSDPLCVLLQDVGGAWAELCR
FT                   TERVRNCSSPEFSKTLQIEYHFETVQKLRFGIYDIDNKTPELGDDDFLGGAECSLGQIV
FT                   SSQTLTLPLMLKPGKPAGRGTITVSAQELKDSRVVTMEVEARNLDKKDFLGKSDPFLEF
FT                   FRQGDGKWQLAYRTEVVKNNLNPTWKRFSVSLQHFCGGDLSTPIQVRCSDYDSDGSHDL
FT                   IGTFHTTLAQLQAVPAEFECVHPEKQQRKKNYRNSGTVRVKTCRVETEYSFLDYVMGGC
FT                   QINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLTALWSVGSVVQDYDSDKLFPAFGF
FT                   GAQVPPDWQVSHEFALNFNPSNPYCAGIQGIVDAYRQALPQVRLYGPTNFAPIINHVAR
FT                   FAAQAAQQRSASQYFVLLLLTDGAVTDVEATCKAVVDASKLPMSVIIVGVGGADFEVME
FT                   QLDADGGPLRTRSGEAAARDIVQFVPYRRFQNAPRETLAQTVLAEVPTQMVSYFRAQGW
FT                   APLKAPPTPGKGPAQAPQA"
FT   assembly_gap    4764942..4765239
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4785156..4788648,4793616..4793696,
FT                   4802053..4802231))
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, transcript variant mCT182087"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT182087.0 created
FT                   on 28-APR-2003"
FT   mRNA            complement(join(4785166..4788648,4793616..4793664,
FT                   4802053..4802231))
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, transcript variant mCT172515"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT172515.1 created
FT                   on 28-APR-2003"
FT   CDS             complement(4786305..4788626)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, isoform CRA_a"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT172515.1
FT                   protein_id=mCP95434.1 isoform=CRA_a"
FT                   /protein_id="EDL06171.1"
FT                   /translation="MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFI
FT                   VFATDEDARLGMMRTGGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDIPPANASR
FT                   SGPPPSSGMSSRVNLPAIVPNFNNPSPSVVTATTSVHESNKNIQTFSTASVGTAPPSMG
FT                   TSFGSPTFSSTIPSTASPMNTVPPPPIPPIPAMPSLPPLPSIPPIPVPPPVPTLPPVPP
FT                   VPPIPPVPSVPPMTTLPPMSGMPPLNPPPVAPLPAGMNGSGAPIGLNNNMNPVFLGPLN
FT                   PVNSIQMNSQSSVKSLPINPDDLYVSVHGMPFSAMENDVREFFHGLRVDAVHLLKDHVG
FT                   RNNGNGLVKFLSPQDTFEALKRNRMLMIQRYVEVSPATERQWVAAGGHITFKQSMGPSG
FT                   QAHPPPQTLPRSKSPSGQKRSRSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVED
FT                   SIYIAYGPNGKATGEGFVEFRNDADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMI
FT                   RKRLQNFSYDQRELVLNPEGEVSSAKVCAHITNIPFSITKMDVLQFLEGIPVDESAVHV
FT                   LVDNNGQGLGQALVQFKTEDDAHKSEHLHRKKLNGREAFVHIVTLEDMREIEKNPPAQG
FT                   KKGLKISVPGNPAVPVIPSAGMPAAGIPTAGIPGAGLPSAGMPGAGMPSSGMPGPGMPG
FT                   PGIPGAGIPGPAMPGPAMPGPAMPGPAMPGPAMPGPAMPGPAMPGPAMPGPAIPGPAIP
FT                   GPAIPLVLASPVQEEKSMSS"
FT   CDS             complement(4786305..4788626)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5227"
FT                   /product="mCG5227, isoform CRA_a"
FT                   /note="gene_id=mCG5227.3 transcript_id=mCT182087.0
FT                   protein_id=mCP105011.0 isoform=CRA_a"
FT                   /protein_id="EDL06172.1"
FT                   /translation="MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFI
FT                   VFATDEDARLGMMRTGGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDIPPANASR
FT                   SGPPPSSGMSSRVNLPAIVPNFNNPSPSVVTATTSVHESNKNIQTFSTASVGTAPPSMG
FT                   TSFGSPTFSSTIPSTASPMNTVPPPPIPPIPAMPSLPPLPSIPPIPVPPPVPTLPPVPP
FT                   VPPIPPVPSVPPMTTLPPMSGMPPLNPPPVAPLPAGMNGSGAPIGLNNNMNPVFLGPLN
FT                   PVNSIQMNSQSSVKSLPINPDDLYVSVHGMPFSAMENDVREFFHGLRVDAVHLLKDHVG
FT                   RNNGNGLVKFLSPQDTFEALKRNRMLMIQRYVEVSPATERQWVAAGGHITFKQSMGPSG
FT                   QAHPPPQTLPRSKSPSGQKRSRSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVED
FT                   SIYIAYGPNGKATGEGFVEFRNDADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMI
FT                   RKRLQNFSYDQRELVLNPEGEVSSAKVCAHITNIPFSITKMDVLQFLEGIPVDESAVHV
FT                   LVDNNGQGLGQALVQFKTEDDAHKSEHLHRKKLNGREAFVHIVTLEDMREIEKNPPAQG
FT                   KKGLKISVPGNPAVPVIPSAGMPAAGIPTAGIPGAGLPSAGMPGAGMPSSGMPGPGMPG
FT                   PGIPGAGIPGPAMPGPAMPGPAMPGPAMPGPAMPGPAMPGPAMPGPAMPGPAIPGPAIP
FT                   GPAIPLVLASPVQEEKSMSS"
FT   assembly_gap    4805594..4806683
FT                   /estimated_length=1090
FT                   /gap_type="unknown"
FT   gene            complement(4813816..4834431)
FT                   /gene="Nfs1"
FT                   /locus_tag="mCG_5229"
FT                   /note="gene_id=mCG5229.1"
FT   mRNA            complement(join(4813816..4814493,4815423..4815512,
FT                   4816637..4816720,4817329..4817410,4817984..4818089,
FT                   4818756..4818913,4821899..4822033,4822879..4822972,
FT                   4824652..4824804,4829975..4830058,4832372..4832488,
FT                   4833613..4833704,4834266..4834431))
FT                   /gene="Nfs1"
FT                   /locus_tag="mCG_5229"
FT                   /product="nitrogen fixation gene 1 (S. cerevisiae),
FT                   transcript variant mCT3756"
FT                   /note="gene_id=mCG5229.1 transcript_id=mCT3756.1 created on
FT                   28-AUG-2002"
FT   CDS             complement(join(4814430..4814493,4815423..4815512,
FT                   4816637..4816720,4817329..4817410,4817984..4818089,
FT                   4818756..4818913,4821899..4822033,4822879..4822972,
FT                   4824652..4824804,4829975..4830058,4832372..4832488,
FT                   4833613..4833704,4834266..4834386))
FT                   /codon_start=1
FT                   /gene="Nfs1"
FT                   /locus_tag="mCG_5229"
FT                   /product="nitrogen fixation gene 1 (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5229.1 transcript_id=mCT3756.1
FT                   protein_id=mCP23006.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9Z1J3"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="MGI:MGI:1316706"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9Z1J3"
FT                   /protein_id="EDL06179.1"
FT                   /translation="MVGSVAGNMLLRAAWRRASLAATSLALGRSSVPTRGLRLRVVDHG
FT                   PHSPVHSEAEAVLRPLYMDVQATTPLDPRVLDAMLPYLVNYYGNPHSRTHAYGWESEAA
FT                   MERARQQVASLIGADPREIIFTSGATESNNIAIKGVARFYRSRKKHLVTTQTEHKCVLD
FT                   SCRSLEAEGFRVTYLPVQKSGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGQ
FT                   ICSSRKVYFHTDAAQAVGKIPLDVNDMKIDLMSISGHKLYGPKGVGAIYIRRRPRVRVE
FT                   ALQSGGGQERGMRSGTVPTPLVVGLGAACELAQQEMEYDHKRISKLAERLVQNIMKNLP
FT                   DVVMNGDPKQHYPGCINLSFAYVEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGT
FT                   DEDLAHSSIRFGIGRFTTEEEVDYTAEKCIHHVKRLREMSPLWEMVQDGIDLKSIKWTQ
FT                   H"
FT   assembly_gap    4816366..4816566
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    4820884..4821070
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4832033..4832488,4833613..4833704,
FT                   4834266..>4834426))
FT                   /gene="Nfs1"
FT                   /locus_tag="mCG_5229"
FT                   /product="nitrogen fixation gene 1 (S. cerevisiae),
FT                   transcript variant mCT172520"
FT                   /note="gene_id=mCG5229.1 transcript_id=mCT172520.0 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(4832255..4832488,4833613..4833704,
FT                   4834266..>4834425))
FT                   /codon_start=1
FT                   /gene="Nfs1"
FT                   /locus_tag="mCG_5229"
FT                   /product="nitrogen fixation gene 1 (S. cerevisiae), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5229.1 transcript_id=mCT172520.0
FT                   protein_id=mCP95439.0 isoform=CRA_a"
FT                   /protein_id="EDL06178.1"
FT                   /translation="LPGAWAEDLQAPRMVGSVAGNMLLRAAWRRASLAATSLALGRSSV
FT                   PTRGLRLRVVDHGPHSPVHSEAEAVLRPLYMDVQATTPLDPRVLDAMLPYLVNYYGNPH
FT                   SRTHAYGWESEAAMERARQVSTKDCEEFQSVVYVTYFFLTDGNSCFSRRDSGSSSGI"
FT   gene            4834392..4836039
FT                   /locus_tag="mCG_5233"
FT                   /note="gene_id=mCG5233.1"
FT   mRNA            join(4834392..4834526,4834705..4834835,4835848..4836039)
FT                   /locus_tag="mCG_5233"
FT                   /product="mCG5233, transcript variant mCT3753"
FT                   /note="gene_id=mCG5233.1 transcript_id=mCT3753.1 created on
FT                   28-AUG-2002"
FT   mRNA            join(4834491..4834526,4834691..4834835,4835848..4836025)
FT                   /locus_tag="mCG_5233"
FT                   /product="mCG5233, transcript variant mCT172523"
FT                   /note="gene_id=mCG5233.1 transcript_id=mCT172523.0 created
FT                   on 28-AUG-2002"
FT   mRNA            join(4834533..4834835,4835848..4836039)
FT                   /locus_tag="mCG_5233"
FT                   /product="mCG5233, transcript variant mCT172522"
FT                   /note="gene_id=mCG5233.1 transcript_id=mCT172522.0 created
FT                   on 28-AUG-2002"
FT   CDS             join(4834705..4834835,4835848..4835956)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5233"
FT                   /product="mCG5233, isoform CRA_a"
FT                   /note="gene_id=mCG5233.1 transcript_id=mCT172522.0
FT                   protein_id=mCP95441.0 isoform=CRA_a"
FT                   /protein_id="EDL06180.1"
FT                   /translation="MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRI
FT                   GMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC"
FT   CDS             join(4834705..4834835,4835848..4835956)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5233"
FT                   /product="mCG5233, isoform CRA_a"
FT                   /note="gene_id=mCG5233.1 transcript_id=mCT172523.0
FT                   protein_id=mCP95442.0 isoform=CRA_a"
FT                   /protein_id="EDL06181.1"
FT                   /translation="MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRI
FT                   GMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC"
FT   CDS             join(4834705..4834835,4835848..4835956)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5233"
FT                   /product="mCG5233, isoform CRA_a"
FT                   /note="gene_id=mCG5233.1 transcript_id=mCT3753.1
FT                   protein_id=mCP23017.1 isoform=CRA_a"
FT                   /protein_id="EDL06182.1"
FT                   /translation="MPVAVGPYGQSQPSCFDRVKMGFVMGCAVGMAAGALFGTFSCLRI
FT                   GMRGRELMGGIGKTMMQSGGTFGTFMAIGMGIRC"
FT   gene            complement(4837488..4870303)
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /note="gene_id=mCG5242.1"
FT   mRNA            complement(join(4837488..4838437,4838531..4838609,
FT                   4839482..4839587,4840981..4841062,4844485..4844535,
FT                   4848654..4848731,4849291..4849495,4851822..4851887,
FT                   4852082..4852219,4852983..4853135,4855060..4855177,
FT                   4857792..4857845,4857939..4858004,4862934..4863128,
FT                   4867443..4867492,4869284..4869347,4869994..4870303))
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /product="RNA binding motif protein 39, transcript variant
FT                   mCT3743"
FT                   /note="gene_id=mCG5242.1 transcript_id=mCT3743.2 created on
FT                   25-SEP-2002"
FT   mRNA            complement(join(4837494..4838437,4838531..4838609,
FT                   4839482..4839587,4840981..4841062,4844485..4844517,
FT                   4848654..4848731,4849291..4849495,4851822..4851887,
FT                   4852082..4852219,4852983..4853135,4855060..4855177,
FT                   4857792..4857845,4857939..4858004,4862934..4863128,
FT                   4867443..>4867515))
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /product="RNA binding motif protein 39, transcript variant
FT                   mCT173584"
FT                   /note="gene_id=mCG5242.1 transcript_id=mCT173584.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4838337..4838437,4838531..4838609,
FT                   4839482..4839587,4840981..4841062,4844485..4844535,
FT                   4848654..4848731,4849291..4849495,4851822..4851887,
FT                   4852082..4852219,4852983..4853135,4855060..4855177,
FT                   4857792..4857845,4857939..4858004,4862934..4863128,
FT                   4867443..4867492,4869284..4869334))
FT                   /codon_start=1
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /product="RNA binding motif protein 39, isoform CRA_b"
FT                   /note="gene_id=mCG5242.1 transcript_id=mCT3743.2
FT                   protein_id=mCP23022.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q8VH51"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR006509"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR029123"
FT                   /db_xref="MGI:MGI:2157953"
FT                   /db_xref="PDB:2LQ5"
FT                   /db_xref="PDB:3S6E"
FT                   /db_xref="PDB:4J5O"
FT                   /db_xref="PDB:4RU2"
FT                   /db_xref="PDB:5CXT"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VH51"
FT                   /protein_id="EDL06184.1"
FT                   /translation="MADDIDIEAMLEAPYKKDENKLNSANGHEERSKKRKKSKSRSRSH
FT                   ERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRRFRGRYRSPYSGPKF
FT                   NSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAAR
FT                   IRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVP
FT                   IIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQL
FT                   MMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLD
FT                   SDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDL
FT                   QTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHG
FT                   GVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPD
FT                   SMTATQLLVPSRR"
FT   CDS             complement(join(4838337..4838437,4838531..4838609,
FT                   4839482..4839587,4840981..4841062,4844485..4844517,
FT                   4848654..4848731,4849291..4849495,4851822..4851887,
FT                   4852082..4852219,4852983..4853135,4855060..4855177,
FT                   4857792..4857845,4857939..4858004,4862934..4863128,
FT                   4867443..>4867492))
FT                   /codon_start=1
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /product="RNA binding motif protein 39, isoform CRA_d"
FT                   /note="gene_id=mCG5242.1 transcript_id=mCT173584.0
FT                   protein_id=mCP96503.0 isoform=CRA_d"
FT                   /protein_id="EDL06186.1"
FT                   /translation="DENKLNSANGHEERSKKRKKSKSRSRSHERKRSKSKERKRSRDRE
FT                   RKKSKSRERKRSRSKERRRSRSRSRDRRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKLS
FT                   RRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVR
FT                   DVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMA
FT                   NNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITF
FT                   SDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDLGTTGRL
FT                   QLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVADLQTRLSQQTEASALAAAASVQPLA
FT                   TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSI
FT                   AAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR"
FT   assembly_gap    4862397..4862416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4862762..4863128,4867443..4867492,
FT                   4867809..4868013,4868987..4869059,4869284..4869347,
FT                   4869994..>4870258))
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /product="RNA binding motif protein 39, transcript variant
FT                   mCT172530"
FT                   /note="gene_id=mCG5242.1 transcript_id=mCT172530.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4862933..4863128,4867443..4867492,
FT                   4867809..>4867865))
FT                   /codon_start=1
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /product="RNA binding motif protein 39, isoform CRA_c"
FT                   /note="gene_id=mCG5242.1 transcript_id=mCT172530.0
FT                   protein_id=mCP95449.0 isoform=CRA_c"
FT                   /protein_id="EDL06185.1"
FT                   /translation="SHGTDKRDNSTWNKTQNDFDENKLNSANGHEERSKKRKKSKSRSR
FT                   SHERKRSKSKERKRSRDRERKKSKSRERKRSRSKERRRSRSRSRDRRFRGRYRSP"
FT   mRNA            complement(join(4868666..4869347,4869994..>4870295))
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /product="RNA binding motif protein 39, transcript variant
FT                   mCT172531"
FT                   /note="gene_id=mCG5242.1 transcript_id=mCT172531.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(4869257..4869347,4869994..>4870148))
FT                   /codon_start=1
FT                   /gene="Rbm39"
FT                   /locus_tag="mCG_5242"
FT                   /product="RNA binding motif protein 39, isoform CRA_a"
FT                   /note="gene_id=mCG5242.1 transcript_id=mCT172531.0
FT                   protein_id=mCP95450.0 isoform=CRA_a"
FT                   /protein_id="EDL06183.1"
FT                   /translation="IRLGLDALGARYSGWAVPRPGPSGLTVATAAAAAAAAADFPWRAQ
FT                   ARGSPHRRVEKMADDIDIEAMLEAPYKKVRKHASEL"
FT   assembly_gap    4882981..4883003
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            4886677..5000932
FT                   /locus_tag="mCG_5243"
FT                   /note="gene_id=mCG5243.2"
FT   mRNA            join(4886677..4886833,4913797..4913911,4942758..4942929,
FT                   4945206..4945290,4955271..4955350,4958145..4958532,
FT                   4963540..4963653,4964681..4964869,4967472..4967651,
FT                   4978784..4979062,4983449..4983547,4984397..4984561,
FT                   4985080..4985258,4987632..4987731,4989504..4989699,
FT                   4993766..4994162,4995614..4995797,4998277..4999999)
FT                   /locus_tag="mCG_5243"
FT                   /product="mCG5243, transcript variant mCT3738"
FT                   /note="gene_id=mCG5243.2 transcript_id=mCT3738.2 created on
FT                   28-AUG-2002"
FT   mRNA            join(<4886768..4886833,4942758..4942929,4945206..4945290,
FT                   4955271..4955350,4958145..4958532,4963540..4963653,
FT                   4964681..4964869,4967472..4967651,4978784..4979062,
FT                   4983449..4983547,4984397..4984561,4985080..4985258,
FT                   4987632..4987731,4989504..4989699,4993766..4994162,
FT                   4995614..4995797,4998277..5000932)
FT                   /locus_tag="mCG_5243"
FT                   /product="mCG5243, transcript variant mCT189867"
FT                   /note="gene_id=mCG5243.2 transcript_id=mCT189867.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4886769..4886833,4942758..4942929,4945206..4945290,
FT                   4955271..4955350,4958145..4958532,4963540..4963653,
FT                   4964681..4964869,4967472..4967651,4978784..4979062,
FT                   4983449..4983547,4984397..4984561,4985080..4985258,
FT                   4987632..4987731,4989504..4989699,4993766..4994162,
FT                   4995614..4995797,4998277..4998419)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5243"
FT                   /product="mCG5243, isoform CRA_a"
FT                   /note="gene_id=mCG5243.2 transcript_id=mCT189867.0
FT                   protein_id=mCP110894.0 isoform=CRA_a"
FT                   /protein_id="EDL06187.1"
FT                   /translation="CAARTVLLSVGLERRSRSGAVRYPAHIEDIDYEEGRVLIHFKRWN
FT                   HRYDEWFCWDSPYLRPLEKIQLRKEGLHDEDGSSEFQINQQVLACWSDCRFYPARVTAV
FT                   NKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARPKETDHKSLSSSPEKREKFKEQ
FT                   RKVTVNVKKDKVEKALKTEKRPKQPDKEGKLICSEKGKVSEKSLPKNEKEDKENISENE
FT                   REYSGDAQVEKKPEKDLVKNPQENLKEPKRKRGRPPSITPTAVDSNSQTLQPITLELRR
FT                   RKISKRSDTPLKRPRLDKNSPQEQSKKRSENSDKDLSRRRSSRLSTNGTREILDPDSIV
FT                   PDLVHTVDTNPLPDKSPSAKDSAEGQLKSPLEAGQVSSALTCHPIGDGLGAADLELNCK
FT                   SMGENTMKTEPVSPLAEVQEVSTVEVPNTLKKVDDSVTLNVPAVDLDHKFRCKVLDCLK
FT                   FFRKAKLLHYHMKYFHGMEKSPEPEEGPGKTHVQTRGSAVPDKTSQESLTRKRVSASSP
FT                   TAKEKEKTKEKKFKELVRVKPKKKKKKKKKTKPECPCSEDISDTSQEPSPPKTFAVTRC
FT                   GSSHKPGVHMSPQLHGSDNGNHKGKLKTCEEDNLSESSSESFLWSDEEYGQDVDVTTNP
FT                   DEELEGDDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEKYTCYVC
FT                   QDPPGQRPGFKYWYDKEWLSRGHMHGLAFLDQNYSHQNARKIVATHQLLGDVQRVIQVL
FT                   HGLQLKMSILQSREHPDLQLWCQPWKQHSGEGRAHPRHIHITDARSEESPSYRTLNGAV
FT                   EKPSPLPRSVEESYITSEHCYQKPRAYYPAVEQRLVVETRGSALDAAVSPLCENGDDSL
FT                   SPRLGWPIDQDRSRGDIDPKPSSPKVREYISKNVLPEETPARKLLDRGGEGLVSSQHQW
FT                   QFNLLTHVESLQDEVTHRMDSIEKELDVLESWLDYTGELEPPEPLARLPQLKHCIKQLL
FT                   TDLGKVQQIALCCST"
FT   assembly_gap    4893769..4894127
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    4895726..4896160
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    4899950..4900411
FT                   /estimated_length=462
FT                   /gap_type="unknown"
FT   assembly_gap    4901809..4905342
FT                   /estimated_length=3534
FT                   /gap_type="unknown"
FT   assembly_gap    4912605..4913289
FT                   /estimated_length=685
FT                   /gap_type="unknown"
FT   CDS             join(4913829..4913911,4942758..4942929,4945206..4945290,
FT                   4955271..4955350,4958145..4958532,4963540..4963653,
FT                   4964681..4964869,4967472..4967651,4978784..4979062,
FT                   4983449..4983547,4984397..4984561,4985080..4985258,
FT                   4987632..4987731,4989504..4989699,4993766..4994162,
FT                   4995614..4995797,4998277..4998419)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5243"
FT                   /product="mCG5243, isoform CRA_b"
FT                   /note="gene_id=mCG5243.2 transcript_id=mCT3738.2
FT                   protein_id=mCP22960.2 isoform=CRA_b"
FT                   /protein_id="EDL06188.1"
FT                   /translation="MTKHPPNRRGISFEVGAQLEARDRLKNWYPAHIEDIDYEEGRVLI
FT                   HFKRWNHRYDEWFCWDSPYLRPLEKIQLRKEGLHDEDGSSEFQINQQVLACWSDCRFYP
FT                   ARVTAVNKDGTYTVKFYDGVVQTVKHIHVKAFSKDQNIVGNARPKETDHKSLSSSPEKR
FT                   EKFKEQRKVTVNVKKDKVEKALKTEKRPKQPDKEGKLICSEKGKVSEKSLPKNEKEDKE
FT                   NISENEREYSGDAQVEKKPEKDLVKNPQENLKEPKRKRGRPPSITPTAVDSNSQTLQPI
FT                   TLELRRRKISKRSDTPLKRPRLDKNSPQEQSKKRSENSDKDLSRRRSSRLSTNGTREIL
FT                   DPDSIVPDLVHTVDTNPLPDKSPSAKDSAEGQLKSPLEAGQVSSALTCHPIGDGLGAAD
FT                   LELNCKSMGENTMKTEPVSPLAEVQEVSTVEVPNTLKKVDDSVTLNVPAVDLDHKFRCK
FT                   VLDCLKFFRKAKLLHYHMKYFHGMEKSPEPEEGPGKTHVQTRGSAVPDKTSQESLTRKR
FT                   VSASSPTAKEKEKTKEKKFKELVRVKPKKKKKKKKKTKPECPCSEDISDTSQEPSPPKT
FT                   FAVTRCGSSHKPGVHMSPQLHGSDNGNHKGKLKTCEEDNLSESSSESFLWSDEEYGQDV
FT                   DVTTNPDEELEGDDRYDFEVVRCICEVQEENDFMIQCEECQCWQHGVCMGLLEENVPEK
FT                   YTCYVCQDPPGQRPGFKYWYDKEWLSRGHMHGLAFLDQNYSHQNARKIVATHQLLGDVQ
FT                   RVIQVLHGLQLKMSILQSREHPDLQLWCQPWKQHSGEGRAHPRHIHITDARSEESPSYR
FT                   TLNGAVEKPSPLPRSVEESYITSEHCYQKPRAYYPAVEQRLVVETRGSALDAAVSPLCE
FT                   NGDDSLSPRLGWPIDQDRSRGDIDPKPSSPKVREYISKNVLPEETPARKLLDRGGEGLV
FT                   SSQHQWQFNLLTHVESLQDEVTHRMDSIEKELDVLESWLDYTGELEPPEPLARLPQLKH
FT                   CIKQLLTDLGKVQQIALCCST"
FT   assembly_gap    4927936..4927955
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4965762..4967030
FT                   /estimated_length=1269
FT                   /gap_type="unknown"
FT   gene            complement(5002840..5003667)
FT                   /gene="Scand1"
FT                   /locus_tag="mCG_5214"
FT                   /note="gene_id=mCG5214.2"
FT   mRNA            complement(join(5002840..5003385,5003485..5003667))
FT                   /gene="Scand1"
FT                   /locus_tag="mCG_5214"
FT                   /product="SCAN domain-containing 1"
FT                   /note="gene_id=mCG5214.2 transcript_id=mCT3773.2 created on
FT                   28-AUG-2002"
FT   CDS             complement(5002903..5003331)
FT                   /codon_start=1
FT                   /gene="Scand1"
FT                   /locus_tag="mCG_5214"
FT                   /product="SCAN domain-containing 1"
FT                   /note="gene_id=mCG5214.2 transcript_id=mCT3773.2
FT                   protein_id=mCP23024.1"
FT                   /db_xref="GOA:Q2M4I6"
FT                   /db_xref="InterPro:IPR003309"
FT                   /db_xref="InterPro:IPR008916"
FT                   /db_xref="MGI:MGI:1343132"
FT                   /db_xref="UniProtKB/TrEMBL:Q2M4I6"
FT                   /protein_id="EDL06189.1"
FT                   /translation="MAAPQPSQDPQSPAAPPEQQEGAGDCAAPSPDSGSSPAPELPGAP
FT                   AALNTAPYADAALRPGASRPGPETFRQRFRQFRYQDAAGPREAFRQLRELSRQWLRPDI
FT                   RTKEQIVEMLVQEQLQAILPEAARARRLRRRADVRITG"
FT   gene            5003431..5066535
FT                   /locus_tag="mCG_5230"
FT                   /note="gene_id=mCG5230.3"
FT   mRNA            join(5003431..5003782,5011116..5011169,5019448..5019585,
FT                   5024703..5024756,5026380..5026543,5029709..5029865,
FT                   5030265..5030416,5032736..5032874,5044320..5044434,
FT                   5056010..5056187,5058449..5058569,5064538..5064701,
FT                   5066194..5066534)
FT                   /locus_tag="mCG_5230"
FT                   /product="mCG5230, transcript variant mCT3751"
FT                   /note="gene_id=mCG5230.3 transcript_id=mCT3751.3 created on
FT                   28-APR-2003"
FT   CDS             join(5003516..5003782,5011116..5011169,5019448..5019585,
FT                   5024703..5024756,5026380..5026543,5029709..5029865,
FT                   5030265..5030416,5032736..5032874,5044320..5044434,
FT                   5056010..5056187,5058449..5058569,5064538..5064701,
FT                   5066194..5066512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5230"
FT                   /product="mCG5230, isoform CRA_b"
FT                   /note="gene_id=mCG5230.3 transcript_id=mCT3751.3
FT                   protein_id=mCP22959.3 isoform=CRA_b"
FT                   /protein_id="EDL06191.1"
FT                   /translation="MNRSANPEAASSTSHVKFDLGKSVDISSTDTKDGGTARSPLEPAD
FT                   KSDTTESKSESGSDSRSEEDKESPASIKEIKAETPQPKDRPGVQIKLSWSQKIKSWTAK
FT                   KKRKLYQLVIDIIMMNRVCKMFRQGLRGFREYQIIEPVHKKHPDFSFWDKKKQGRISFV
FT                   TEDFAAQEGHFPPRAISITQKKPSWRTHQEIQDLCNILQALDCYRSYTESLQLLLAKVI
FT                   RFERFGRRRVIVKKGQMGNSFYFIYLGTVAITEDEDGSSAFLDPHPTLLHRGGSFGEMG
FT                   LLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNFFRNLDIFQSWSEE
FT                   KLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILRLVALGDCSAYYKWVWQQ
FT                   LELLDHKPLRIHDNEISPKERFKELQIKSYPLQDFTYLKLLRLQKAREQQGIDFHGKIN
FT                   KVENTLPKLLGPKIKSRFGHLVKCSMVNTKFGELPKEAIVGVYMKIHKTEEGEIVGLHQ
FT                   AFVPEIQRDCRPFILLSLGSELIQVRKEKFYDMVDEETRAKIIKMDVDYPSDEDLCQSF
FT                   LKENDYIVFRKDLLRLLVEPLNKSPFIPVQTKKKEIYNHKSLFLDLCSLEKKVKQHYPI
FT                   FLAPQKYLPPLRVVQAISAPRHKIQELLPQYKNAGVLI"
FT   mRNA            join(<5003616..5003782,5011116..5011169,5019448..5019585,
FT                   5024703..5024756,5026416..5026543,5029709..5029865,
FT                   5030265..5030416,5032736..5032874,5044320..5044434,
FT                   5056010..5056187,5058449..5058569,5064538..5064701,
FT                   5066194..5066535)
FT                   /locus_tag="mCG_5230"
FT                   /product="mCG5230, transcript variant mCT189888"
FT                   /note="gene_id=mCG5230.3 transcript_id=mCT189888.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<5003618..5003782,5011116..5011169,5019448..5019585,
FT                   5024703..5024756,5026416..5026543,5029709..5029865,
FT                   5030265..5030416,5032736..5032874,5044320..5044434,
FT                   5056010..5056187,5058449..5058569,5064538..5064701,
FT                   5066194..5066512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5230"
FT                   /product="mCG5230, isoform CRA_a"
FT                   /note="gene_id=mCG5230.3 transcript_id=mCT189888.0
FT                   protein_id=mCP110893.0 isoform=CRA_a"
FT                   /protein_id="EDL06190.1"
FT                   /translation="GTARSPLEPADKSDTTESKSESGSDSRSEEDKESPASIKEIKAET
FT                   PQPKDRPGVQIKLSWSQKIKSWTAKKKRKLYQLVIDIIMMNRVCKMFRQGLRGFREYQI
FT                   IEPVHKKHPDFSFWDKKKQGRISFVTEDFAAQEKKPSWRTHQEIQDLCNILQALDCYRS
FT                   YTESLQLLLAKVIRFERFGRRRVIVKKGQMGNSFYFIYLGTVAITEDEDGSSAFLDPHP
FT                   TLLHRGGSFGEMGLLSTTVRSATVVCMEETEFLVVDREDFVANKLGDEVQKETQYRYNF
FT                   FRNLDIFQSWSEEKLWKLVALGRIERFSYGQMVSKDFMNSAFITFICQGNCEILRLVAL
FT                   GDCSAYYKWVWQQLELLDHKPLRIHDNEISPKERFKELQIKSYPLQDFTYLKLLRLQKA
FT                   REQQGIDFHGKINKVENTLPKLLGPKIKSRFGHLVKCSMVNTKFGELPKEAIVGVYMKI
FT                   HKTEEGEIVGLHQAFVPEIQRDCRPFILLSLGSELIQVRKEKFYDMVDEETRAKIIKMD
FT                   VDYPSDEDLCQSFLKENDYIVFRKDLLRLLVEPLNKSPFIPVQTKKKEIYNHKSLFLDL
FT                   CSLEKKVKQHYPIFLAPQKYLPPLRVVQAISAPRHKIQELLPQYKNAGVLI"
FT   assembly_gap    5005107..5005190
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    5010054..5010171
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   gene            5013489..5013838
FT                   /pseudo
FT                   /locus_tag="mCG_5215"
FT                   /note="gene_id=mCG5215.0"
FT   mRNA            5013489..5013838
FT                   /pseudo
FT                   /locus_tag="mCG_5215"
FT                   /note="gene_id=mCG5215.0 transcript_id=mCT3775.0 created on
FT                   28-AUG-2002"
FT   gene            complement(5037791..5039185)
FT                   /locus_tag="mCG_124317"
FT                   /note="gene_id=mCG124317.1"
FT   mRNA            complement(5037791..5039185)
FT                   /locus_tag="mCG_124317"
FT                   /product="mCG124317"
FT                   /note="gene_id=mCG124317.1 transcript_id=mCT125556.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(5038336..5038974)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124317"
FT                   /product="mCG124317"
FT                   /note="gene_id=mCG124317.1 transcript_id=mCT125556.1
FT                   protein_id=mCP73139.0"
FT                   /protein_id="EDL06192.1"
FT                   /translation="MRMTMEEMKNEAEITSMVSMPLYAVMYPVFNELERVNLSAAQTLR
FT                   AAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLN
FT                   EKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQ
FT                   KKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA"
FT   assembly_gap    5045256..5045275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5049616..5049698
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    5066154..5066173
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<5068824..>5069867)
FT                   /locus_tag="mCG_140971"
FT                   /note="gene_id=mCG140971.0"
FT   mRNA            complement(join(<5068824..5068868,5069155..5069335,
FT                   5069763..>5069867))
FT                   /locus_tag="mCG_140971"
FT                   /product="mCG140971"
FT                   /note="gene_id=mCG140971.0 transcript_id=mCT172490.0
FT                   created on 28-AUG-2002"
FT   CDS             complement(join(<5068824..5068868,5069155..>5069263))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140971"
FT                   /product="mCG140971"
FT                   /note="gene_id=mCG140971.0 transcript_id=mCT172490.0
FT                   protein_id=mCP95409.0"
FT                   /protein_id="EDL06193.1"
FT                   /translation="PHGSSLLAVERTPTSADFFSLNPCDCSGDSENCIPLYCCRRECVE
FT                   EHSGSF"
FT   gene            5077641..5078120
FT                   /pseudo
FT                   /locus_tag="mCG_1027905"
FT                   /note="gene_id=mCG1027905.1"
FT   mRNA            5077641..5078120
FT                   /pseudo
FT                   /locus_tag="mCG_1027905"
FT                   /note="gene_id=mCG1027905.1 transcript_id=mCT145609.1
FT                   created on 28-AUG-2002"
FT   assembly_gap    5081869..5083272
FT                   /estimated_length=1404
FT                   /gap_type="unknown"
FT   assembly_gap    5088660..5088679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5097096..5097449
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   gene            complement(5102201..5102553)
FT                   /locus_tag="mCG_5220"
FT                   /note="gene_id=mCG5220.2"
FT   mRNA            complement(5102201..5102553)
FT                   /locus_tag="mCG_5220"
FT                   /product="mCG5220"
FT                   /note="gene_id=mCG5220.2 transcript_id=mCT3766.2 created on
FT                   28-AUG-2002"
FT   CDS             complement(5102262..5102540)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5220"
FT                   /product="mCG5220"
FT                   /note="gene_id=mCG5220.2 transcript_id=mCT3766.2
FT                   protein_id=mCP22982.1"
FT                   /db_xref="GOA:Q4VAF2"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="MGI:MGI:98068"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAF2"
FT                   /protein_id="EDL06194.1"
FT                   /translation="MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKT
FT                   KMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ"
FT   assembly_gap    5103118..5103359
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   gene            <5112537..5232063
FT                   /gene="Epb4.1l1"
FT                   /locus_tag="mCG_5224"
FT                   /note="gene_id=mCG5224.4"
FT   mRNA            join(<5112537..5112754,5130014..5130062,5185515..5185705,
FT                   5186568..5186732,5187471..5187575,5188097..5188139,
FT                   5191198..5191273,5195256..5195474,5197377..5197464,
FT                   5197962..5198114,5200424..5200521,5200743..5200918,
FT                   5202347..5202492,5203396..5203431,5205693..5205875,
FT                   5212515..>5213488)
FT                   /gene="Epb4.1l1"
FT                   /locus_tag="mCG_5224"
FT                   /product="erythrocyte protein band 4.1-like 1, transcript
FT                   variant mCT189862"
FT                   /note="gene_id=mCG5224.4 transcript_id=mCT189862.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(5112551..5112754,5185515..5185705,5186568..5186732,
FT                   5187471..5187575,5188097..5188139,5191198..5191273,
FT                   5195256..5195474,5197377..5197464,5197962..5198114,
FT                   5200424..5200521,5200743..5200918,5202344..5202492,
FT                   5203396..5203431,5205693..5205875,5216122..5216529,
FT                   5218130..5218234,5220631..5220711,5225022..5225108,
FT                   5225929..5226012,5228223..5228303,5228610..5228726,
FT                   5231053..5232033)
FT                   /gene="Epb4.1l1"
FT                   /locus_tag="mCG_5224"
FT                   /product="erythrocyte protein band 4.1-like 1, transcript
FT                   variant mCT3759"
FT                   /note="gene_id=mCG5224.4 transcript_id=mCT3759.2 created on
FT                   25-SEP-2002"
FT   mRNA            join(5112567..5112754,5130014..5130062,5185515..5185705,
FT                   5186568..5186732,5187471..5187575,5188097..5188139,
FT                   5191198..5191273,5195256..5195474,5197377..5197464,
FT                   5197962..5198114,5200424..5200521,5200743..5200918,
FT                   5202344..5202492,5205693..5205875,5216122..5216529,
FT                   5218130..5218234,5220631..5220711,5225022..5225108,
FT                   5225929..5226012,5228223..5228303,5228610..5228726,
FT                   5231053..5232063)
FT                   /gene="Epb4.1l1"
FT                   /locus_tag="mCG_5224"
FT                   /product="erythrocyte protein band 4.1-like 1, transcript
FT                   variant mCT173583"
FT                   /note="gene_id=mCG5224.4 transcript_id=mCT173583.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(<5130026..5130062,5185515..5185705,5186568..5186732,
FT                   5187471..5187575,5188097..5188139,5191198..5191273,
FT                   5195256..5195474,5197377..5197464,5197962..5198114,
FT                   5200424..5200521,5200743..5200918,5202347..5202492,
FT                   5203396..5203431,5205693..5205875,5212515..>5213488)
FT                   /codon_start=1
FT                   /gene="Epb4.1l1"
FT                   /locus_tag="mCG_5224"
FT                   /product="erythrocyte protein band 4.1-like 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG5224.4 transcript_id=mCT189862.0
FT                   protein_id=mCP110889.0 isoform=CRA_b"
FT                   /protein_id="EDL06196.1"
FT                   /translation="GRPPQGAGVPRRGVLVTMTTETGPDSEVKKAQEETPQQPEAAAAV
FT                   TTPVTPAGHSHPETNSNEKHLTQQDTRPAEQSLDMDDKDYSEADGLSERTTPSKAQKSP
FT                   QKIAKKFKSAICRVTLLDASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTYCDAD
FT                   SQKNWLDPSKEIKKQIRSSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRL
FT                   PCSFVTHALLGSYAVQAELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGM
FT                   TPGEAEIHFLENAKKLSMYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPK
FT                   ILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPP
FT                   PKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFFERSSSKRYTMSRSLDGEFSRPASV
FT                   SENHDAGPDGDKREDDAESGGRRSEAEEGEVRTPTKIKELKPEQETTPRHKQEFLDKPE
FT                   DVLLKHQASINELKRTLKEPNSKLIHRDRDWDRERRLPSSPASPSPKGTPEKASEGSEH
FT                   WVLIERVYTRPEDLGLLTVPATQREESGSSLTEILADGRLSKVDILVDKFKVEVATEET
FT                   VRAQRTSTQQQGKMIASPEGSETMREEDACLRGGPRDATRAAGYTSTDKLKLRNTRVSN
FT                   GQTESHVELNKGLERPQTWGRLTAAGVGPVQGEVLSPASDKGGLQSFLLDPAQTEARAD
FT                   SSDETDTSFAERSFCLNYGKKDSEDSLLAPSLGDREEHLDAPPGDGTWLELAGAHTENW
FT                   EPKSSDPRASAPGSSQNKDEAHMASSAEEAWSPRDRGRPDDLQGSAVCQTLEEGWENTQ
FT                   GLEGELAYPVADVAEDEAPTSIDWMG"
FT   gene            complement(<5136462..>5139323)
FT                   /locus_tag="mCG_140979"
FT                   /note="gene_id=mCG140979.0"
FT   mRNA            complement(join(<5136462..5136893,5139222..>5139323))
FT                   /locus_tag="mCG_140979"
FT                   /product="mCG140979"
FT                   /note="gene_id=mCG140979.0 transcript_id=mCT172513.0
FT                   created on 28-AUG-2002"
FT   CDS             complement(<5136462..>5136703)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140979"
FT                   /product="mCG140979"
FT                   /note="gene_id=mCG140979.0 transcript_id=mCT172513.0
FT                   protein_id=mCP95432.0"
FT                   /protein_id="EDL06198.1"
FT                   /translation="TLKRTQLGGWGQSTVHQAGHGAVLSVRQAQLAVFLLGSSCLAFPR
FT                   SGLPHGHPQLSGAPPSTKHIISVVCQSLWTTGRKRR"
FT   assembly_gap    5137847..5138108
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    5158752..5158771
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5164566..5164585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5166217..5166236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5167393..5167549
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   CDS             join(5185529..5185705,5186568..5186732,5187471..5187575,
FT                   5188097..5188139,5191198..5191273,5195256..5195474,
FT                   5197377..5197464,5197962..5198114,5200424..5200521,
FT                   5200743..5200918,5202344..5202492,5203396..5203431,
FT                   5205693..5205875,5216122..5216529,5218130..5218234,
FT                   5220631..5220711,5225022..5225108,5225929..5226012,
FT                   5228223..5228303,5228610..5228726,5231053..5231061)
FT                   /codon_start=1
FT                   /gene="Epb4.1l1"
FT                   /locus_tag="mCG_5224"
FT                   /product="erythrocyte protein band 4.1-like 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG5224.4 transcript_id=mCT3759.2
FT                   protein_id=mCP22983.2 isoform=CRA_c"
FT                   /db_xref="GOA:A2AUK5"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR007477"
FT                   /db_xref="InterPro:IPR008379"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR014847"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:103010"
FT                   /db_xref="UniProtKB/TrEMBL:A2AUK5"
FT                   /protein_id="EDL06197.1"
FT                   /translation="MTTETGPDSEVKKAQEETPQQPEAAAAVTTPVTPAGHSHPETNSN
FT                   EKHLTQQDTRPAEQSLDMDDKDYSEADGLSERTTPSKAQKSPQKIAKKFKSAICRVTLL
FT                   DASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTYCDADSQKNWLDPSKEIKKQIR
FT                   SSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQA
FT                   ELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLS
FT                   MYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRP
FT                   GEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRT
FT                   QAQTRQASALIDRPAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKREDD
FT                   AESGGRRSEAEEGEVRTPTKIKELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRT
FT                   LKEPNSKLIHRDRDWDRERRLPSSPASPSPKGTPEKASERAGLREGSEEKVKPPRPRAP
FT                   ESDTGDEDQDQERDAVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHGGAFED
FT                   FSRSLPELDRDKSDSETEGLVFARDLKGPSSQEDESGGLEDSPDRGACSTPEMPQFESV
FT                   KAETMTVSSLAIRKKIEPEAMLQSRVSAADSTQVDGGTPMVKDFMTTPPCITTETISTT
FT                   MENSLKSGKGAAAMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKT
FT                   VKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPEE
FT                   RDKKPQES"
FT   CDS             join(5185529..5185705,5186568..5186732,5187471..5187575,
FT                   5188097..5188139,5191198..5191273,5195256..5195474,
FT                   5197377..5197464,5197962..5198114,5200424..5200521,
FT                   5200743..5200918,5202344..5202492,5205693..5205875,
FT                   5216122..5216529,5218130..5218234,5220631..5220711,
FT                   5225022..5225108,5225929..5226012,5228223..5228303,
FT                   5228610..5228726,5231053..5231061)
FT                   /codon_start=1
FT                   /gene="Epb4.1l1"
FT                   /locus_tag="mCG_5224"
FT                   /product="erythrocyte protein band 4.1-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5224.4 transcript_id=mCT173583.0
FT                   protein_id=mCP96502.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AUK8"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000798"
FT                   /db_xref="InterPro:IPR007477"
FT                   /db_xref="InterPro:IPR008379"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR014847"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:103010"
FT                   /db_xref="UniProtKB/TrEMBL:A2AUK8"
FT                   /protein_id="EDL06195.1"
FT                   /translation="MTTETGPDSEVKKAQEETPQQPEAAAAVTTPVTPAGHSHPETNSN
FT                   EKHLTQQDTRPAEQSLDMDDKDYSEADGLSERTTPSKAQKSPQKIAKKFKSAICRVTLL
FT                   DASEYECEVEKHGRGQVLFDLVCEHLNLLEKDYFGLTYCDADSQKNWLDPSKEIKKQIR
FT                   SSPWNFAFTVKFYPPDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQA
FT                   ELGDYDAEEHVGNYVSELRFAPNQTRELEERIMELHKTYRGMTPGEAEIHFLENAKKLS
FT                   MYGVDLHHAKDSEGIDIMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRP
FT                   GEYEQFESTIGFKLPNHRSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRT
FT                   QAQTRQASALIDRPAPFFERSSSKRYTMSRSLDGAEFSRPASVSENHDAGPDGDKREDD
FT                   AESGGRRSEAEEGEVRTPTKIKELKFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRD
FT                   RDWDRERRLPSSPASPSPKGTPEKASERAGLREGSEEKVKPPRPRAPESDTGDEDQDQE
FT                   RDAVFLKDNHLAIERKCSSITVSSTSSLEAEVDFTVIGDYHGGAFEDFSRSLPELDRDK
FT                   SDSETEGLVFARDLKGPSSQEDESGGLEDSPDRGACSTPEMPQFESVKAETMTVSSLAI
FT                   RKKIEPEAMLQSRVSAADSTQVDGGTPMVKDFMTTPPCITTETISTTMENSLKSGKGAA
FT                   AMIPGPQTVATEIRSLSPIIGKDVLTSTYGATAETLSTSTTTHVTKTVKGGFSETRIEK
FT                   RIIITGDEDVDQDQALALAIKEAKLQHPDMLVTKAVVYRETDPSPEERDKKPQES"
FT   assembly_gap    5204447..5204466
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5207594..5207613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5208976..5209281
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    5235538..5235557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5238730..5259222
FT                   /gene="0610011L14Rik"
FT                   /locus_tag="mCG_5236"
FT                   /note="gene_id=mCG5236.1"
FT   mRNA            join(5238730..5239057,5241823..5242623,5246963..5247192,
FT                   5257927..5259222)
FT                   /gene="0610011L14Rik"
FT                   /locus_tag="mCG_5236"
FT                   /product="RIKEN cDNA 0610011L14, transcript variant
FT                   mCT3747"
FT                   /note="gene_id=mCG5236.1 transcript_id=mCT3747.2 created on
FT                   28-AUG-2002"
FT   mRNA            join(<5238784..5238798,5241823..5241926,5258672..5258873)
FT                   /gene="0610011L14Rik"
FT                   /locus_tag="mCG_5236"
FT                   /product="RIKEN cDNA 0610011L14, transcript variant
FT                   mCT172528"
FT                   /note="gene_id=mCG5236.1 transcript_id=mCT172528.0 created
FT                   on 28-AUG-2002"
FT   CDS             join(<5238786..5238798,5241823..5241926,5258672..5258764)
FT                   /codon_start=1
FT                   /gene="0610011L14Rik"
FT                   /locus_tag="mCG_5236"
FT                   /product="RIKEN cDNA 0610011L14, isoform CRA_b"
FT                   /note="gene_id=mCG5236.1 transcript_id=mCT172528.0
FT                   protein_id=mCP95447.0 isoform=CRA_b"
FT                   /protein_id="EDL06200.1"
FT                   /translation="LRCYGDRKEPCFWLPSTGFMSSMQMDPELAKQLFFEGATPQWLIP
FT                   ESAADCGVSCYCHRHPEASLCSRM"
FT   CDS             join(5241867..5242623,5246963..5247192,5257927..5258094)
FT                   /codon_start=1
FT                   /gene="0610011L14Rik"
FT                   /locus_tag="mCG_5236"
FT                   /product="RIKEN cDNA 0610011L14, isoform CRA_a"
FT                   /note="gene_id=mCG5236.1 transcript_id=mCT3747.2
FT                   protein_id=mCP23014.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D2V5"
FT                   /db_xref="InterPro:IPR007946"
FT                   /db_xref="MGI:MGI:1915545"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D2V5"
FT                   /protein_id="EDL06199.1"
FT                   /translation="MSSMQMDPELAKQLFFEGATVVILNMPKGTEFGIDYNSWEVGPKF
FT                   RGVKMIPPGIHFLYYSSVDKANPREVGPRMGFFLSLKQRGLTVLRWNAVQEEVDLSPAP
FT                   EAEVEAMRANLPDLDQFLGPYPYATLKKWISLTNFISEATMEKLQPESRQICAFSDVLP
FT                   VLFMKHTKDRVGQNLPLCGTECRSYQEGLARLPEMRPRAGTEIRFSELPTQMFPAGATP
FT                   AEITRHSMDLSYALETVLSKQFPGNPQDVLGELQFAFVCFLLGNVYEAFEHWKRLLNLL
FT                   CRSESAMGKYHALYISLISILYHQLGEIPADFFVDIVSQDNFLTSTLQVFFSSACSIAV
FT                   EATLRKKAEKFQAHLTKKFRWDFTSEPEDCAPVVVELPEGIETA"
FT   assembly_gap    5244751..5244770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5250405..5250424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5262853..5268458
FT                   /locus_tag="mCG_147176"
FT                   /note="gene_id=mCG147176.0"
FT   mRNA            join(5262853..5262959,5266367..5268458)
FT                   /locus_tag="mCG_147176"
FT                   /product="mCG147176"
FT                   /note="gene_id=mCG147176.0 transcript_id=mCT187439.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    5266290..5266309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             5266669..5266956
FT                   /codon_start=1
FT                   /locus_tag="mCG_147176"
FT                   /product="mCG147176"
FT                   /note="gene_id=mCG147176.0 transcript_id=mCT187439.0
FT                   protein_id=mCP109236.0"
FT                   /protein_id="EDL06201.1"
FT                   /translation="MHINLHFALPFPSALLHLFPQPCPAQPQGCLSHSGLIFIFFSSSY
FT                   ILSPITLSTLPACPFLSHQGLHTNPVSLHIVHSLRTQSSFWECSLEATAF"
FT   gene            complement(5300163..>5304379)
FT                   /locus_tag="mCG_145066"
FT                   /note="gene_id=mCG145066.0"
FT   mRNA            complement(join(5300163..5302184,5303424..5303531,
FT                   5303900..5304151,5304241..>5304379))
FT                   /locus_tag="mCG_145066"
FT                   /product="mCG145066"
FT                   /note="gene_id=mCG145066.0 transcript_id=mCT184490.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(5300411..>5300791)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145066"
FT                   /product="mCG145066"
FT                   /note="gene_id=mCG145066.0 transcript_id=mCT184490.0
FT                   protein_id=mCP105617.0"
FT                   /protein_id="EDL06202.1"
FT                   /translation="SACCLSIRTSARVSRIHVKSGRGEQGWGIPEACWLASLAKLMSFR
FT                   SRERPCLKKGTWRLTKERPLARHTFIGICTSTHMCMSTPHTNHISPVSLFPSLLPSSPL
FT                   NTTSTTMTTGPRGERSDEELAT"
FT   gene            <5391605..5454829
FT                   /gene="Dlgap4"
FT                   /locus_tag="mCG_5226"
FT                   /note="gene_id=mCG5226.1"
FT   mRNA            join(<5391605..5392600,5395336..5395580,5396782..5396896,
FT                   5398000..5398050,5401758..5401998,5436318..5436679,
FT                   5438814..5438902,5439422..5439834,5451315..5451406,
FT                   5452237..5452392,5453149..5454829)
FT                   /gene="Dlgap4"
FT                   /locus_tag="mCG_5226"
FT                   /product="discs, large homolog-associated protein 4
FT                   (Drosophila)"
FT                   /note="gene_id=mCG5226.1 transcript_id=mCT3757.2 created on
FT                   28-AUG-2002"
FT   CDS             join(5391605..5392600,5395336..5395580,5396782..5396896,
FT                   5398000..5398050,5401758..5401998,5436318..5436679,
FT                   5438814..5438902,5439422..5439834,5451315..5451406,
FT                   5452237..5452392,5453149..5453367)
FT                   /codon_start=1
FT                   /gene="Dlgap4"
FT                   /locus_tag="mCG_5226"
FT                   /product="discs, large homolog-associated protein 4
FT                   (Drosophila)"
FT                   /note="gene_id=mCG5226.1 transcript_id=mCT3757.2
FT                   protein_id=mCP23031.2"
FT                   /protein_id="EDL06203.1"
FT                   /translation="MKGLGDSRPRHLSDSLDPPHEPLFAGPDRNPYLLSPTEAFAREAR
FT                   FPGQNTLPGDGLFPLNNQLPPPSSTFPRIHYNSHFEVPEESPFPSHAQATKINRLPANL
FT                   LDQFEKQLPIHRDGFSTLQFPRGEAKARGESPGRIRHLVHSVQRLFFTKAPSMEGTAGK
FT                   VGGNGSKKGGLEDGKGRRAKSKERAKAGEPKRRSRSNISGWWSSDDNLDGEGGAFRSGP
FT                   ASGLMTLGRQQERTQPRYFMHAYNTISGHMLKTTKNTTTELTAPPPPPAPPATCPSLGV
FT                   GTDTNYVKRGSWSTLTLSHAHEVCQKTSATLDKSLLKSKSCHQGLAYHYLQVPGGGGEW
FT                   STTLLSPRDMDSTAEGPIPCRRMRSGSYIKAMGDEDSDESGGGSPKPSPKTAARRQSYL
FT                   RATQQSLGEQSNPRRSLDRLDSVDMLLPSKCPSWEDDYNPISDSLNDSSCISQVFGQAS
FT                   LIPQLFGHDQQVREADLSDQYEAACESACSEAESTTAEALDLPLPSYFRSRSHSYLRAI
FT                   QAGCSQEEDSVSLQSLSPPPSTGSLSNSRTLPSSSCLVAYKKTPPPVPPRTTSKPFISV
FT                   TVQSSTESAQDTYLDSQDHKSEVTSQSGLSNSSDSLDSSTRPPSVTRGGITPGPEAPEP
FT                   PPKHAALKSEQGTLTSSESHSEAIPKRKLSSIGIQVDCIQPVPKEEPSPATKFQSIGIQ
FT                   VEDDWRSSAPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTSHPNSISIDAGPRQAP
FT                   KIAQIKRNLSYGDNSDPALEASSLPPPDPWLETSSSSPAEPAQPGACRRDGYWFLKLLQ
FT                   AETERLEGWCCQMDKETKENNLSEEVLGKVLSAVGSAQLLMSQKFQQFRGLCEQNLNPD
FT                   ANPRPTAQDLAGFWDLLQLSIEDISMKFDELYHLKANSWQLVETPEKRKEEKKPPPPVP
FT                   KKPAKSKAAVSRDKASDAGDKQRQEARKRLLAAKRAASVRQNSATESADSIEIYVPEAQ
FT                   TRL"
FT   gene            complement(5405274..>5411631)
FT                   /locus_tag="mCG_124321"
FT                   /note="gene_id=mCG124321.1"
FT   mRNA            complement(join(5405274..5405785,5406830..5406980,
FT                   5407622..5407750,5411426..>5411631))
FT                   /locus_tag="mCG_124321"
FT                   /product="mCG124321"
FT                   /note="gene_id=mCG124321.1 transcript_id=mCT125560.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(5406968..5406980,5407622..5407750,
FT                   5411426..>5411631))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124321"
FT                   /product="mCG124321"
FT                   /note="gene_id=mCG124321.1 transcript_id=mCT125560.1
FT                   protein_id=mCP72789.1"
FT                   /protein_id="EDL06204.1"
FT                   /translation="VPRGPRPGRPVLKGSARPRQLAHARVRGSALSNRPAKPVPAGTQC
FT                   VVCTGVGVAVRPCGLTLVATPRCSRWWQSVIRGSVLFLTRHKSTTWTSCSSGQKPGDLV
FT                   APALLGGRIKM"
FT   assembly_gap    5418303..5418322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5461232..5461251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5465884..5471971
FT                   /locus_tag="mCG_5232"
FT                   /note="gene_id=mCG5232.1"
FT   mRNA            join(5465884..5465973,5468832..5469041,5470795..5470956,
FT                   5471303..5471971)
FT                   /locus_tag="mCG_5232"
FT                   /product="mCG5232"
FT                   /note="gene_id=mCG5232.1 transcript_id=mCT3758.1 created on
FT                   05-SEP-2002"
FT   CDS             join(5468858..5469041,5470795..5470956,5471303..5471475)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5232"
FT                   /product="mCG5232"
FT                   /note="gene_id=mCG5232.1 transcript_id=mCT3758.1
FT                   protein_id=mCP23005.1"
FT                   /protein_id="EDL06205.1"
FT                   /translation="MSSKRAKAKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNR
FT                   DGFIDKEDLHDMLASLGKNPTDEYLEGMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIR
FT                   NAFACFDEEASGFIHEDHLRELLTTMGDRFTDEEVDEMYREAPIDKKGNFNYVEFTRIL
FT                   KHGAKDKDD"
FT   gene            complement(5468954..>5471972)
FT                   /locus_tag="mCG_140982"
FT                   /note="gene_id=mCG140982.0"
FT   mRNA            complement(join(5468954..5469035,5470790..5470951,
FT                   5471298..>5471972))
FT                   /locus_tag="mCG_140982"
FT                   /product="mCG140982"
FT                   /note="gene_id=mCG140982.0 transcript_id=mCT172521.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(5469000..5469035,5470790..5470951,
FT                   5471298..>5471420))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140982"
FT                   /product="mCG140982"
FT                   /note="gene_id=mCG140982.0 transcript_id=mCT172521.0
FT                   protein_id=mCP95440.0"
FT                   /protein_id="EDL06206.1"
FT                   /translation="LKLPFLSMGASRYISSTSSSVNRSPMVVSSSLRWSSWMKPEASSS
FT                   KQAKALRITSSGSVPFSFSPNIVRNMVKLMGPGASFIMPSRYSSVGFFPVRPACRAGPP
FT                   YQ"
FT   gene            complement(5480042..5480698)
FT                   /pseudo
FT                   /locus_tag="mCG_48710"
FT                   /note="gene_id=mCG48710.1"
FT   mRNA            complement(5480042..5480698)
FT                   /pseudo
FT                   /locus_tag="mCG_48710"
FT                   /note="gene_id=mCG48710.1 transcript_id=mCT48893.1 created
FT                   on 05-SEP-2002"
FT   gene            5496300..5497080
FT                   /pseudo
FT                   /locus_tag="mCG_1027924"
FT                   /note="gene_id=mCG1027924.0"
FT   mRNA            5496300..5497080
FT                   /pseudo
FT                   /locus_tag="mCG_1027924"
FT                   /note="gene_id=mCG1027924.0 transcript_id=mCT145628.1
FT                   created on 05-SEP-2002"
FT   assembly_gap    5502416..5503226
FT                   /estimated_length=811
FT                   /gap_type="unknown"
FT   assembly_gap    5511833..5512705
FT                   /estimated_length=873
FT                   /gap_type="unknown"
FT   gene            complement(<5523755..5530652)
FT                   /locus_tag="mCG_5223"
FT                   /note="gene_id=mCG5223.2"
FT   mRNA            complement(join(<5523755..5524181,5528588..5528671,
FT                   5529176..5529294,5530293..>5530524))
FT                   /locus_tag="mCG_5223"
FT                   /product="mCG5223, transcript variant mCT3762"
FT                   /note="gene_id=mCG5223.2 transcript_id=mCT3762.3 created on
FT                   25-SEP-2002"
FT   CDS             complement(join(<5523755..5524181,5528588..>5528589))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5223"
FT                   /product="mCG5223, isoform CRA_b"
FT                   /note="gene_id=mCG5223.2 transcript_id=mCT3762.3
FT                   protein_id=mCP23010.2 isoform=CRA_b"
FT                   /protein_id="EDL06208.1"
FT                   /translation="CPAEGSRNREERNWEQLKETYTASDLQVSHQFEVGDTVLVRRHRA
FT                   GNLEPRWKGPSLVLLTTATTLKVEGIPSWVHASHVKRAPPETDRDEWTLEKTNNPLKLR
FT                   LRRKSDSEQRHQPSYSNNHGKCLMRRGTLYGRPPQYNPH"
FT   mRNA            complement(join(5524155..5524181,5528588..5528671,
FT                   5529176..5529294,5530474..5530652))
FT                   /locus_tag="mCG_5223"
FT                   /product="mCG5223, transcript variant mCT172512"
FT                   /note="gene_id=mCG5223.2 transcript_id=mCT172512.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(5529190..5529294,5530474..5530650))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5223"
FT                   /product="mCG5223, isoform CRA_a"
FT                   /note="gene_id=mCG5223.2 transcript_id=mCT172512.0
FT                   protein_id=mCP95431.0 isoform=CRA_a"
FT                   /protein_id="EDL06207.1"
FT                   /translation="MPHGRGPGRSGGTRAPGVSSRAGSGPLLLSESVSGAPTVCSSMGV
FT                   GALPGTKGASPRTFEPLVGSHKPTDSTSDPRPAHMSDAFLPMASSRAD"
FT   gene            5530764..5546286
FT                   /gene="Tgif2"
FT                   /locus_tag="mCG_5228"
FT                   /note="gene_id=mCG5228.3"
FT   mRNA            join(5530764..5530996,5534911..5535136,5543882..5546286)
FT                   /gene="Tgif2"
FT                   /locus_tag="mCG_5228"
FT                   /product="TGFB-induced factor 2, transcript variant
FT                   mCT3765"
FT                   /note="gene_id=mCG5228.3 transcript_id=mCT3765.2 created on
FT                   15-APR-2003"
FT   mRNA            join(5531718..5531845,5534911..5535136,5543882..>5544403)
FT                   /gene="Tgif2"
FT                   /locus_tag="mCG_5228"
FT                   /product="TGFB-induced factor 2, transcript variant
FT                   mCT172516"
FT                   /note="gene_id=mCG5228.3 transcript_id=mCT172516.0 created
FT                   on 15-APR-2003"
FT   gene            complement(5533883..5553414)
FT                   /locus_tag="mCG_140981"
FT                   /note="gene_id=mCG140981.0"
FT   mRNA            complement(join(5533883..5535644,5553048..5553414))
FT                   /locus_tag="mCG_140981"
FT                   /product="mCG140981, transcript variant mCT172518"
FT                   /note="gene_id=mCG140981.0 transcript_id=mCT172518.0
FT                   created on 11-JUN-2003"
FT   CDS             join(5534945..5535136,5543882..5544403)
FT                   /codon_start=1
FT                   /gene="Tgif2"
FT                   /locus_tag="mCG_5228"
FT                   /product="TGFB-induced factor 2, isoform CRA_a"
FT                   /note="gene_id=mCG5228.3 transcript_id=mCT3765.2
FT                   protein_id=mCP23003.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2AVY9"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1915299"
FT                   /db_xref="UniProtKB/TrEMBL:A2AVY9"
FT                   /protein_id="EDL06209.1"
FT                   /translation="MSDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAY
FT                   PSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVA
FT                   LPRGSSPSLLAVSVPAPTNMLSLSVCSMPLHSGQGEKPAAPFPQVELESPKALVTPAST
FT                   LTLLTRAEAGSPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQEPAP
FT                   PLLHTPLPFVSENAK"
FT   CDS             join(5534945..5535136,5543882..5544403)
FT                   /codon_start=1
FT                   /gene="Tgif2"
FT                   /locus_tag="mCG_5228"
FT                   /product="TGFB-induced factor 2, isoform CRA_a"
FT                   /note="gene_id=mCG5228.3 transcript_id=mCT172516.0
FT                   protein_id=mCP95435.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AVY9"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR008422"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="MGI:MGI:1915299"
FT                   /db_xref="UniProtKB/TrEMBL:A2AVY9"
FT                   /protein_id="EDL06210.1"
FT                   /translation="MSDSDLGEDEGLLSLTGKRKRRGNLPKESVKILRDWLYLHRYNAY
FT                   PSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVA
FT                   LPRGSSPSLLAVSVPAPTNMLSLSVCSMPLHSGQGEKPAAPFPQVELESPKALVTPAST
FT                   LTLLTRAEAGSPTGGLFNTPPPTPPEQDKDDFSSFQLLVEVALQRAAEMELQKQQEPAP
FT                   PLLHTPLPFVSENAK"
FT   CDS             complement(join(5535287..5535644,5553048..5553136))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140981"
FT                   /product="mCG140981, isoform CRA_a"
FT                   /note="gene_id=mCG140981.0 transcript_id=mCT172518.0
FT                   protein_id=mCP95437.1 isoform=CRA_a"
FT                   /protein_id="EDL06211.1"
FT                   /translation="MTMENKTKTKTKPKFPRLAMVQACLPAGGWAGITGVCRLVYLPPA
FT                   RRLKDLLFYIKKLKKKKKFHGHMCTCRGEKPLELGLQKALSCPLCAEAGTRMHRKSRTR
FT                   SQPLGHLLSSLNSFLSKCSGLPPRTSAPVSSHLQGQLEPLLIPS"
FT   mRNA            complement(join(5544481..5545057,5553048..5553414))
FT                   /locus_tag="mCG_140981"
FT                   /product="mCG140981, transcript variant mCT172519"
FT                   /note="gene_id=mCG140981.0 transcript_id=mCT172519.1
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(5544926..5545057,5553048..5553050))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140981"
FT                   /product="mCG140981, isoform CRA_b"
FT                   /note="gene_id=mCG140981.0 transcript_id=mCT172519.1
FT                   protein_id=mCP95438.1 isoform=CRA_b"
FT                   /protein_id="EDL06212.1"
FT                   /translation="MGRPNQELNNHSSLNSAPLQRICWSLYNHPVGSRLPTYRAPPTV"
FT   assembly_gap    5550475..5550494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5553478..5563951
FT                   /gene="1110008F13Rik"
FT                   /locus_tag="mCG_5237"
FT                   /note="gene_id=mCG5237.2"
FT   mRNA            join(5553478..5553866,5555706..5555809,5562730..5562859,
FT                   5563435..5563951)
FT                   /gene="1110008F13Rik"
FT                   /locus_tag="mCG_5237"
FT                   /product="RIKEN cDNA 1110008F13"
FT                   /note="gene_id=mCG5237.2 transcript_id=mCT3745.1 created on
FT                   05-SEP-2002"
FT   CDS             join(5553753..5553866,5555706..5555809,5562730..5562859,
FT                   5563435..5563476)
FT                   /codon_start=1
FT                   /gene="1110008F13Rik"
FT                   /locus_tag="mCG_5237"
FT                   /product="RIKEN cDNA 1110008F13"
FT                   /note="gene_id=mCG5237.2 transcript_id=mCT3745.1
FT                   protein_id=mCP23023.1"
FT                   /protein_id="EDL06213.1"
FT                   /translation="MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWDDKDEFLDVI
FT                   YWFRQIIALVLGVIWGVLPLRGFLGIAGFCLINAGVLYLYFSNYLQIDEEEYGGTWELT
FT                   KEGFMTSFALFMVIWIIFYTAIHYD"
FT   gene            complement(5564543..5577287)
FT                   /locus_tag="mCG_5240"
FT                   /note="gene_id=mCG5240.1"
FT   mRNA            complement(join(5564543..5564929,5565269..5565401,
FT                   5566214..5566363,5569096..5569199,5569834..5569920,
FT                   5570238..5570337,5573693..5573823,5576990..5577287))
FT                   /locus_tag="mCG_5240"
FT                   /product="mCG5240, transcript variant mCT3749"
FT                   /note="gene_id=mCG5240.1 transcript_id=mCT3749.2 created on
FT                   05-SEP-2002"
FT   mRNA            complement(join(5564551..5564929,5565269..5565401,
FT                   5566214..5566363,5569096..5569199,5569834..5569920,
FT                   5570238..5570337,5573693..5573811,5576990..5577186))
FT                   /locus_tag="mCG_5240"
FT                   /product="mCG5240, transcript variant mCT172529"
FT                   /note="gene_id=mCG5240.1 transcript_id=mCT172529.0 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(5564812..5564929,5565269..5565401,
FT                   5566214..5566363,5569096..5569199,5569834..5569920,
FT                   5570238..5570337,5573693..5573780))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5240"
FT                   /product="mCG5240, isoform CRA_a"
FT                   /note="gene_id=mCG5240.1 transcript_id=mCT172529.0
FT                   protein_id=mCP95448.0 isoform=CRA_a"
FT                   /protein_id="EDL06214.1"
FT                   /translation="MGSLSSRGKTSSPSPSSSGPDQEPVSMQPERHKVTAVALGSFPAG
FT                   EQARLSLRLGEPLTIISEDGDWWTVQSEVSGREYHMPSVYVAKVAHGWLYEGLSREKAE
FT                   ELLLLPGNPGGAFLIRESQTRRGCYSLSVRLSRPASWDRIRHYRIQRLDNGWLYISPRL
FT                   TFPSLHALVEHYSELADGICCPLREPCVLQKLGPLPGKDTPPPVTVPTSSLNWKKLDRS
FT                   LLFLEAPASGEASLLSEGLRESLSSYISLAEDPLDDA"
FT   CDS             complement(join(5564812..5564929,5565269..5565401,
FT                   5566214..5566363,5569096..5569199,5569834..5569920,
FT                   5570238..5570337,5573693..5573780))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5240"
FT                   /product="mCG5240, isoform CRA_a"
FT                   /note="gene_id=mCG5240.1 transcript_id=mCT3749.2
FT                   protein_id=mCP23016.1 isoform=CRA_a"
FT                   /protein_id="EDL06215.1"
FT                   /translation="MGSLSSRGKTSSPSPSSSGPDQEPVSMQPERHKVTAVALGSFPAG
FT                   EQARLSLRLGEPLTIISEDGDWWTVQSEVSGREYHMPSVYVAKVAHGWLYEGLSREKAE
FT                   ELLLLPGNPGGAFLIRESQTRRGCYSLSVRLSRPASWDRIRHYRIQRLDNGWLYISPRL
FT                   TFPSLHALVEHYSELADGICCPLREPCVLQKLGPLPGKDTPPPVTVPTSSLNWKKLDRS
FT                   LLFLEAPASGEASLLSEGLRESLSSYISLAEDPLDDA"
FT   assembly_gap    5577434..5578430
FT                   /estimated_length=997
FT                   /gap_type="unknown"
FT   assembly_gap    5579282..5581960
FT                   /estimated_length=2679
FT                   /gap_type="unknown"
FT   assembly_gap    5586110..5586658
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   assembly_gap    5592196..5593515
FT                   /estimated_length=1320
FT                   /gap_type="unknown"
FT   assembly_gap    5598198..5598217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5606959..5608347
FT                   /estimated_length=1389
FT                   /gap_type="unknown"
FT   assembly_gap    5609251..5609270
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5610793..5610812
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5618044..>5682531)
FT                   /gene="Ndrg3"
FT                   /locus_tag="mCG_124313"
FT                   /note="gene_id=mCG124313.1"
FT   mRNA            complement(join(5618044..5619580,5622158..5622209,
FT                   5622362..5622397,5625855..5625902,5627949..5628000,
FT                   5628109..5628174,5629174..5629277,5630987..5631043,
FT                   5634315..5634401,5634703..5634763,5636337..5636399,
FT                   5638558..5638678,5640350..5640455,5682458..>5682531))
FT                   /gene="Ndrg3"
FT                   /locus_tag="mCG_124313"
FT                   /product="N-myc downstream regulated gene 3, transcript
FT                   variant mCT125552"
FT                   /note="gene_id=mCG124313.1 transcript_id=mCT125552.1
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(5618045..5619580,5620631..5620669,
FT                   5622158..5622209,5622362..5622397,5625855..5625902,
FT                   5627949..5628000,5628109..5628174,5629174..5629277,
FT                   5630987..5631043,5634315..5634401,5634703..5634763,
FT                   5636337..5636399,5638558..5638678,5640350..5640455,
FT                   5682458..>5682502))
FT                   /gene="Ndrg3"
FT                   /locus_tag="mCG_124313"
FT                   /product="N-myc downstream regulated gene 3, transcript
FT                   variant mCT189872"
FT                   /note="gene_id=mCG124313.1 transcript_id=mCT189872.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(5619323..5619580,5622158..5622209,
FT                   5622362..5622397,5625855..5625902,5627949..5628000,
FT                   5628109..5628174,5629174..5629277,5630987..5631043,
FT                   5634315..5634401,5634703..5634763,5636337..5636399,
FT                   5638558..5638678,5640350..5640455,5648810..>5648845))
FT                   /gene="Ndrg3"
FT                   /locus_tag="mCG_124313"
FT                   /product="N-myc downstream regulated gene 3, transcript
FT                   variant mCT172494"
FT                   /note="gene_id=mCG124313.1 transcript_id=mCT172494.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(5619399..5619580,5620631..5620669,
FT                   5622158..5622209,5622362..5622397,5625855..5625902,
FT                   5627949..5628000,5628109..5628174,5629174..5629277,
FT                   5630987..5631043,5634315..5634401,5634703..5634763,
FT                   5636337..5636399,5638558..5638678,5640350..5640455,
FT                   5682458..>5682484))
FT                   /codon_start=1
FT                   /gene="Ndrg3"
FT                   /locus_tag="mCG_124313"
FT                   /product="N-myc downstream regulated gene 3, isoform CRA_a"
FT                   /note="gene_id=mCG124313.1 transcript_id=mCT189872.0
FT                   protein_id=mCP110852.0 isoform=CRA_a"
FT                   /protein_id="EDL06216.1"
FT                   /translation="IDGPALALQEHDIETPHGMVHVTIRGLPKGNRPVILTYHDIGLNH
FT                   KSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTH
FT                   LSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLSGFTTNI
FT                   VDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQ
FT                   NDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPINTTLLKMADCGGLPQVVQPGKLT
FT                   EAFKYFLQGMGYIPYVQLSHLSSESVPSASMTRLARSRTHSTSSSIGSGESPFSRSVTS
FT                   NQSDGTQESCESPDVLDRHQTMEVSC"
FT   CDS             complement(join(5619399..5619580,5622158..5622209,
FT                   5622362..5622397,5625855..5625902,5627949..5628000,
FT                   5628109..5628174,5629174..5629277,5630987..5631043,
FT                   5634315..5634401,5634703..5634763,5636337..5636399,
FT                   5638558..5638678,5640350..5640455,5648810..>5648845))
FT                   /codon_start=1
FT                   /gene="Ndrg3"
FT                   /locus_tag="mCG_124313"
FT                   /product="N-myc downstream regulated gene 3, isoform CRA_c"
FT                   /note="gene_id=mCG124313.1 transcript_id=mCT172494.0
FT                   protein_id=mCP95413.0 isoform=CRA_c"
FT                   /protein_id="EDL06218.1"
FT                   /translation="NGTRNFQDFDCQEHDIETPHGMVHVTIRGLPKGNRPVILTYHDIG
FT                   LNHKSCFNTFFNFEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPV
FT                   LTHLSMKSIIGIGVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLSGFT
FT                   TNIVDIILAHHFGQEELQANLDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPI
FT                   LGQNDNRLKTLKCSTLLVVGDNSPAVEAVVECNSRLDPINTTLLKMADCGGLPQVVQPG
FT                   KLTEAFKYFLQGMGYIPSASMTRLARSRTHSTSSSIGSGESPFSRSVTSNQSDGTQESC
FT                   ESPDVLDRHQTMEVSC"
FT   CDS             complement(join(5619399..5619580,5622158..5622209,
FT                   5622362..5622397,5625855..5625902,5627949..5628000,
FT                   5628109..5628174,5629174..5629277,5630987..5631043,
FT                   5634315..5634401,5634703..5634763,5636337..5636399,
FT                   5638558..5638678,5640350..>5640455))
FT                   /codon_start=1
FT                   /gene="Ndrg3"
FT                   /locus_tag="mCG_124313"
FT                   /product="N-myc downstream regulated gene 3, isoform CRA_b"
FT                   /note="gene_id=mCG124313.1 transcript_id=mCT125552.1
FT                   protein_id=mCP73109.1 isoform=CRA_b"
FT                   /protein_id="EDL06217.1"
FT                   /translation="EHDIETPHGMVHVTIRGLPKGNRPVILTYHDIGLNHKSCFNTFFN
FT                   FEDMQEITQHFAVCHVDAPGQQEAAPSFPTGYQYPTMDELAEMLPPVLTHLSMKSIIGI
FT                   GVGAGAYILSRFALNHPELVEGLVLINIDPCAKGWIDWAASKLSGFTTNIVDIILAHHF
FT                   GQEELQANLDLIQTYRLHIAQDINQENLQLFLGSYNGRRDLEIERPILGQNDNRLKTLK
FT                   CSTLLVVGDNSPAVEAVVECNSRLDPINTTLLKMADCGGLPQVVQPGKLTEAFKYFLQG
FT                   MGYIPSASMTRLARSRTHSTSSSIGSGESPFSRSVTSNQSDGTQESCESPDVLDRHQTM
FT                   EVSC"
FT   assembly_gap    5623300..5623622
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    5627283..5627302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5631829..5632410
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    5633637..5633661
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    5660338..5660695
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    5679154..5679196
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   gene            complement(5685724..5697531)
FT                   /gene="1700022L09Rik"
FT                   /locus_tag="mCG_21984"
FT                   /note="gene_id=mCG21984.0"
FT   mRNA            complement(join(5685724..5686740,5687192..5687279,
FT                   5688066..5688213,5689179..5689256,5689595..5689654,
FT                   5691293..5691383,5692142..5692214,5693146..5693219,
FT                   5695625..5695948,5696305..5696330,5697429..5697531))
FT                   /gene="1700022L09Rik"
FT                   /locus_tag="mCG_21984"
FT                   /product="RIKEN cDNA 1700022L09"
FT                   /note="gene_id=mCG21984.0 transcript_id=mCT22230.1 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(5686655..5686740,5687192..5687279,
FT                   5688066..5688213,5689179..5689256,5689595..5689654,
FT                   5691293..5691383,5692142..5692214,5693146..5693219,
FT                   5695625..5695948,5696305..5696329))
FT                   /codon_start=1
FT                   /gene="1700022L09Rik"
FT                   /locus_tag="mCG_21984"
FT                   /product="RIKEN cDNA 1700022L09"
FT                   /note="gene_id=mCG21984.0 transcript_id=mCT22230.1
FT                   protein_id=mCP22976.1"
FT                   /protein_id="EDL06219.1"
FT                   /translation="MTSVTRSEDQEPTMSETQDRPLQPSLKPLEALPQSSAYQEMMTQG
FT                   VSEEKNHLGSNPGEGESCGADHQEGSQLRSFHLSPQEQSIRPQDRRQSWRRASMKEVNR
FT                   RKSLAPFHPGITELCRSISVKLAQSQRLGALLLSSFQFSVEKLEPFLKNTKDFSLECFR
FT                   AKASSLSEELKHFTDRLGNDGTLQKCFVEDSKEKAADFSLEASVAEVKEYITKFSLERQ
FT                   AWDRLLLQYQNEVPPEEMPRGSTETRITEVKVDPAAYLRSSQKEVLSTKPDYQRIVQDQ
FT                   NQVFAYVELVMDELQGSVKQLQALMDESTQYLQKVSVQLKKRSMDQLDSSPARKLLKLP
FT                   LQSSPSTQ"
FT   assembly_gap    5700006..5700241
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   gene            <5700923..5701462
FT                   /locus_tag="mCG_140978"
FT                   /note="gene_id=mCG140978.0"
FT   mRNA            <5700923..5701462
FT                   /locus_tag="mCG_140978"
FT                   /product="mCG140978, transcript variant mCT172505"
FT                   /note="gene_id=mCG140978.0 transcript_id=mCT172505.0
FT                   created on 05-SEP-2002"
FT   CDS             <5700963..5701325
FT                   /codon_start=1
FT                   /locus_tag="mCG_140978"
FT                   /product="mCG140978, isoform CRA_b"
FT                   /note="gene_id=mCG140978.0 transcript_id=mCT172505.0
FT                   protein_id=mCP95423.0 isoform=CRA_b"
FT                   /protein_id="EDL06221.1"
FT                   /translation="KHFVSLHCTVLMSKIRHRARIAGGPDAVLPPNMSWEGAFKERKAG
FT                   GEVTEGRGEGQNSGRDRWTVGPRMPLVPSLLSGPAGPTTAGPSPGNQAEQEGRHSIGQG
FT                   EAGSQDGEERQSLALP"
FT   mRNA            join(<5700980..5701277,5701326..5701432)
FT                   /locus_tag="mCG_140978"
FT                   /product="mCG140978, transcript variant mCT172504"
FT                   /note="gene_id=mCG140978.0 transcript_id=mCT172504.0
FT                   created on 05-SEP-2002"
FT   CDS             join(<5700981..5701277,5701326..5701412)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140978"
FT                   /product="mCG140978, isoform CRA_a"
FT                   /note="gene_id=mCG140978.0 transcript_id=mCT172504.0
FT                   protein_id=mCP95424.0 isoform=CRA_a"
FT                   /protein_id="EDL06220.1"
FT                   /translation="HCTVLMSKIRHRARIAGGPDAVLPPNMSWEGAFKERKAGGEVTEG
FT                   RGEGQNSGRDRWTVGPRMPLVPSLLSGPAGPTTAGPSPGNQAEQEGRHSIGQGEALGVG
FT                   TDFWHCLHGLPGIRRTRRCGMGG"
FT   assembly_gap    5709266..5711637
FT                   /estimated_length=2372
FT                   /gap_type="unknown"
FT   assembly_gap    5713219..5713248
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            complement(<5715003..>5766710)
FT                   /locus_tag="mCG_21977"
FT                   /note="gene_id=mCG21977.2"
FT   mRNA            complement(join(<5715003..5715347,5717573..5717740,
FT                   5718612..5718716,5718881..5719111,5721514..5721639,
FT                   5724935..5725075,5727592..5728767,5741287..5741445,
FT                   5747957..5748181,5766133..5766332,5766510..>5766710))
FT                   /locus_tag="mCG_21977"
FT                   /product="mCG21977"
FT                   /note="gene_id=mCG21977.2 transcript_id=mCT22223.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(5715003..5715347,5717573..5717740,
FT                   5718612..5718716,5718881..5719111,5721514..5721639,
FT                   5724935..5725075,5727592..5728767,5741287..5741445,
FT                   5747957..5748181,5766133..5766332,5766510..>5766708))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21977"
FT                   /product="mCG21977"
FT                   /note="gene_id=mCG21977.2 transcript_id=mCT22223.2
FT                   protein_id=mCP23029.2"
FT                   /protein_id="EDL06222.1"
FT                   /translation="RPKDVAGWSLAKGRRGTGPGSATACGTASSARPDKKGRAVAPGTR
FT                   GTGPRVAGVRTGVRAKGRPRPAQSGQQPPRPPASPDEPSVAASSVGSSRLPLSASLAFS
FT                   DLTEEMLDCGPGGLVRELEELRSENDYLKDEIEELRAEMLEMRDVYMEEDVYQLQELRQ
FT                   QLDQASKTCRILQYRLRKAERRSLRAAQTGQVDGELIRGLEQDVKVSKDISMRLHKELE
FT                   VVEKKRMRLEEENEGLRQRLIETELAKQVLQTELDRPREEDSADLKCQLHFAKEESALM
FT                   CKKLTKLAKENDSMKEELLKYRSLYGDLDAALSAEELADAPHSRETELKVHLKLVEEEA
FT                   NLLSRRIVELEVENRGLRAEMDDMKDHGGGGGPEARLAFSSLGGECGESLAELRRHLQF
FT                   VEEEAELLRRSSAELEDQNKLLLNELAKYRSEHELDVTLSEDSCSVLSEPSQEELAAAK
FT                   LQIGELSGKVKKLQYENRVLLSNLQRCDLASCQSTRPMLETDAEAGDSAQCVPAPLGET
FT                   LEPHATRLCRAREAEALPGLREQAALVSKAIDVLVADANGFSVGLRLCLDNECADLRLH
FT                   EAPDNSEGPRDAKLIHAILVRLSVLQQELNAFTRKADVALGSSGKEQPEPFPALPALGS
FT                   QGPAKEIMLSKDLGSDFQPPDFRDLLEWEPRIREAFRTGDLESKPDPSRNFRPYRAEDN
FT                   DSYASEIKDLQLVLAEAHDSLRGLQEQLSQERQLRKEEADSFNQKMVQLKEDQQRALLR
FT                   REFELQSLSLQRRLEQKFWSQEKNILVQESQQFKHNFLLLFMKLRWFLKRWRQGKVLPS
FT                   EEDDFLEVNSMKELYLLMEEEEMNAQHSDNKACTGESWTQNTPNECIKTLADMKVTLKE
FT                   LCWLLQDERRGLTELQQQFAKAKATWETERAELKGHASQMELKAGKGASERPGPDWKAA
FT                   LQREREEQQHLLAESYSAVMELTRQLQLSERHWSQEKLQLVERLQGEKQQVEQQVKELQ
FT                   NRLSQVRRLWCSDSWSPGRRGSRQSRALHSTWQPR"
FT   assembly_gap    5715665..5715684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5720288..5720478
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    5766773..5767218
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    5773476..5773689
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    5776789..5777182
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    5784762..5784853
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    5787086..5787213
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   gene            complement(5787257..5823753)
FT                   /gene="Samhd1"
FT                   /locus_tag="mCG_21986"
FT                   /note="gene_id=mCG21986.3"
FT   mRNA            complement(join(5787257..5787708,5789925..5790062,
FT                   5793063..5793167,5794507..5794599,5795705..5795841,
FT                   5797693..5797808,5798824..5798915,5801077..5801218,
FT                   5802497..5802597,5804627..5804782,5808797..5808867,
FT                   5810146..5810261,5811604..5811764,5815087..5815159,
FT                   5818165..5818231,5823409..5823753))
FT                   /gene="Samhd1"
FT                   /locus_tag="mCG_21986"
FT                   /product="SAM domain and HD domain, 1, transcript variant
FT                   mCT22232"
FT                   /note="gene_id=mCG21986.3 transcript_id=mCT22232.3 created
FT                   on 17-JUN-2003"
FT   CDS             complement(join(5787604..5787708,5789925..5790062,
FT                   5793063..5793167,5794507..5794599,5795705..5795841,
FT                   5797693..5797808,5798824..5798915,5801077..5801218,
FT                   5802497..5802597,5804627..5804782,5808797..5808867,
FT                   5810146..5810261,5811604..5811764,5815087..5815159,
FT                   5818165..5818231,5823409..5823619))
FT                   /codon_start=1
FT                   /gene="Samhd1"
FT                   /locus_tag="mCG_21986"
FT                   /product="SAM domain and HD domain, 1, isoform CRA_c"
FT                   /note="gene_id=mCG21986.3 transcript_id=mCT22232.3
FT                   protein_id=mCP22979.3 isoform=CRA_c"
FT                   /protein_id="EDL06225.1"
FT                   /translation="MQSAPLEQPAKRPRCDGSPRTPPSTPPATANLSADDDFQNTDLRT
FT                   WEPEDVCSFLENRGFREKKVLDIFRDNKIAGSFLPFLDEDRLEDLGVSSLEERKKMIEC
FT                   IQQLSQSRIDLMKVFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFPGASH
FT                   NRFEHSLGVGYLAGCLVRALAEKQPELQISERDILCVQIAGLCHDLGHGPFSHMFDGRF
FT                   IPRARPDKKWKHEQGSIEMFEHLVNSNELKLVMKNYGLVPEEDITFIKEQIMGPPITPV
FT                   KDSLWPYKGRPATKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKFAR
FT                   ICEVEYKVKEDKTYIRKVKHICSREKEVGNLYDMFHTRNCLHRRAYQHKISNLIDIMIT
FT                   DAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILR
FT                   NIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVD
FT                   YGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCKKKDGKSLDAA
FT                   GKHFVQWCALRDFTKPQDGDIIAPLITPLKWNNKTSSCLQEVSKVKTCLKF"
FT   mRNA            complement(join(5787606..5789647,5789925..5790062,
FT                   5793063..5793167,5794507..5794599,5795705..5795841,
FT                   5797693..5797808,5798824..5798915,5801077..5801218,
FT                   5802497..5802597,5804627..5804782,5808797..5808867,
FT                   5810146..5810261,5811604..5811764,5818165..5818231,
FT                   5823409..>5823623))
FT                   /gene="Samhd1"
FT                   /locus_tag="mCG_21986"
FT                   /product="SAM domain and HD domain, 1, transcript variant
FT                   mCT189896"
FT                   /note="gene_id=mCG21986.3 transcript_id=mCT189896.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(5789564..5789647,5789925..5790062,
FT                   5793063..5793167,5794507..5794599,5795705..5795841,
FT                   5797693..5797808,5798824..5798915,5801077..5801218,
FT                   5802497..5802597,5804627..5804782,5808797..5808867,
FT                   5810146..5810261,5811604..5811764,5818165..>5818191))
FT                   /codon_start=1
FT                   /gene="Samhd1"
FT                   /locus_tag="mCG_21986"
FT                   /product="SAM domain and HD domain, 1, isoform CRA_a"
FT                   /note="gene_id=mCG21986.3 transcript_id=mCT189896.0
FT                   protein_id=mCP110882.0 isoform=CRA_a"
FT                   /protein_id="EDL06223.1"
FT                   /translation="GSSGRSGSKVFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGG
FT                   GYYVFPGASHNRFEHSLGVGYLAGCLVRALAEKQPELQISERDILCVQIAGLCHDLGHG
FT                   PFSHMFDGRFIPRARPDKKWKHEQGSIEMFEHLVNSNELKLVMKNYGLVPEEDITFIKE
FT                   QIMGPPITPVKDSLWPYKGRPATKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNF
FT                   DYKRFIKFARICEVEYKVKEDKTYIRKVKHICSREKEVGNLYDMFHTRNCLHRRAYQHK
FT                   ISNLIDIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDP
FT                   QLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVAKAKPEKAPDVELKAE
FT                   DFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVSQLLPEKFAEQLIRVYCK
FT                   KKDGKSLDAAGKHFVQWCALRDFTKPQQCGAGEMAEDPDSIPSTQQPHAAHNQL"
FT   assembly_gap    5790278..5790399
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   mRNA            complement(join(5791574..5793167,5794507..5794599,
FT                   5795705..5795841,5797693..5797808,5798824..5798915,
FT                   5801077..5801218,5802497..5802597,5804627..5804782,
FT                   5808797..5808867,5810146..5810261,5811604..5811764,
FT                   5815087..5815159,5818165..5818231,5823409..>5823696))
FT                   /gene="Samhd1"
FT                   /locus_tag="mCG_21986"
FT                   /product="SAM domain and HD domain, 1, transcript variant
FT                   mCT189897"
FT                   /note="gene_id=mCG21986.3 transcript_id=mCT189897.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(5793048..5793167,5794507..5794599,
FT                   5795705..5795841,5797693..5797808,5798824..5798915,
FT                   5801077..5801218,5802497..5802597,5804627..5804782,
FT                   5808797..5808867,5810146..5810261,5811604..5811764,
FT                   5815087..5815159,5818165..5818231,5823409..>5823694))
FT                   /codon_start=1
FT                   /gene="Samhd1"
FT                   /locus_tag="mCG_21986"
FT                   /product="SAM domain and HD domain, 1, isoform CRA_b"
FT                   /note="gene_id=mCG21986.3 transcript_id=mCT189897.0
FT                   protein_id=mCP110883.0 isoform=CRA_b"
FT                   /protein_id="EDL06224.1"
FT                   /translation="CGVSAAAREPVPRYLTSQPRVSEVAMQSAPLEQPAKRPRCDGSPR
FT                   TPPSTPPATANLSADDDFQNTDLRTWEPEDVCSFLENRGFREKKVLDIFRDNKIAGSFL
FT                   PFLDEDRLEDLGVSSLEERKKMIECIQQLSQSRIDLMKVFNDPIHGHIEFHPLLIRIID
FT                   TPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLVRALAEKQPELQISERDI
FT                   LCVQIAGLCHDLGHGPFSHMFDGRFIPRARPDKKWKHEQGSIEMFEHLVNSNELKLVMK
FT                   NYGLVPEEDITFIKEQIMGPPITPVKDSLWPYKGRPATKSFLYEIVSNKRNGIDVDKWD
FT                   YFARDCHHLGIQNNFDYKRFIKFARICEVEYKVKEDKTYIRKVKHICSREKEVGNLYDM
FT                   FHTRNCLHRRAYQHKISNLIDIMITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTK
FT                   LTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQPKREKIRKEEYERLPQEVA
FT                   KAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRVHFYCKSNSKQAVRINKEQVMVT
FT                   "
FT   assembly_gap    5793937..5794316
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    5819046..5819065
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5834417..>5892828)
FT                   /gene="Rbl1"
FT                   /locus_tag="mCG_21972"
FT                   /note="gene_id=mCG21972.2"
FT   mRNA            complement(join(5834417..5836205,5839223..5839387,
FT                   5841450..5841598,5848255..5848333,5849975..5850046,
FT                   5852266..5852442,5855688..5855899,5858319..5858582,
FT                   5863226..5863358,5863979..5864143,5865671..5865808,
FT                   5876400..5876503,5876688..5876800,5880402..5880568,
FT                   5881571..5881757,5882507..5882556,5883654..5883814,
FT                   5883915..5884043,5884134..5884198,5884530..5884730,
FT                   5887791..5887953,5892665..>5892828))
FT                   /gene="Rbl1"
FT                   /locus_tag="mCG_21972"
FT                   /product="retinoblastoma-like 1 (p107)"
FT                   /note="gene_id=mCG21972.2 transcript_id=mCT22220.2 created
FT                   on 05-SEP-2002"
FT   CDS             complement(join(5836035..5836205,5839223..5839387,
FT                   5841450..5841598,5848255..5848333,5849975..5850046,
FT                   5852266..5852442,5855688..5855899,5858319..5858582,
FT                   5863226..5863358,5863979..5864143,5865671..5865808,
FT                   5876400..5876503,5876688..5876800,5880402..5880568,
FT                   5881571..5881757,5882507..5882556,5883654..5883814,
FT                   5883915..5884043,5884134..5884198,5884530..5884730,
FT                   5887791..5887953,5892665..>5892827))
FT                   /codon_start=1
FT                   /gene="Rbl1"
FT                   /locus_tag="mCG_21972"
FT                   /product="retinoblastoma-like 1 (p107)"
FT                   /note="gene_id=mCG21972.2 transcript_id=mCT22220.2
FT                   protein_id=mCP22978.2"
FT                   /protein_id="EDL06226.1"
FT                   /translation="LAGREKKTPKPVAPPVGPEGDMFEDEPHAEGAAAVAAAREALQAL
FT                   CQELNLDEGNMYCVCIGLQGEVIHWLACSLYVACRKSIIPTVGKGVMEGNCVSLTRILR
FT                   SAKLSLIQFFSKMKKWMDMSNLPQEFRERIERLERNFEVSTVIFKKFEPIFLDIFQNPY
FT                   EEPPKLPRSRKQRRIPCSVKDLFNFCWTLFVYTKGNFRMIGDDLVNSYHLLLCCLDLIF
FT                   ANAIMCPNRRDLLNPSFKGLPSDFHAPDFKAAEEPPCIIAVLCDLHDGLLVEAKGIKEH
FT                   YFKPYISKLFDKKILKGECLLDLSSFTDNSKAVNKEYEEYVLTVGDFDERIFLGADAEE
FT                   EIGTPRKFTADTPFGKLTSQASVECNLQQHFEKKRSFAPSTPLTGRRYLQEKEAVTTPV
FT                   ASATQSVSRLQSIVAGLKSAPSEQLLNIFESCMRNPMGNIIKIVKGIGETFCQHYTQST
FT                   DKQPGSHIDFAVNRLKLAEILYYKILETIMVQETRRLHGMDMSVLLEQDIFHKSLMACC
FT                   LEIVLFAYSSPRTFPWIIEVLDLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILE
FT                   SLAWTNNSALWEALHASANRVPSCEEVIFPNNFEIGNGGNVQGHLPMMPMSPIIHPRVK
FT                   EVRTDSGSLRQDMQPLSPISVHERYSSPAAGSAKRRLFGDDPPKDTLMDKIMAEGTKLK
FT                   IAPSSVTAESLSISPGQALLTMATTTVTGTTGRKVTVPLHGIANDAGEITLVPISMNPT
FT                   QESTAESPVSLTAQSLIGTSPKQTHLTKAQDAHLTGVSKPKRTGSLALFYRKVYHLASV
FT                   RLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERT
FT                   FQEIMKSYRNQPQANSHVYRSVLLKSIPGGVVVYNGDCEMTDGDIEDATKTPNCSSEPV
FT                   KEERGDLIKFYNTVYVGRVKSFALKYDLSNQDHIMDAPPLSPFPHIKQQPGSPRRISQQ
FT                   HSLYVSPHKNGAGLTPRSALLYKFNGSPSKSLKDINNMIRQGEQKTKKRVIAISGDADS
FT                   PAKRLCQENDDVLLKRLQDVVSERANH"
FT   assembly_gap    5851584..5851738
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   gene            <5857226..5857731
FT                   /locus_tag="mCG_21971"
FT                   /note="gene_id=mCG21971.0"
FT   mRNA            <5857226..5857731
FT                   /locus_tag="mCG_21971"
FT                   /product="mCG21971"
FT                   /note="gene_id=mCG21971.0 transcript_id=mCT22217.0 created
FT                   on 05-SEP-2002"
FT   CDS             <5857227..5857631
FT                   /codon_start=1
FT                   /locus_tag="mCG_21971"
FT                   /product="mCG21971"
FT                   /note="gene_id=mCG21971.0 transcript_id=mCT22217.0
FT                   protein_id=mCP22988.0"
FT                   /protein_id="EDL06227.1"
FT                   /translation="NSMNSRTRRENCIARMKLVRFLMKLSHETVTIELKNGTQVHGTIT
FT                   GVDVSMNTHLKAVKMTLKNREPVQLETLSIQGTNIRYFILPDSLPLDTLLVDVEPKVKS
FT                   RKREAVAGRGRGRGRGRGHGRARGRGGPRR"
FT   assembly_gap    5883177..5883215
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    5892645..5892664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5896867..5926610)
FT                   /locus_tag="mCG_1050957"
FT                   /note="gene_id=mCG1050957.0"
FT   mRNA            complement(join(5896867..5897043,5899119..5899152,
FT                   5899965..5900135,5901990..5902055,5903214..5903313,
FT                   5905224..5905346,5908376..5908531,5909460..5909624,
FT                   5911090..5911230,5911514..5911628,5912232..5912366,
FT                   5913790..5913954,5916947..5917082,5918248..5918408,
FT                   5921652..5921804,5926498..5926610))
FT                   /locus_tag="mCG_1050957"
FT                   /product="mCG1050957"
FT                   /note="gene_id=mCG1050957.0 transcript_id=mCT194746.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(5899987..5900135,5901990..5902055,
FT                   5903214..5903313,5905224..5905346,5908376..5908531,
FT                   5909460..5909624,5911090..5911230,5911514..5911628,
FT                   5912232..5912366,5913790..5913803))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050957"
FT                   /product="mCG1050957"
FT                   /note="gene_id=mCG1050957.0 transcript_id=mCT194746.0
FT                   protein_id=mCP115775.0"
FT                   /protein_id="EDL06228.1"
FT                   /translation="MQSRNFAIQATKTLLLRTLCWQEFSIMEKSGGWTLLKGEGHLQGV
FT                   FLLANALMERSHLFAYKILYLLVPLINRGNDKHKLTSAGFFVELLKSPMARRLPKVYST
FT                   IRLKAWLNEESKLFRILALRGLRNLVRHQEMREDIKSLLPCILSSLHETDERIILLAIQ
FT                   ILLQLVRMLDSTTLATMMKTLLSLFGDVRQDVHCFSMTLFGASIKAVKHTEKKSVEDQV
FT                   LESLVPLLLFSQDENDEIAKESRRVLTLCARFLNWKLPREVYCKDPLYIKPNEVRRVCK
FT                   FFGEKSKGKIDILDQTLPYSKDPKLPIRRTAVLFVGLLSHYVDTSELKRKGTDWIEKDL
FT                   RELLQDPEPSLRILASQALFRIQRVGSTSEAETSVSWLRKLLCCLHT"
FT   assembly_gap    5910211..5910391
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    5917999..5918097
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    5920659..5920692
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    5921997..5922662
FT                   /estimated_length=666
FT                   /gap_type="unknown"
FT   assembly_gap    5926242..5926443
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    5928213..5931145
FT                   /estimated_length=2933
FT                   /gap_type="unknown"
FT   assembly_gap    5932424..5932443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5933535..5933554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5936531..5939667
FT                   /estimated_length=3137
FT                   /gap_type="unknown"
FT   gene            complement(5943915..>5969550)
FT                   /locus_tag="mCG_66546"
FT                   /note="gene_id=mCG66546.2"
FT   mRNA            complement(join(5943915..5944117,5944772..5944867,
FT                   5946169..5946313,5947870..5947949,5954848..5954970,
FT                   5959260..5959405,5961739..5961860,5969193..>5969550))
FT                   /locus_tag="mCG_66546"
FT                   /product="mCG66546"
FT                   /note="gene_id=mCG66546.2 transcript_id=mCT66729.2 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(5943935..5944117,5944772..5944867,
FT                   5946169..5946313,5947870..5947949,5954848..5954970,
FT                   5959260..5959405,5961739..5961860,5969193..>5969548))
FT                   /codon_start=1
FT                   /locus_tag="mCG_66546"
FT                   /product="mCG66546"
FT                   /note="gene_id=mCG66546.2 transcript_id=mCT66729.2
FT                   protein_id=mCP42729.2"
FT                   /protein_id="EDL06229.1"
FT                   /translation="PFGSPALHQLAASATRSTPKAPVPMPLPRRGGEPRLAGARVVRTS
FT                   LPRATPRSPKRVGRGAPLLSHAQRLTRRRHSSEQVPPEPEQADFRSGKWLQERAGGDAR
FT                   DPRHTPLARMGSRQRASGTEEVVIPCASDSDSGSVDLQLSNLDDVQKGGASVEFTDSDI
FT                   ADIPTLPQESLPDNLRLLTLQEPLSETSIERLVQSIQEVLHGELKGETQKLKFLRSLSS
FT                   LSQTIPYDENTESFIHRHTAEIVHVLSVLVQEEPLHSLTSMVRQEIFVTITDLSFQNVY
FT                   LLFGSEDREDLLGLITKSIISLPATSTPIQLLKIVSNQAIEQECLYRETFEAFSVMLQS
FT                   LVIKDPHLEFFDSIFKPTPDARTLSCWYPVRRNADSTSCHATPDADRFLLLSDCTSTVR
FT                   RGSCFVQLYLARSCPGS"
FT   assembly_gap    5951149..5951217
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    5964805..5965552
FT                   /estimated_length=748
FT                   /gap_type="unknown"
FT   gene            5969051..6017353
FT                   /gene="Rpn2"
FT                   /locus_tag="mCG_140977"
FT                   /note="gene_id=mCG140977.0"
FT   mRNA            join(5969051..5969336,5973585..5973778,5980556..5980651,
FT                   5981565..5981740,5985142..5985217,5986243..5986377,
FT                   5988372..5988548,5990531..5990649,5993396..5993501,
FT                   6001196..6001287,6003472..6003586,6005773..6005967,
FT                   6007118..6007204,6008945..6009040,6012811..6012905,
FT                   6016742..6017353)
FT                   /gene="Rpn2"
FT                   /locus_tag="mCG_140977"
FT                   /product="ribophorin II"
FT                   /note="gene_id=mCG140977.0 transcript_id=mCT172502.0
FT                   created on 06-SEP-2002"
FT   CDS             join(5969324..5969336,5973585..5973778,5980556..5980651,
FT                   5981565..5981740,5985142..5985217,5986243..5986377,
FT                   5988372..5988548,5990531..5990649,5993396..5993501,
FT                   6001196..6001287,6003472..6003586,6005773..6005967,
FT                   6007118..6007204,6008945..6009040,6012811..6012905,
FT                   6016742..6016754)
FT                   /codon_start=1
FT                   /gene="Rpn2"
FT                   /locus_tag="mCG_140977"
FT                   /product="ribophorin II"
FT                   /note="gene_id=mCG140977.0 transcript_id=mCT172502.0
FT                   protein_id=mCP95421.0"
FT                   /protein_id="EDL06230.1"
FT                   /translation="MAPPGSSAVFLLALTITASIQALTPTHYLTKQDVERLKASLDRPF
FT                   TDLESAFYSIVGLSSLGVQVPDVKKACTFIKSNLDPSNVDSLFYAAQSSQVLSGCEISV
FT                   SNETKELLLAAVSEDSPIAQIYHAVAALSGFGLPLASNEALGALTARLGKEETVLATVQ
FT                   ALQTASHLSQQADLRNIVEEIEDLVARLDELGGVYLQFEEGLELTALFVAATYKLMDHV
FT                   GTEPSMKEDQVIQLMNTIFSKKNFESLSEAFSVASAAAALSQNRYHVPVVVVPEGSTSD
FT                   TQEQAILRLQVSNVLSQPLAQAAVKLEHAKSAATRATVLQKTPFSLVGNVFELNFKNVK
FT                   LSSGYYDFSVRVEGDSRYIANTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYP
FT                   AKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNV
FT                   YKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQ
FT                   SLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALLNMFQTLKYLAVLGTVT
FT                   FLAGNRMLAQHAVKRTAH"
FT   assembly_gap    5974739..5974758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5983104..5983693
FT                   /estimated_length=590
FT                   /gap_type="unknown"
FT   assembly_gap    6009727..6009939
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    6010590..6011302
FT                   /estimated_length=713
FT                   /gap_type="unknown"
FT   gene            complement(6020513..6037783)
FT                   /gene="Ghrh"
FT                   /locus_tag="mCG_21978"
FT                   /note="gene_id=mCG21978.2"
FT   mRNA            complement(join(6020513..6020651,6022796..6022886,
FT                   6024395..6024496,6024710..6024809,6037699..6037783))
FT                   /gene="Ghrh"
FT                   /locus_tag="mCG_21978"
FT                   /product="growth hormone releasing hormone"
FT                   /note="gene_id=mCG21978.2 transcript_id=mCT22224.2 created
FT                   on 06-SEP-2002"
FT   CDS             complement(join(6020613..6020651,6022796..6022886,
FT                   6024395..6024496,6024710..6024789))
FT                   /codon_start=1
FT                   /gene="Ghrh"
FT                   /locus_tag="mCG_21978"
FT                   /product="growth hormone releasing hormone"
FT                   /note="gene_id=mCG21978.2 transcript_id=mCT22224.2
FT                   protein_id=mCP22996.2"
FT                   /db_xref="GOA:Q544X5"
FT                   /db_xref="InterPro:IPR000532"
FT                   /db_xref="MGI:MGI:95709"
FT                   /db_xref="UniProtKB/TrEMBL:Q544X5"
FT                   /protein_id="EDL06231.1"
FT                   /translation="MLLWVLFVILILTSGSHCSLPPSPPFRMQRHVDAIFTTNYRKLLS
FT                   QLYARKVIQDIMNKQGERIQEQRARLSRQEDSMWTEDKQMTLESILQGFPRMKPSADA"
FT   assembly_gap    6025100..6025160
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    6030357..6032071
FT                   /estimated_length=1715
FT                   /gap_type="unknown"
FT   assembly_gap    6047460..6048582
FT                   /estimated_length=1123
FT                   /gap_type="unknown"
FT   assembly_gap    6049181..6050016
FT                   /estimated_length=836
FT                   /gap_type="unknown"
FT   assembly_gap    6054364..6054753
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    6057124..6057143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6058249..6060479
FT                   /estimated_length=2231
FT                   /gap_type="unknown"
FT   gene            <6063904..6095476
FT                   /gene="Manbal"
FT                   /locus_tag="mCG_21970"
FT                   /note="gene_id=mCG21970.2"
FT   mRNA            join(<6063904..6063929,6077160..6077365,6094637..6095476)
FT                   /gene="Manbal"
FT                   /locus_tag="mCG_21970"
FT                   /product="mannosidase, beta A, lysosomal-like, transcript
FT                   variant mCT173580"
FT                   /note="gene_id=mCG21970.2 transcript_id=mCT173580.0 created
FT                   on 26-SEP-2002"
FT   CDS             join(<6063906..6063929,6077160..6077365,6094637..6094859)
FT                   /codon_start=1
FT                   /gene="Manbal"
FT                   /locus_tag="mCG_21970"
FT                   /product="mannosidase, beta A, lysosomal-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21970.2 transcript_id=mCT173580.0
FT                   protein_id=mCP96499.0 isoform=CRA_b"
FT                   /protein_id="EDL06233.1"
FT                   /translation="YGGAAFPEKLVLESGESRGAWQWCLGPWPPTWASHLPRCLSPPSW
FT                   RTCCGMDSSWEPSSSSSVSWPSSYPFPSPMRRRQNRLSPEVQRGRRSPRLPSLPPTRGR
FT                   RRRRRRSDRILESEAEEPKAAASGTALLGTSILFALTDCLCPRLRV"
FT   mRNA            join(<6075366..6075536,6094637..6095476)
FT                   /gene="Manbal"
FT                   /locus_tag="mCG_21970"
FT                   /product="mannosidase, beta A, lysosomal-like, transcript
FT                   variant mCT22216"
FT                   /note="gene_id=mCG21970.2 transcript_id=mCT22216.2 created
FT                   on 26-SEP-2002"
FT   CDS             join(<6075367..6075536,6094637..6094859)
FT                   /codon_start=1
FT                   /gene="Manbal"
FT                   /locus_tag="mCG_21970"
FT                   /product="mannosidase, beta A, lysosomal-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21970.2 transcript_id=mCT22216.2
FT                   protein_id=mCP23020.2 isoform=CRA_a"
FT                   /protein_id="EDL06232.1"
FT                   /translation="WQWCLGPWPPTWASHLLRCLSPPSWRTCCGMDSSWEPSSSSSVSW
FT                   PSSYPFPSPTRRRQNRLSPEVQRGRRSPRLPSLPPTRGRRRRRRRSDRILESEAEEPKA
FT                   AASGTALLGTSILFALTDCLCPRLRV"
FT   assembly_gap    6077069..6077088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6083470..6083489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6084814..6084833
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6085910..6085929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6087067..6087086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6090558..6090577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6099815..6101180
FT                   /estimated_length=1366
FT                   /gap_type="unknown"
FT   assembly_gap    6112137..6112488
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    6115934..6115953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6118596..6118615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6123393..6123806
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   gene            6124097..6171285
FT                   /gene="Src"
FT                   /locus_tag="mCG_21979"
FT                   /note="gene_id=mCG21979.2"
FT   mRNA            join(6124097..6124200,6155066..6155242,6156560..6156814,
FT                   6157986..6158085,6158295..6158312,6162161..6162259,
FT                   6162430..6162533,6164082..6164231,6165326..6165481,
FT                   6166884..6167063,6167936..6168012,6168578..6168731,
FT                   6168843..6168974,6169206..6171285)
FT                   /gene="Src"
FT                   /locus_tag="mCG_21979"
FT                   /product="Rous sarcoma oncogene"
FT                   /note="gene_id=mCG21979.2 transcript_id=mCT22226.1 created
FT                   on 06-SEP-2002"
FT   assembly_gap    6135756..6135985
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    6144014..6144205
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   CDS             join(6156568..6156814,6157986..6158085,6158295..6158312,
FT                   6162161..6162259,6162430..6162533,6164082..6164231,
FT                   6165326..6165481,6166884..6167063,6167936..6168012,
FT                   6168578..6168731,6168843..6168974,6169206..6169414)
FT                   /codon_start=1
FT                   /gene="Src"
FT                   /locus_tag="mCG_21979"
FT                   /product="Rous sarcoma oncogene"
FT                   /note="gene_id=mCG21979.2 transcript_id=mCT22226.1
FT                   protein_id=mCP22997.1"
FT                   /db_xref="GOA:P05480"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="MGI:MGI:98397"
FT                   /db_xref="UniProtKB/Swiss-Prot:P05480"
FT                   /protein_id="EDL06234.1"
FT                   /translation="MGSNKSKPKDASQRRRSLEPSENVHGAGGAFPASQTPSKPASADG
FT                   HRGPSAAFVPPAAEPKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSF
FT                   KKGERLQIVNNTRKVDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITR
FT                   RESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYI
FT                   TSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKL
FT                   GQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEE
FT                   PIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAAN
FT                   ILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGI
FT                   LLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTF
FT                   EYLQAFLEDYFTSTEPQYQPGENL"
FT   assembly_gap    6173640..6173746
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    6174593..6174719
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    6179402..6179421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6185570..6185589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6187977..6188138
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    6205820..6205968
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            complement(6221212..6221647)
FT                   /pseudo
FT                   /locus_tag="mCG_21981"
FT                   /note="gene_id=mCG21981.2"
FT   mRNA            complement(6221212..6221647)
FT                   /pseudo
FT                   /locus_tag="mCG_21981"
FT                   /note="gene_id=mCG21981.2 transcript_id=mCT22227.2 created
FT                   on 06-SEP-2002"
FT   assembly_gap    6227432..6227861
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    6234008..6234095
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    6242406..6242489
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            complement(6255079..6265079)
FT                   /gene="Blcap"
FT                   /locus_tag="mCG_21983"
FT                   /note="gene_id=mCG21983.2"
FT   mRNA            complement(join(6255079..6257044,6264937..6265079))
FT                   /gene="Blcap"
FT                   /locus_tag="mCG_21983"
FT                   /product="bladder cancer associated protein homolog
FT                   (human), transcript variant mCT172503"
FT                   /note="gene_id=mCG21983.2 transcript_id=mCT172503.0 created
FT                   on 06-SEP-2002"
FT   mRNA            complement(join(6255079..6257044,6264965..6265068))
FT                   /gene="Blcap"
FT                   /locus_tag="mCG_21983"
FT                   /product="bladder cancer associated protein homolog
FT                   (human), transcript variant mCT22229"
FT                   /note="gene_id=mCG21983.2 transcript_id=mCT22229.1 created
FT                   on 06-SEP-2002"
FT   CDS             complement(6256607..6256870)
FT                   /codon_start=1
FT                   /gene="Blcap"
FT                   /locus_tag="mCG_21983"
FT                   /product="bladder cancer associated protein homolog
FT                   (human), isoform CRA_a"
FT                   /note="gene_id=mCG21983.2 transcript_id=mCT172503.0
FT                   protein_id=mCP95422.0 isoform=CRA_a"
FT                   /protein_id="EDL06235.1"
FT                   /translation="MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTI
FT                   CALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT"
FT   CDS             complement(6256607..6256870)
FT                   /codon_start=1
FT                   /gene="Blcap"
FT                   /locus_tag="mCG_21983"
FT                   /product="bladder cancer associated protein homolog
FT                   (human), isoform CRA_a"
FT                   /note="gene_id=mCG21983.2 transcript_id=mCT22229.1
FT                   protein_id=mCP23011.1 isoform=CRA_a"
FT                   /protein_id="EDL06236.1"
FT                   /translation="MYCLQWLLPVLLIPKPLNPALWFSHSMFMGFYLLSFLLERKPCTI
FT                   CALVFLAALFLICYSCWGNCFLYHCSDSPLPESAHDPGVVGT"
FT   gene            <6258827..6264903
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /note="gene_id=mCG21985.2"
FT   mRNA            join(<6258827..6258977,6260259..6260866)
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, transcript variant mCT172508"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172508.0 created
FT                   on 06-SEP-2002"
FT   CDS             join(<6258829..6258977,6260259..6260499)
FT                   /codon_start=1
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, isoform CRA_b"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172508.0
FT                   protein_id=mCP95425.0 isoform=CRA_b"
FT                   /protein_id="EDL06238.1"
FT                   /translation="CAQQRTPRPVDLGEPLLSTTHPLSEPWPQWQQPRQNCSSSAGTSS
FT                   ACCCRCSGTPCRSWRTRCPGPGGRCWGSAGSEPPTEAPAPSPGRPCHQVLLCFSTSMGA
FT                   SAAQEWGVPCVPSSEEHLPRSVRGR"
FT   mRNA            join(6258840..6258977,6259930..6260010,6260259..6261221)
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, transcript variant mCT22231"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT22231.1 created
FT                   on 06-SEP-2002"
FT   mRNA            join(<6258847..6258977,6263700..6263880,6264351..6264903)
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, transcript variant mCT172509"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172509.0 created
FT                   on 06-SEP-2002"
FT   CDS             join(<6258849..6258977,6263700..6263880,6264351..6264712)
FT                   /codon_start=1
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, isoform CRA_d"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172509.0
FT                   protein_id=mCP95429.0 isoform=CRA_d"
FT                   /protein_id="EDL06240.1"
FT                   /translation="ETSRPRRTLALDHPPTFGTMAAVAAASAELLIIGWYIFRVLLQGS
FT                   YHTRIQIPEHSQGRARRQRGRQYRALGKSHSHKLEWNACISKRTSKKGSLTLIPLEITA
FT                   RHSVPSAALECHSPQTGEGTGVQTRRKVGGSEKHTGPVADGHPITPDTKESVRGPLLLS
FT                   PHTPSDKGGGRKRKKKGGGRETEVARKECPASQKLSPSPRSGTEEVVVAPAPPSPVPGA
FT                   R"
FT   mRNA            join(6258856..6258977,6259165..6259252,6260259..6260562)
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, transcript variant mCT172506"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172506.0 created
FT                   on 06-SEP-2002"
FT   mRNA            join(<6258866..6258977,6259930..6259956,6260259..6260719)
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, transcript variant mCT172510"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172510.0 created
FT                   on 06-SEP-2002"
FT   mRNA            join(<6258866..6258977,6259930..6260005,6260259..6260670)
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, transcript variant mCT172507"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172507.0 created
FT                   on 06-SEP-2002"
FT   CDS             join(<6258866..6258977,6259930..6260005,6260259..6260499)
FT                   /codon_start=1
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, isoform CRA_c"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172507.0
FT                   protein_id=mCP95428.0 isoform=CRA_c"
FT                   /protein_id="EDL06239.1"
FT                   /translation="ANPCSRPPTHFRNHGRSGSSLGRTAHHRLVHLPRAAAGVPGMLHL
FT                   LGRIRFSKSSRDTAHCEKCSGTPCRSWRTRCPGPGGRCWGSAGSEPPTEAPAPSPGRPC
FT                   HQVLLCFSTSMGASAAQEWGVPCVPSSEEHLPRSVRGR"
FT   CDS             join(<6258868..6258977,6259930..6259956,6260259..6260499)
FT                   /codon_start=1
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, isoform CRA_g"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172510.0
FT                   protein_id=mCP95427.0 isoform=CRA_g"
FT                   /protein_id="EDL06243.1"
FT                   /translation="EPLLSTTHPLSEPWPQWQQPRQNCSSSAGTSSACCCRCSWNAAFT
FT                   GCSGTPCRSWRTRCPGPGGRCWGSAGSEPPTEAPAPSPGRPCHQVLLCFSTSMGASAAQ
FT                   EWGVPCVPSSEEHLPRSVRGR"
FT   CDS             join(6258906..6258977,6259165..6259252,6260259..6260488)
FT                   /codon_start=1
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, isoform CRA_a"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172506.0
FT                   protein_id=mCP95430.0 isoform=CRA_a"
FT                   /db_xref="GOA:G3X9K1"
FT                   /db_xref="InterPro:IPR024885"
FT                   /db_xref="MGI:MGI:104716"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9K1"
FT                   /protein_id="EDL06237.1"
FT                   /translation="MAAVAAASAELLIIGWYIFRVLLQTLSPVRPRPAGNKDSGVRRSP
FT                   AADDRDQRGVQVLPAEAGAHGVPDRAAGAGGAQAASPQLRPQLPALGGRVIRCSCASRP
FT                   AWEPVPRRNGGSPVFPRQRSTCQGQ"
FT   CDS             join(6258906..6258977,6259930..6260010,6260259..6260351)
FT                   /codon_start=1
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, isoform CRA_f"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT22231.1
FT                   protein_id=mCP23013.2 isoform=CRA_f"
FT                   /protein_id="EDL06242.1"
FT                   /translation="MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQ
FT                   PIARSEVFRYSLQKLAHTVSRTGRQVLGERRQRAPN"
FT   mRNA            join(<6259726..6260010,6260259..6260572)
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, transcript variant mCT172511"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172511.0 created
FT                   on 06-SEP-2002"
FT   CDS             join(<6259961..6260010,6260259..6260499)
FT                   /codon_start=1
FT                   /gene="Nnat"
FT                   /locus_tag="mCG_21985"
FT                   /product="neuronatin, isoform CRA_e"
FT                   /note="gene_id=mCG21985.2 transcript_id=mCT172511.0
FT                   protein_id=mCP95426.0 isoform=CRA_e"
FT                   /protein_id="EDL06241.1"
FT                   /translation="DSLFEILQGHSPLREVRCSGTPCRSWRTRCPGPGGRCWGSAGSEP
FT                   PTEAPAPSPGRPCHQVLLCFSTSMGASAAQEWGVPCVPSSEEHLPRSVRGR"
FT   assembly_gap    6269157..6269225
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    6281922..6281941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6294051..>6295789)
FT                   /locus_tag="mCG_140972"
FT                   /note="gene_id=mCG140972.0"
FT   mRNA            complement(join(6294051..6294453,6295563..>6295789))
FT                   /locus_tag="mCG_140972"
FT                   /product="mCG140972"
FT                   /note="gene_id=mCG140972.0 transcript_id=mCT172491.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(6294194..>6294436)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140972"
FT                   /product="mCG140972"
FT                   /note="gene_id=mCG140972.0 transcript_id=mCT172491.0
FT                   protein_id=mCP95410.0"
FT                   /protein_id="EDL06244.1"
FT                   /translation="GKLQPVAEEWAEDLKSQKNRGFACEIVSPRNVRSCGHKVFLTRLP
FT                   THGLNKDDASRHAHVGRGSGAYGASKLQLQAAKEC"
FT   assembly_gap    6301665..6301684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6303472..6303577
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    6320853..6320872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6323976..6323995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6343943..6343962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6345770..6345842
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    6348383..6349448
FT                   /estimated_length=1066
FT                   /gap_type="unknown"
FT   assembly_gap    6380907..6381234
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    6382278..6382395
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    6388415..6388656
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    6397009..6397230
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    6401171..6401677
FT                   /estimated_length=507
FT                   /gap_type="unknown"
FT   assembly_gap    6412860..6412879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6418163..6418182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6423294..6423805
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   gene            6431265..6586994
FT                   /gene="Ctnnbl1"
FT                   /locus_tag="mCG_140973"
FT                   /note="gene_id=mCG140973.0"
FT   mRNA            join(6431265..6431384,6469970..6470158,6475288..6475394,
FT                   6484433..6484572,6494883..6494980,6502131..6502224,
FT                   6504925..6505016,6513195..6513267,6513491..6513549,
FT                   6514894..6515042,6531695..6531876,6563654..6563751,
FT                   6566458..6566538,6579484..6579621,6579779..6579851,
FT                   6586276..6586994)
FT                   /gene="Ctnnbl1"
FT                   /locus_tag="mCG_140973"
FT                   /product="catenin, beta like 1"
FT                   /note="gene_id=mCG140973.0 transcript_id=mCT172493.0
FT                   created on 06-SEP-2002"
FT   CDS             join(6431355..6431384,6469970..6470158,6475288..6475394,
FT                   6484433..6484572,6494883..6494980,6502131..6502224,
FT                   6504925..6505016,6513195..6513267,6513491..6513549,
FT                   6514894..6515042,6531695..6531876,6563654..6563751,
FT                   6566458..6566538,6579484..6579621,6579779..6579851,
FT                   6586276..6586364)
FT                   /codon_start=1
FT                   /gene="Ctnnbl1"
FT                   /locus_tag="mCG_140973"
FT                   /product="catenin, beta like 1"
FT                   /note="gene_id=mCG140973.0 transcript_id=mCT172493.0
FT                   protein_id=mCP95411.0"
FT                   /protein_id="EDL06245.1"
FT                   /translation="MDVGELLSYQPNRGTKRPRDDEEEELKTRRKQTGPRERGRYREEE
FT                   ATAAEDTADDKKRLLQIIDRDGEEEEEEEEPLDESSVKKMILTFEKRSYKNQELRIKFP
FT                   DNPEKFMESELDLNDIIQEMHVVATMPDLYHLLVELSAVQSLLGLLGHDNTDVSIAVVD
FT                   LLQELTDIDTLHESEEGAEVLIDALVDGQVVALLVQNLERLDESVREEADGVHNTLAIV
FT                   ENMAEFRPEMCTEAAQQGLLQWLLKRLKAKMPFDANKLYCSEVLAILLQDNDENRELLG
FT                   ELDGIDVLLQQLSVFKRHNPSTAEEQEMMENLFDALCSCLMLSSNRERFLKGEGLQLMN
FT                   LMLREKKVSRSSALKVLDHAMIGPEGTDNCHKFVDILGLRTIFPLFMKSPRKIKKVGTT
FT                   EKEHEEHVCSILASLLRNLRGQQRTRLLNKFTENDSEKVDRLMELHFKYLSAMQVADKK
FT                   IEGEKHDIVRRGEIIDNDMEDEFYLRRLDAGLFILQHICYIMAEICNANVPQIRQRVHQ
FT                   ILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRETEQKRILALLENF"
FT   assembly_gap    6431658..6431790
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    6466485..6466504
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6474584..6474608
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    6477345..6477480
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    6518205..6518224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6550336..6550373
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    6585193..6585212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6596813..6597888
FT                   /locus_tag="mCG_21975"
FT                   /note="gene_id=mCG21975.2"
FT   mRNA            6596813..6597888
FT                   /locus_tag="mCG_21975"
FT                   /product="mCG21975"
FT                   /note="gene_id=mCG21975.2 transcript_id=mCT22219.2 created
FT                   on 06-SEP-2002"
FT   CDS             6596899..6597375
FT                   /codon_start=1
FT                   /locus_tag="mCG_21975"
FT                   /product="mCG21975"
FT                   /note="gene_id=mCG21975.2 transcript_id=mCT22219.2
FT                   protein_id=mCP22995.1"
FT                   /protein_id="EDL06246.1"
FT                   /translation="MSGIALSRLAQERKAWRKDHPFGFVAVPTKNPDGTMNLMNGECAI
FT                   PGKKGTPWEGGLFKLRMLFKDDYPSSPPKCKFEPPLFHPNVYPSGTVCLSILEEDKDWR
FT                   PAITIKQILLGIQELLNEPNIQDPAQAEAYTIYCQNRVEYEKRVRAQAKKFAPS"
FT   assembly_gap    6598876..6599037
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            <6610123..6640081
FT                   /gene="Gm691"
FT                   /locus_tag="mCG_140974"
FT                   /note="gene_id=mCG140974.0"
FT   mRNA            join(<6610123..6610207,6610461..6610537,6631028..6631197,
FT                   6632894..6632944,6639559..6640081)
FT                   /gene="Gm691"
FT                   /locus_tag="mCG_140974"
FT                   /product="gene model 691, (NCBI)"
FT                   /note="gene_id=mCG140974.0 transcript_id=mCT172492.0
FT                   created on 06-SEP-2002"
FT   CDS             join(<6610125..6610207,6610461..6610537,6631028..6631197,
FT                   6632894..6632944,6639559..6639825)
FT                   /codon_start=1
FT                   /gene="Gm691"
FT                   /locus_tag="mCG_140974"
FT                   /product="gene model 691, (NCBI)"
FT                   /note="gene_id=mCG140974.0 transcript_id=mCT172492.0
FT                   protein_id=mCP95412.0"
FT                   /protein_id="EDL06247.1"
FT                   /translation="GLGVRSLPAAGAGPGPAGEGGGGAGQGTALFLQLGGATRPAGHAP
FT                   WDNHVSGHALFTETPHDMTARTGEDVEMACSFRGSGSPSYSLEIQWWYLRSHRDWTDKQ
FT                   TWASNQLKASQQEDSGKDATKISVVKVVGSNISHKLRLSRVKPTDEGTYECRVIDFSDG
FT                   KARHHKVKAYLRVQPGENSVLQLPDAPPAAPAPPPKPGRELRKRSLPEACSL"
FT   assembly_gap    6610216..6610460
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    6613995..6614014
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6623742..6623761
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6629362..6629381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6629921..6630042
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    6672268..6672510
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   gene            complement(6677304..6725411)
FT                   /gene="2610036D13Rik"
FT                   /locus_tag="mCG_15747"
FT                   /note="gene_id=mCG15747.1"
FT   mRNA            complement(join(6677304..6677961,6688468..6688555,
FT                   6688854..6689058,6690881..6691021,6692577..6692725,
FT                   6696096..6696284,6702495..6704834,6725393..6725411))
FT                   /gene="2610036D13Rik"
FT                   /locus_tag="mCG_15747"
FT                   /product="RIKEN cDNA 2610036D13"
FT                   /note="gene_id=mCG15747.1 transcript_id=mCT20107.2 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(6677775..6677961,6688468..6688555,
FT                   6688854..6689058,6690881..6691021,6692577..6692725,
FT                   6696096..6696284,6702495..6704793))
FT                   /codon_start=1
FT                   /gene="2610036D13Rik"
FT                   /locus_tag="mCG_15747"
FT                   /product="RIKEN cDNA 2610036D13"
FT                   /note="gene_id=mCG15747.1 transcript_id=mCT20107.2
FT                   protein_id=mCP22966.1"
FT                   /db_xref="GOA:Q91V83"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016441"
FT                   /db_xref="MGI:MGI:1922675"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91V83"
FT                   /protein_id="EDL06248.1"
FT                   /translation="MAVFDTPEEAFGVLRPVCVQLTKTQTVENVEHLQTQLQAISDTAL
FT                   QELQQYILFPLRFALKTPGPKRERLVQSVVECLTFVLSSTCVREQELLQELFSELSACL
FT                   YSPSSQKPAALSEELKLAVIQGLSTLMHSAYRDIILTFYEPSILPRLGFAVSLLLGLAE
FT                   QEKSKQIKIAALQCLQVLLLQCDCQDHPRPLDELEQQQLGDLLASFLPGISTALTRIIT
FT                   GDFKQGHSIVVSSLKVFYKTVGFIMADEQLTRIPKAQAKPVVEHRVAALMIHREADWVK
FT                   STGDKLAIFIKKIIDCVSVHPHWKVRLELVEFVEILLLKCTQSLVESTGPLLKVLVGLV
FT                   NDESPEVQARCSTVLRRLADQKVVVGSRALADILSESLHSLATSLPRLMNTQDDQGKFS
FT                   TLSLLLGYLKLLGPKVHVILNSVAHVQRLSRALIQVLELEVTDVKMVEERRWNSDNLSA
FT                   SAEVSAARPWSRVQRRYFRCFTDERVFLLLRKICQLLGYYGDLYLLVDHFMELYHTSVV
FT                   YRKQAAMILNELVVGAAGLDVEDIHNKCPSMGPEELREIVKSILEEYTSQENWYLITCF
FT                   EAEEGEEVMMKQQGFQAVTSGVHTCQVVSFPALSKPSPTICSMNSNIWQICIQLEGIGQ
FT                   FAYALGKDFRLLLMSALYPILEKAGDPTLLISQVATSTMVDICHACGYNSVQHLINQNS
FT                   DYLVNGISLNLRHLALHPHAPKVLEAMLRNADASLLPLVADVVQDVLATLDQFYDKRAA
FT                   SFVSVLHALLAALAHWFPDSGSTGQLQQRSLEEEGRQLPAAGEASTTAEDIEQFVLSYL
FT                   QEKDVAEGNVSDLEAEEEVQSAPPKVDENDTLPDVEPPLPTHIQIAKDVMERCIHLSAD
FT                   KNLKIRLKVLDVLGLCVEVLQTHKNQLLPLAHRAWPSLVHRLTSDDPLAVLRAFKVLQT
FT                   LGSRCGDFLRSRFCKDVLPKLTSSLITQAPISARAGPVYSHTLAFKLQLAVLQGLGPLC
FT                   ENLDLGEGDLNKVADACVIYLSTKQPVKLQEAARSVFLHLMRVDPDSTWLLLHELYCPV
FT                   QQFTAPHPSLHPVQLQGATQPQNPYATNVCHLLLQLQ"
FT   gene            <6690697..6704038
FT                   /locus_tag="mCG_141089"
FT                   /note="gene_id=mCG141089.0"
FT   mRNA            join(<6690697..6690939,6703780..6704038)
FT                   /locus_tag="mCG_141089"
FT                   /product="mCG141089"
FT                   /note="gene_id=mCG141089.0 transcript_id=mCT172982.0
FT                   created on 09-SEP-2002"
FT   CDS             join(<6690810..6690939,6703780..6703922)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141089"
FT                   /product="mCG141089"
FT                   /note="gene_id=mCG141089.0 transcript_id=mCT172982.0
FT                   protein_id=mCP95901.0"
FT                   /protein_id="EDL06249.1"
FT                   /translation="SDAEDGGSLCASDLHPMTDRGVSTLKALSTARGSSLVSRCTSEGQ
FT                   LTPSRGVPWIQPGTECTSKAGFPQTLPVPASPSSVGERRHSQLSF"
FT   assembly_gap    6712630..6713647
FT                   /estimated_length=1018
FT                   /gap_type="unknown"
FT   gene            6725513..6776526
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /note="gene_id=mCG15734.1"
FT   mRNA            join(6725513..6726064,6733020..6733149,6740398..6740531,
FT                   6744908..6745020,6747063..6747189,6757865..6758040,
FT                   6774143..6776526)
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /product="RIKEN cDNA 2610304G08, transcript variant
FT                   mCT20095"
FT                   /note="gene_id=mCG15734.1 transcript_id=mCT20095.1 created
FT                   on 09-SEP-2002"
FT   mRNA            join(<6725709..6726064,6740398..6740531,6744911..6745020,
FT                   6747063..6747189,6757865..6758040,6774143..6775579)
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /product="RIKEN cDNA 2610304G08, transcript variant
FT                   mCT189919"
FT                   /note="gene_id=mCG15734.1 transcript_id=mCT189919.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<6725709..6726064,6740398..6740531,6744911..6745020,
FT                   6747063..6747189,6757865..6758040,6769774..6769869,
FT                   6774143..6774280)
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /product="RIKEN cDNA 2610304G08, transcript variant
FT                   mCT172979"
FT                   /note="gene_id=mCG15734.1 transcript_id=mCT172979.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(<6725718..6726064,6740398..6740531,6744911..6745020,
FT                   6747063..6747189,6757865..6758040,6774143..6774292)
FT                   /codon_start=1
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /product="RIKEN cDNA 2610304G08, isoform CRA_c"
FT                   /note="gene_id=mCG15734.1 transcript_id=mCT189919.0
FT                   protein_id=mCP110908.0 isoform=CRA_c"
FT                   /protein_id="EDL06252.1"
FT                   /translation="EVGWPSCGGGAGGCYCGDLSPPPTWYPELSVSRRRALQPVSGGLG
FT                   RVRSLSPSHRAARAAPHHRHHVLLLRIGAGKEALRAEQLSAERADPLPVAHPPPQARRT
FT                   HRLRVAPRAPQREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAEE
FT                   KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKI
FT                   ASLPQEVQDVSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVE
FT                   YTQNQKEVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSA
FT                   GDLFSTD"
FT   CDS             join(<6725718..6726064,6740398..6740531,6744911..6745020,
FT                   6747063..6747189,6757865..6758040,6769774..6769827)
FT                   /codon_start=1
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /product="RIKEN cDNA 2610304G08, isoform CRA_a"
FT                   /note="gene_id=mCG15734.1 transcript_id=mCT172979.0
FT                   protein_id=mCP95898.0 isoform=CRA_a"
FT                   /protein_id="EDL06250.1"
FT                   /translation="EVGWPSCGGGAGGCYCGDLSPPPTWYPELSVSRRRALQPVSGGLG
FT                   RVRSLSPSHRAARAAPHHRHHVLLLRIGAGKEALRAEQLSAERADPLPVAHPPPQARRT
FT                   HRLRVAPRAPQREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAEE
FT                   KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKI
FT                   ASLPQEVQDVSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVE
FT                   YTQNQKEVLSEKEKKLERLTQQLQPCSDPQNVSF"
FT   mRNA            join(<6725813..6726064,6733020..6733149,6740398..6740531,
FT                   6744911..6745020,6747063..6747189,6757865..6758040,
FT                   6774143..6776526)
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /product="RIKEN cDNA 2610304G08, transcript variant
FT                   mCT189918"
FT                   /note="gene_id=mCG15734.1 transcript_id=mCT189918.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<6725815..6726064,6733020..6733149,6740398..6740531,
FT                   6744911..6745020,6747063..6747189,6757865..6758040,
FT                   6774143..6774292)
FT                   /codon_start=1
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /product="RIKEN cDNA 2610304G08, isoform CRA_b"
FT                   /note="gene_id=mCG15734.1 transcript_id=mCT189918.0
FT                   protein_id=mCP110907.0 isoform=CRA_b"
FT                   /protein_id="EDL06251.1"
FT                   /translation="GGEPCSLSAEAWAECGRFPRLIGRPGLLPTTATMSSFSESALEKK
FT                   LSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSK
FT                   RKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSME
FT                   DSKSPPPKAEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENA
FT                   ASGDATVRQKIASLPQEVQDVSLLEKITDKEAAERLSKTVDEACLLLAEYNGRLAAELE
FT                   DRRQLARMLVEYTQNQKEVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSLLPN
FT                   VTGGLAPLPSAGDLFSTD"
FT   CDS             join(6725914..6726064,6733020..6733149,6740398..6740531,
FT                   6744908..6745020,6747063..6747189,6757865..6758040,
FT                   6774143..6774292)
FT                   /codon_start=1
FT                   /gene="2610304G08Rik"
FT                   /locus_tag="mCG_15734"
FT                   /product="RIKEN cDNA 2610304G08, isoform CRA_d"
FT                   /note="gene_id=mCG15734.1 transcript_id=mCT20095.1
FT                   protein_id=mCP23032.1 isoform=CRA_d"
FT                   /protein_id="EDL06253.1"
FT                   /translation="MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWH
FT                   RELRKAKSNRKLTFLYLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPL
FT                   ERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKAAEEKKSLKRTFQQIQEEEDDDYPG
FT                   SYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITDKEA
FT                   AERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKEVLSEKEKKLEEYKQ
FT                   KLARVTQVRKELKSHIQSLPDLSLLPNVTGGLAPLPSAGDLFSTD"
FT   assembly_gap    6735953..6735972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6747850..6747869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6749256..6749275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6752174..6752313
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   gene            complement(6752389..7454246)
FT                   /locus_tag="mCG_147180"
FT                   /note="gene_id=mCG147180.0"
FT   mRNA            complement(join(6752389..6752572,7453240..7454246))
FT                   /locus_tag="mCG_147180"
FT                   /product="mCG147180"
FT                   /note="gene_id=mCG147180.0 transcript_id=mCT187443.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    6753672..6753691
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6754773..6754792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6776790..6776809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6785642..6786326
FT                   /estimated_length=685
FT                   /gap_type="unknown"
FT   assembly_gap    6789916..6791451
FT                   /estimated_length=1536
FT                   /gap_type="unknown"
FT   assembly_gap    6792618..6792637
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6796743..6796918
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    6800054..6800168
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    6806982..6807040
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    6816093..6816184
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   gene            complement(6816185..6846169)
FT                   /gene="Tgm2"
FT                   /locus_tag="mCG_15741"
FT                   /note="gene_id=mCG15741.2"
FT   mRNA            complement(join(6816185..6817627,6818525..6818661,
FT                   6819803..6819963,6823798..6824067,6826781..6827023,
FT                   6828308..6828411,6828993..6829128,6831001..6831178,
FT                   6832099..6832227,6833921..6834039,6838374..6838616,
FT                   6842665..6842844,6846067..6846169))
FT                   /gene="Tgm2"
FT                   /locus_tag="mCG_15741"
FT                   /product="transglutaminase 2, C polypeptide, transcript
FT                   variant mCT20102"
FT                   /note="gene_id=mCG15741.2 transcript_id=mCT20102.2 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(6816764..6816819,6816847..6817627,
FT                   6818525..6818661,6819803..6819963,6823798..6824067,
FT                   6826781..6827023,6828308..6828411,6828993..6829128,
FT                   6831001..6831178,6832099..6832227,6833921..6834039,
FT                   6838374..6838616,6842665..6842844,6846067..>6846133))
FT                   /gene="Tgm2"
FT                   /locus_tag="mCG_15741"
FT                   /product="transglutaminase 2, C polypeptide, transcript
FT                   variant mCT189886"
FT                   /note="gene_id=mCG15741.2 transcript_id=mCT189886.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(6817477..6817627,6818525..6818661,
FT                   6819803..6819963,6823798..6824067,6826781..6827023,
FT                   6828308..6828411,6828993..6829128,6831001..6831178,
FT                   6832099..6832227,6833921..6834039,6838374..6838616,
FT                   6842665..6842844,6846067..>6846097))
FT                   /codon_start=1
FT                   /gene="Tgm2"
FT                   /locus_tag="mCG_15741"
FT                   /product="transglutaminase 2, C polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG15741.2 transcript_id=mCT189886.0
FT                   protein_id=mCP110871.0 isoform=CRA_a"
FT                   /protein_id="EDL06255.1"
FT                   /translation="AVAASLAMAEELLLERCDLEIQANGRDHHTADLCQEKLVLRRGQR
FT                   FRLTLYFEGRGYEASVDSLTFGAVTGPDPSEEAGTKARFSLSDNVEEGSWSASVLDQQD
FT                   NVLSLQLCTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLYNAWCPADDVYLDSEEER
FT                   REYVLTQQGFIYQGSVKFIKSVPWNFGQFEDGILDTCLMLLDMNPKFLKNRSRDCSRRS
FT                   SPIYVGRVVSAMVNCNDDQGVLLGRWDNNYGDGISPMAWIGSVDILRRWKEHGCQQVKY
FT                   GQCWVFAAVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGELESNKSEMIWN
FT                   FHCWVESWMTRPDLQPGYEGWQAIDPTPQEKSEGTYCCGPVSVRAIKEGDLSTKYDAPF
FT                   VFAEVNADVVDWIRQEDGSVLKSINRSLVVGQKISTKSVGRDDREDITHTYKYPEGSPE
FT                   EREVFTKANHLNKLAEKEETGVAMRIRVGDSMSMGNDFDVFAHIGNDTSETRECRLLLC
FT                   ARTVSYNGVLGPECGTEDINLTLDPYSENSIPLRILYEKYSGCLTESNLIKVRGLLIEP
FT                   AANSYLLAERDLYLENPEIKIRVLGEPKQNRKLVAEVSLKNPLSDPLYDCIFTVEGAGL
FT                   TKEQKSVEVSDPVPAGDLVKARVDLFPTDIGLHKLVVNFQCDKLKSVKGYRNVIIGPA"
FT   CDS             complement(join(6817477..6817627,6818525..6818661,
FT                   6819803..6819963,6823798..6824067,6826781..6827023,
FT                   6828308..6828411,6828993..6829128,6831001..6831178,
FT                   6832099..6832227,6833921..6834039,6838374..6838616,
FT                   6842665..6842844,6846067..6846076))
FT                   /codon_start=1
FT                   /gene="Tgm2"
FT                   /locus_tag="mCG_15741"
FT                   /product="transglutaminase 2, C polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG15741.2 transcript_id=mCT20102.2
FT                   protein_id=mCP22961.2 isoform=CRA_b"
FT                   /protein_id="EDL06256.1"
FT                   /translation="MAEELLLERCDLEIQANGRDHHTADLCQEKLVLRRGQRFRLTLYF
FT                   EGRGYEASVDSLTFGAVTGPDPSEEAGTKARFSLSDNVEEGSWSASVLDQQDNVLSLQL
FT                   CTPANAPIGLYRLSLEASTGYQGSSFVLGHFILLYNAWCPADDVYLDSEEERREYVLTQ
FT                   QGFIYQGSVKFIKSVPWNFGQFEDGILDTCLMLLDMNPKFLKNRSRDCSRRSSPIYVGR
FT                   VVSAMVNCNDDQGVLLGRWDNNYGDGISPMAWIGSVDILRRWKEHGCQQVKYGQCWVFA
FT                   AVACTVLRCLGIPTRVVTNYNSAHDQNSNLLIEYFRNEFGELESNKSEMIWNFHCWVES
FT                   WMTRPDLQPGYEGWQAIDPTPQEKSEGTYCCGPVSVRAIKEGDLSTKYDAPFVFAEVNA
FT                   DVVDWIRQEDGSVLKSINRSLVVGQKISTKSVGRDDREDITHTYKYPEGSPEEREVFTK
FT                   ANHLNKLAEKEETGVAMRIRVGDSMSMGNDFDVFAHIGNDTSETRECRLLLCARTVSYN
FT                   GVLGPECGTEDINLTLDPYSENSIPLRILYEKYSGCLTESNLIKVRGLLIEPAANSYLL
FT                   AERDLYLENPEIKIRVLGEPKQNRKLVAEVSLKNPLSDPLYDCIFTVEGAGLTKEQKSV
FT                   EVSDPVPAGDLVKARVDLFPTDIGLHKLVVNFQCDKLKSVKGYRNVIIGPA"
FT   assembly_gap    6843490..6843660
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    6850351..6850370
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6855283..6855302
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6858195..6858214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6891578..6895297
FT                   /locus_tag="mCG_141088"
FT                   /note="gene_id=mCG141088.0"
FT   mRNA            join(<6891578..6891628,6893679..6893836,6894914..6895297)
FT                   /locus_tag="mCG_141088"
FT                   /product="mCG141088"
FT                   /note="gene_id=mCG141088.0 transcript_id=mCT172977.0
FT                   created on 10-SEP-2002"
FT   CDS             join(<6893770..6893836,6894914..6895146)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141088"
FT                   /product="mCG141088"
FT                   /note="gene_id=mCG141088.0 transcript_id=mCT172977.0
FT                   protein_id=mCP95896.0"
FT                   /protein_id="EDL06257.1"
FT                   /translation="QAWMEMADQIPGASSAFWMQGLGCCPLPTRVSSWEYACCDAPPQT
FT                   GVSRVQLLSLLSPDWPQLDGTCLTNALKFPPSAYPPPGGSWGHCQMQSPCFRVC"
FT   gene            complement(6895317..>6920359)
FT                   /gene="D630003M21Rik"
FT                   /locus_tag="mCG_113933"
FT                   /note="gene_id=mCG113933.1"
FT   mRNA            complement(join(6895317..6896221,6899688..6899900,
FT                   6900495..6900617,6902605..6902743,6904097..6904245,
FT                   6905137..6905235,6908100..6908216,6911343..6911436,
FT                   6913111..6913234,6915585..6915767,6916190..6917534,
FT                   6920156..>6920359))
FT                   /gene="D630003M21Rik"
FT                   /locus_tag="mCG_113933"
FT                   /product="RIKEN cDNA D630003M21, transcript variant
FT                   mCT115022"
FT                   /note="gene_id=mCG113933.1 transcript_id=mCT115022.1
FT                   created on 10-SEP-2002"
FT   mRNA            complement(join(6895318..6896221,6899688..6899900,
FT                   6900495..6900617,6902605..6902743,6904097..6904245,
FT                   6905137..6905235,6908100..6908216,6909844..6909927,
FT                   6911343..6911436,6913111..6913234,6915585..6915767,
FT                   6916190..6917534,6920156..>6920359))
FT                   /gene="D630003M21Rik"
FT                   /locus_tag="mCG_113933"
FT                   /product="RIKEN cDNA D630003M21, transcript variant
FT                   mCT189883"
FT                   /note="gene_id=mCG113933.1 transcript_id=mCT189883.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6895529..6896221,6899688..6899900,
FT                   6900495..6900617,6902605..6902743,6904097..6904245,
FT                   6905137..6905235,6908100..6908216,6911343..6911436,
FT                   6913111..6913234,6915585..6915767,6916190..6917534,
FT                   6920156..>6920359))
FT                   /codon_start=1
FT                   /gene="D630003M21Rik"
FT                   /locus_tag="mCG_113933"
FT                   /product="RIKEN cDNA D630003M21, isoform CRA_a"
FT                   /note="gene_id=mCG113933.1 transcript_id=mCT115022.1
FT                   protein_id=mCP73203.1 isoform=CRA_a"
FT                   /protein_id="EDL06258.1"
FT                   /translation="HQDPSALDMAIQHALAGLYPPFEATAPTVLGQVFRLLDSDFRGDG
FT                   LSFLLDFLIPAKRLCEQVREAACALYTHCLFLHEGWPLCLRDEVVVHLAPLNPLLLRQG
FT                   DFYLQVESWEEQSVHMTLKCLSSDLREVDKKPIPESSYSLIFTPEWLEAINNDFEGRPL
FT                   HNCLVASENGITPVPWTKITSPEFVDDRPPIVKVPSSDGDSCPLEDLHLSRPQEPYQAG
FT                   DLGGKGSVAQIWDKGKGKLSGDKYPGLIKVEPARSGQLAFRTDSEASQSLEGDYVALLG
FT                   FPQEYRGASPDSEVVTLSVDIQKSQETRPRTKGAPLLGKTLPLSGPAGAPPLGRWACER
FT                   PAGSGEKPCSGGSRRKARHKASGHTAVRQPQQPHTSVPEKLPDCTSGLVEDTEEEPAAS
FT                   EMQKPVGMPEAMVRLRPGPRQAFSPLLSSAGPGSPAAETKTEETTLGHGRASKPEDCLN
FT                   KNASFHGSPAPGLQFSFLKEQRVPHVTPEKALLQHARPRKALCPLYSLQPCEAKAPGKD
FT                   GTTLPTTSGSGPLSGEPPGFRRDSAGPPGGGLRLEECSRTKPRIETLGVKLLQSGIACL
FT                   PGGRDKVGRPLLLVSTAEDAWEAPWCTTSEVAELLSYLCSVPRLEDKAKGLLVVIDARK
FT                   GTQRPGLVSALQGIQVEVLTSLKALRNHVDPSQLPEALEGPFPYHHSEWVQFFQKLDPF
FT                   LTDLRQASSLLQASIQEFEKGEPPGGVQEATRCLSKSKELMETVLRDPGLLALQREGGT
FT                   TLASLQQEASGLNANPDVRSHLTEAAALYNLVDGQLHDLVTASNQLLRRLELRVRLGHL
FT                   ETAIHQVSDWMAGEGSQSLQALAPVHVCAETVEKVHAEFEDFFLQVAAQYRQGLDLSKQ
FT                   AAQLGAAEEGAGETGLPDLAAFASTQQAFQARLTHFYMAAERQRTDLETLLHLHRFRRK
FT                   MSRFHMDCQNLLTQLSLGKAVKASPGDQLHLRLHCYLKRLASEFQTEKLLAMKLQVASL
FT                   SWPGLGQEVWEEAQERHQEIQSLLRKALAYCPCPEVPATQVALIDRSRPVAKGQGLPRE
FT                   VGSKWDRSLQDSLAVDHVFKSQRTPQGEQSRNMWAGLLSPEPGQSGDTEEVRGTPKLPD
FT                   PTLERLLASLFSWPHLPKQSKASRPTGGSFSSEGTGSQTSLEDSPHTSPPASL"
FT   CDS             complement(join(6895529..6896221,6899688..6899900,
FT                   6900495..6900617,6902605..6902743,6904097..6904245,
FT                   6905137..6905235,6908100..6908216,6909844..6909927,
FT                   6911343..6911436,6913111..6913234,6915585..6915767,
FT                   6916190..6917534,6920156..>6920359))
FT                   /codon_start=1
FT                   /gene="D630003M21Rik"
FT                   /locus_tag="mCG_113933"
FT                   /product="RIKEN cDNA D630003M21, isoform CRA_b"
FT                   /note="gene_id=mCG113933.1 transcript_id=mCT189883.0
FT                   protein_id=mCP110898.0 isoform=CRA_b"
FT                   /protein_id="EDL06259.1"
FT                   /translation="HQDPSALDMAIQHALAGLYPPFEATAPTVLGQVFRLLDSDFRGDG
FT                   LSFLLDFLIPAKRLCEQVREAACALYTHCLFLHEGWPLCLRDEVVVHLAPLNPLLLRQG
FT                   DFYLQVESWEEQSVHMTLKCLSSDLREVDKKPIPESSYSLIFTPEWLEAINNDFEGRPL
FT                   HNCLVASENGITPVPWTKITSPEFVDDRPPIVKVPSSDGDSCPLEDLHLSRPQEPYQAG
FT                   DLGGKGSVAQIWDKGKGKLSGDKYPGLIKVEPARSGQLAFRTDSEASQSLEGDYVALLG
FT                   FPQEYRGASPDSEVVTLSVDIQKSQETRPRTKGAPLLGKTLPLSGPAGAPPLGRWACER
FT                   PAGSGEKPCSGGSRRKARHKASGHTAVRQPQQPHTSVPEKLPDCTSGLVEDTEEEPAAS
FT                   EMQKPVGMPEAMVRLRPGPRQAFSPLLSSAGPGSPAAETKTEETTLGHGRASKPEDCLN
FT                   KNASFHGSPAPGLQFSFLKEQRVPHVTPEKALLQHARPRKALCPLYSLQPCEAKAPGKD
FT                   GTTLPTTSGSGPLSGEPPGFRRDSAGPPGGGLRLEECSRTKPRIETLGVKLLQSGIACL
FT                   PGGRDKVGRPLLLVSTAEDAWEAPWCTTSEVAELLSYLCSVPRLEDKAKGLLVVIDARK
FT                   GTQRPGLVSALQGIQALAPASVSKVLLLGEKASIPQLSVLPAQVEVLTSLKALRNHVDP
FT                   SQLPEALEGPFPYHHSEWVQFFQKLDPFLTDLRQASSLLQASIQEFEKGEPPGGVQEAT
FT                   RCLSKSKELMETVLRDPGLLALQREGGTTLASLQQEASGLNANPDVRSHLTEAAALYNL
FT                   VDGQLHDLVTASNQLLRRLELRVRLGHLETAIHQVSDWMAGEGSQSLQALAPVHVCAET
FT                   VEKVHAEFEDFFLQVAAQYRQGLDLSKQAAQLGAAEEGAGETGLPDLAAFASTQQAFQA
FT                   RLTHFYMAAERQRTDLETLLHLHRFRRKMSRFHMDCQNLLTQLSLGKAVKASPGDQLHL
FT                   RLHCYLKRLASEFQTEKLLAMKLQVASLSWPGLGQEVWEEAQERHQEIQSLLRKALAYC
FT                   PCPEVPATQVALIDRSRPVAKGQGLPREVGSKWDRSLQDSLAVDHVFKSQRTPQGEQSR
FT                   NMWAGLLSPEPGQSGDTEEVRGTPKLPDPTLERLLASLFSWPHLPKQSKASRPTGGSFS
FT                   SEGTGSQTSLEDSPHTSPPASL"
FT   assembly_gap    6906345..6906496
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    6928350..6928863
FT                   /estimated_length=514
FT                   /gap_type="unknown"
FT   gene            <6957558..6971323
FT                   /locus_tag="mCG_113939"
FT                   /note="gene_id=mCG113939.1"
FT   mRNA            join(<6957558..6957743,6960400..6960514,6960665..6960793,
FT                   6961686..6961844,6962778..6962841,6967054..6967077,
FT                   6971164..6971323)
FT                   /locus_tag="mCG_113939"
FT                   /product="mCG113939"
FT                   /note="gene_id=mCG113939.1 transcript_id=mCT115028.1
FT                   created on 10-SEP-2002"
FT   CDS             join(<6957560..6957743,6960400..6960514,6960665..6960793,
FT                   6961686..6961844,6962778..6962841,6967054..6967077,
FT                   6971164..6971250)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113939"
FT                   /product="mCG113939"
FT                   /note="gene_id=mCG113939.1 transcript_id=mCT115028.1
FT                   protein_id=mCP72959.1"
FT                   /protein_id="EDL06260.1"
FT                   /translation="YRSQVPIRGLVVWAALEDMTWAPDNVRKWSALLLLAIIGTALTAA
FT                   TDPGFVAMISQKGLDFACQQGVVELQKELQAISVPDFSGVFKIKHLGKGSYEFYSMAVD
FT                   GFHIPNPKIEMLPSDGLRVFIKDASIKINGKWMSRKNFLKAGGNFELSIQGVSISTDLI
FT                   LGSDSSGHITTICSNCDSHIDSVHIKISGSMLGWLIRLFHRKIETSLKNIIYKKICKIV
FT                   RDSGTPRPTSHSPASNEVCAQRCIHGMHGHL"
FT   assembly_gap    6968751..6968770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6971601..6971620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6975063..6983757
FT                   /locus_tag="mCG_113940"
FT                   /note="gene_id=mCG113940.0"
FT   mRNA            join(<6975063..6975132,6976101..6976146,6980681..6980744,
FT                   6981470..6981546,6983455..6983757)
FT                   /locus_tag="mCG_113940"
FT                   /product="mCG113940"
FT                   /note="gene_id=mCG113940.0 transcript_id=mCT115029.1
FT                   created on 10-SEP-2002"
FT   CDS             join(<6975065..6975132,6976101..6976146,6980681..6980744,
FT                   6981470..6981546,6983455..6983493)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113940"
FT                   /product="mCG113940"
FT                   /note="gene_id=mCG113940.0 transcript_id=mCT115029.1
FT                   protein_id=mCP72967.1"
FT                   /protein_id="EDL06261.1"
FT                   /translation="KTNASLEVDAEENRLVGEMKLGSRWLLELKESKFGPFKVEYLEDV
FT                   INYLVSTLVLPKINERLRRGFPLPLPAGIRFSHFTFYPYQNFLLLEADLHLI"
FT   assembly_gap    6976550..6976945
FT                   /estimated_length=396
FT                   /gap_type="unknown"
FT   assembly_gap    6985167..6985536
FT                   /estimated_length=370
FT                   /gap_type="unknown"
FT   gene            6999290..7023482
FT                   /gene="Lbp"
FT                   /locus_tag="mCG_141087"
FT                   /note="gene_id=mCG141087.0"
FT   mRNA            join(6999290..6999540,7001428..7001542,7002348..7002476,
FT                   7006220..7006375,7006900..7006963,7010286..7010349,
FT                   7010654..7010745,7011246..7011422,7013037..7013096,
FT                   7015484..7015651,7016682..7016749,7017203..7017245,
FT                   7018409..7018472,7019238..7019314,7022874..7023482)
FT                   /gene="Lbp"
FT                   /locus_tag="mCG_141087"
FT                   /product="lipopolysaccharide binding protein"
FT                   /note="gene_id=mCG141087.0 transcript_id=mCT172976.0
FT                   created on 10-SEP-2002"
FT   CDS             join(6999417..6999540,7001428..7001542,7002348..7002476,
FT                   7006220..7006375,7006900..7006963,7010286..7010349,
FT                   7010654..7010745,7011246..7011422,7013037..7013096,
FT                   7015484..7015651,7016682..7016749,7017203..7017245,
FT                   7018409..7018472,7019238..7019314,7022874..7022918)
FT                   /codon_start=1
FT                   /gene="Lbp"
FT                   /locus_tag="mCG_141087"
FT                   /product="lipopolysaccharide binding protein"
FT                   /note="gene_id=mCG141087.0 transcript_id=mCT172976.0
FT                   protein_id=mCP95895.0"
FT                   /db_xref="GOA:Q61805"
FT                   /db_xref="InterPro:IPR001124"
FT                   /db_xref="InterPro:IPR017942"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="InterPro:IPR017954"
FT                   /db_xref="InterPro:IPR030180"
FT                   /db_xref="InterPro:IPR030675"
FT                   /db_xref="InterPro:IPR032942"
FT                   /db_xref="MGI:MGI:1098776"
FT                   /db_xref="PDB:4M4D"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61805"
FT                   /protein_id="EDL06262.1"
FT                   /translation="MKAGTGPLLSTLLGLLFLSIQGTGGVNPGVVARITDKGLAYAAKE
FT                   GLVALQRELYKITLPDFSGDFKIKAVGRGQYEFHSLEIQNCELRGSSLKLLPGQGLSLA
FT                   ISDSSIGVRGKWKVRKSFLKLHGSFDLDVKGVTISVDLLLGMDPSGRPTVSASGCSSRI
FT                   CDLDVHISGNVGWLLNLFHNQIESKLQKVLENKVCEMIQKSVTSDLQPYLQTLPVTAEI
FT                   DNVLGIDYSLVAAPQAKAQVLDVMFKGEIFNRNHRSPVATPTPTMSLPEDSKQMVYFAI
FT                   SDYAFNIASRVYHQAGYLNFSITDDMLPHDSGIRLNTKAFRPFTPQIYKKYPDMKLELL
FT                   GTVVSAPILNVSPGNLSLAPQMEIEGFVILPTSAREPVFRLGVVTNVFASLTFNNSKVT
FT                   GMLHPDKAQVRLIESKVGMFNVNLFQAFLNYYLLNSLYPDVNAELAQGFPLPLPRHIQL
FT                   HDLDFQIRKDFLYLGANVQYMRV"
FT   assembly_gap    7010475..7010494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7020790..7020887
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   gene            complement(7046271..>7052484)
FT                   /locus_tag="mCG_15731"
FT                   /note="gene_id=mCG15731.2"
FT   mRNA            complement(join(7046271..7047006,7048164..7048229,
FT                   7050148..7050398,7051425..7051560,7051904..7052031,
FT                   7052366..>7052484))
FT                   /locus_tag="mCG_15731"
FT                   /product="mCG15731, transcript variant mCT20091"
FT                   /note="gene_id=mCG15731.2 transcript_id=mCT20091.2 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(7046745..7047006,7048164..7048229,
FT                   7050148..7050297,7051425..7051560,7051904..7052031,
FT                   7052366..>7052484))
FT                   /locus_tag="mCG_15731"
FT                   /product="mCG15731, transcript variant mCT173576"
FT                   /note="gene_id=mCG15731.2 transcript_id=mCT173576.0 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(7046745..7047006,7048164..7048229,
FT                   7050148..7051560,7051904..7052031,7052366..>7052484))
FT                   /locus_tag="mCG_15731"
FT                   /product="mCG15731, transcript variant mCT189910"
FT                   /note="gene_id=mCG15731.2 transcript_id=mCT189910.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(7046902..7047006,7048164..7048229,
FT                   7049171..7049306,7050148..7050398,7051488..7051560,
FT                   7051904..7052031,7052366..>7052480))
FT                   /locus_tag="mCG_15731"
FT                   /product="mCG15731, transcript variant mCT172978"
FT                   /note="gene_id=mCG15731.2 transcript_id=mCT172978.0 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(7051488..7051560,7051904..7052031,
FT                   7052366..>7052479))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15731"
FT                   /product="mCG15731, isoform CRA_a"
FT                   /note="gene_id=mCG15731.2 transcript_id=mCT172978.0
FT                   protein_id=mCP95897.0 isoform=CRA_a"
FT                   /protein_id="EDL06263.1"
FT                   /translation="RPQFPVAWMCFLSGHCHPPKSTDIPHVPGLVSPIQGTKAVDCAAL
FT                   LETDGSSLGRQITASGTPYSLQLRDGHPLSRERMPGNNSWDLQWPKSCLRLATSTNWCS
FT                   "
FT   CDS             complement(join(7051488..7051560,7051904..7052031,
FT                   7052366..>7052479))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15731"
FT                   /product="mCG15731, isoform CRA_a"
FT                   /note="gene_id=mCG15731.2 transcript_id=mCT173576.0
FT                   protein_id=mCP96495.0 isoform=CRA_a"
FT                   /protein_id="EDL06264.1"
FT                   /translation="RPQFPVAWMCFLSGHCHPPKSTDIPHVPGLVSPIQGTKAVDCAAL
FT                   LETDGSSLGRQITASGTPYSLQLRDGHPLSRERMPGNNSWDLQWPKSCLRLATSTNWCS
FT                   "
FT   CDS             complement(join(7051488..7051560,7051904..7052031,
FT                   7052366..>7052479))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15731"
FT                   /product="mCG15731, isoform CRA_a"
FT                   /note="gene_id=mCG15731.2 transcript_id=mCT189910.0
FT                   protein_id=mCP110869.0 isoform=CRA_a"
FT                   /protein_id="EDL06265.1"
FT                   /translation="RPQFPVAWMCFLSGHCHPPKSTDIPHVPGLVSPIQGTKAVDCAAL
FT                   LETDGSSLGRQITASGTPYSLQLRDGHPLSRERMPGNNSWDLQWPKSCLRLATSTNWCS
FT                   "
FT   CDS             complement(join(7051488..7051560,7051904..7052031,
FT                   7052366..>7052479))
FT                   /codon_start=1
FT                   /locus_tag="mCG_15731"
FT                   /product="mCG15731, isoform CRA_a"
FT                   /note="gene_id=mCG15731.2 transcript_id=mCT20091.2
FT                   protein_id=mCP22973.2 isoform=CRA_a"
FT                   /protein_id="EDL06266.1"
FT                   /translation="RPQFPVAWMCFLSGHCHPPKSTDIPHVPGLVSPIQGTKAVDCAAL
FT                   LETDGSSLGRQITASGTPYSLQLRDGHPLSRERMPGNNSWDLQWPKSCLRLATSTNWCS
FT                   "
FT   assembly_gap    7060305..7060638
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    7063512..7063531
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7065305..7065463
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            <7066818..7076565
FT                   /gene="A930034L06Rik"
FT                   /locus_tag="mCG_114776"
FT                   /note="gene_id=mCG114776.1"
FT   mRNA            join(<7066818..7066994,7067187..7067432,7067851..7067930,
FT                   7068100..7068178,7071879..7071959,7073897..7074270,
FT                   7076380..7076565)
FT                   /gene="A930034L06Rik"
FT                   /locus_tag="mCG_114776"
FT                   /product="RIKEN cDNA A930034L06"
FT                   /note="gene_id=mCG114776.1 transcript_id=mCT115873.1
FT                   created on 10-SEP-2002"
FT   CDS             join(<7067254..7067432,7067851..7067930,7068100..7068178,
FT                   7071879..7071936)
FT                   /codon_start=1
FT                   /gene="A930034L06Rik"
FT                   /locus_tag="mCG_114776"
FT                   /product="RIKEN cDNA A930034L06"
FT                   /note="gene_id=mCG114776.1 transcript_id=mCT115873.1
FT                   protein_id=mCP72805.1"
FT                   /protein_id="EDL06267.1"
FT                   /translation="DSCVAPCFEPFSKGCFPDEPLPQGPLDTKDDDAKPAAANTPLPTL
FT                   RTHWWVPPSRKQVSRRWDKKPFGVAAVYQSLEERSEKCSLTELTAWCRGDMRGVSVQLG
FT                   SSWTTALPRNVLPNISVERPESMTISQ"
FT   assembly_gap    7090398..7090543
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    7092290..7092560
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   gene            7101109..7189898
FT                   /locus_tag="mCG_15732"
FT                   /note="gene_id=mCG15732.2"
FT   mRNA            join(7101109..7101334,7112065..7112280,7117416..7117618,
FT                   7121566..7121729,7123883..7124069,7126606..7126737,
FT                   7127638..7127816,7128151..7128337,7128470..7128624,
FT                   7131918..7132119,7134386..7134553,7134975..7135089,
FT                   7135721..7135868,7137277..7137341,7139466..7139595,
FT                   7141323..7141456,7145270..7145452,7147596..7147747,
FT                   7153215..7153402,7155216..7155322,7156963..7157115,
FT                   7157880..7158089,7164261..7164419,7167241..7167406,
FT                   7168777..7168899,7173507..7173643,7184184..7184292,
FT                   7184755..7184833,7186441..7186589,7187540..7189898)
FT                   /locus_tag="mCG_15732"
FT                   /product="mCG15732"
FT                   /note="gene_id=mCG15732.2 transcript_id=mCT20092.2 created
FT                   on 10-SEP-2002"
FT   assembly_gap    7108423..7108442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(7112095..7112280,7117416..7117618,7121566..7121729,
FT                   7123883..7124069,7126606..7126737,7127638..7127816,
FT                   7128151..7128337,7128470..7128624,7131918..7132119,
FT                   7134386..7134553,7134975..7135089,7135721..7135868,
FT                   7137277..7137341,7139466..7139595,7141323..7141456,
FT                   7145270..7145452,7147596..7147747,7153215..7153402,
FT                   7155216..7155322,7156963..7157115,7157880..7158089,
FT                   7164261..7164419,7167241..7167406,7168777..7168899,
FT                   7173507..7173643,7184184..7184292,7184755..7184833,
FT                   7186441..7186589,7187540..7187733)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15732"
FT                   /product="mCG15732"
FT                   /note="gene_id=mCG15732.2 transcript_id=mCT20092.2
FT                   protein_id=mCP22975.2"
FT                   /protein_id="EDL06268.1"
FT                   /translation="MYSEWRSLHLVIQNDQGHTSVLHSYPESVGREVANAVVRPLGQAL
FT                   GTSSVAGSESLLKTDKEVKWTMEVICYGLTLPLDGETVKYCVDVYTDWIMALVLPKDSI
FT                   PLPIIKEPNLYVQSILKHLQNLFVPRQEQGSSQIRLCLQVLRAIQKLARESSIMARETW
FT                   EVLLLFLLQINDILLAPPTVQGGIAENLAEKLIGVLFEVWLLACTRCFPTPPYWKTAKE
FT                   MVANWRHHPAVVEQWSKVICALTSRLLRFTYGPSFPPFKVPDEDANLIPPEMDNECIAQ
FT                   TWFRFLHMLSNPVDLSNPAVISSTPKFQEQFLNVSGMPQELSQYPCLKHLPQIFFRAMR
FT                   GISCLVDAFLGISRPRSDSAPPTPVNRLSMPQSAAVNTTPPHNRRHRAVTVNKATMKTS
FT                   TVRTLSLVVLLYGGPNQTSSEPRPLPAPRRPKVNSILNLFGSWLFDAAFVHCKLHNGIN
FT                   RDNSMTAIATQASMEFRRKGSQMSTDTMVSNPVFDASEFPDNYEAGRAEACGTLCRIFC
FT                   SKKTGEEILPAYLSRFYMLLIQGLQINDYVCHPVLASVILNSPPLFCCDLKGIDVVVPY
FT                   FISALETILPDRELSKFKSYVNPTELRRSSINILLSLLPLPHHFGTVRSEVVLEGKFSN
FT                   DDSSSYDKPITFLSLKLRLVNILIGALQTETDPNNTQMILGAMLNIVQDSALLEAIGCQ
FT                   MEMGGGENNLKSHSRTNSGISSASGGSTEPTTPDSERPAQALLRDYALNTDSAAGLLIR
FT                   SIHLVTQRLNSQWRQDMSISLAALELLSGLAKVKVMVDSGDRKRAISSVCSYIVYQCSR
FT                   PAPLHSRDLHSMIVAAFQCLCVWLTEHPDMLDEKDCLKEVLEIVELGISGSKSKNSEQE
FT                   VKYKGDKEPNPASMRVKDAAEATLTCIMQLLGAFPSPSGPASPCSLVNETTLIKYSRLP
FT                   TINKHSFRYFVLDNSVILAMLEQPLGNEQNDFFPSVTVLVRGMSGRLAWAQQLCLLPRG
FT                   AKANQKLFVPEPRPVPKNDVGFKYSVKHRPFPEEVDKIPFVKADLSIPDLHEIVTEELE
FT                   ERHEKLRSGMAQQIAYEMHLEQQSEGELQKRSFPDPVTDCKPPPPAQEFQTARLFLSHF
FT                   GFLSLEALKEPANSRLPPHLIALDSTIPGFFDDIGYLDLLPCRPFDTVFIFYMKPGQKT
FT                   NQEILKNVESSRNVQPHFLEFLLSLGWSVDVGKHPGWTGHVSTSWSINSCDDGEGSEPD
FT                   EITSSEDVGASIFNGQKKVLYYADALTEIAFVVPSPVESLTDSLESNISDQDSDSNMDL
FT                   MPGILKQPPLTLELVPNHTDSLNSSQRLSPSSRMKKLPQGRPVPPLGPETRVSVVWVER
FT                   YDDIENFPLSDLMTEISTGVETTANSSTSLRSTTLEKEVPVIFIHPLNTGLFRIKIQGA
FT                   TGKFNMVIPLVDGMIVSRRALGFLVRQTVINICRRKRLESDSYSPPHVRRKQKITDIVN
FT                   KYRNKQLEPEFYTALFQEVGLKNCSS"
FT   assembly_gap    7120249..7120268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7158898..>7159534)
FT                   /locus_tag="mCG_52157"
FT                   /note="gene_id=mCG52157.1"
FT   mRNA            complement(7158898..>7159534)
FT                   /locus_tag="mCG_52157"
FT                   /product="mCG52157"
FT                   /note="gene_id=mCG52157.1 transcript_id=mCT52340.1 created
FT                   on 10-SEP-2002"
FT   CDS             complement(7159242..>7159532)
FT                   /codon_start=1
FT                   /locus_tag="mCG_52157"
FT                   /product="mCG52157"
FT                   /note="gene_id=mCG52157.1 transcript_id=mCT52340.1
FT                   protein_id=mCP42740.1"
FT                   /protein_id="EDL06269.1"
FT                   /translation="GRIGSGAGEGAGGAMSSREGGKKKPLKQPKKRAKEMDEEDKAFKQ
FT                   KQKEKQKKLEELKAKAAGKGPLATGGIKKSGKKQAVPHIWGDGDPPLPFLF"
FT   assembly_gap    7181272..7181291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7182535..7182554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7186855..7186874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7194385..7200280
FT                   /gene="BC054059"
FT                   /locus_tag="mCG_15743"
FT                   /note="gene_id=mCG15743.2"
FT   mRNA            join(<7194385..7194400,7197877..7198006,7200039..>7200279)
FT                   /gene="BC054059"
FT                   /locus_tag="mCG_15743"
FT                   /product="cDNA sequence BC054059, transcript variant
FT                   mCT172980"
FT                   /note="gene_id=mCG15743.2 transcript_id=mCT172980.0 created
FT                   on 10-SEP-2002"
FT   mRNA            join(<7194630..7194958,7197877..7198006,7200039..7200280)
FT                   /gene="BC054059"
FT                   /locus_tag="mCG_15743"
FT                   /product="cDNA sequence BC054059, transcript variant
FT                   mCT20099"
FT                   /note="gene_id=mCG15743.2 transcript_id=mCT20099.1 created
FT                   on 10-SEP-2002"
FT   CDS             join(<7194799..7194958,7197877..7197992)
FT                   /codon_start=1
FT                   /gene="BC054059"
FT                   /locus_tag="mCG_15743"
FT                   /product="cDNA sequence BC054059, isoform CRA_b"
FT                   /note="gene_id=mCG15743.2 transcript_id=mCT20099.1
FT                   protein_id=mCP22977.0 isoform=CRA_b"
FT                   /protein_id="EDL06271.1"
FT                   /translation="IQVAPQGPRYAMKYPLVPLVSDLTLSFLVFWLCLPVALLLFLTIV
FT                   WLHFLLSQESKEDDSDLCFNWEPWSKRPSECGCEETFPGEEDGLHW"
FT   mRNA            join(<7194828..7194855,7196023..7196086,7197763..>7197993)
FT                   /gene="BC054059"
FT                   /locus_tag="mCG_15743"
FT                   /product="cDNA sequence BC054059, transcript variant
FT                   mCT172981"
FT                   /note="gene_id=mCG15743.2 transcript_id=mCT172981.0 created
FT                   on 10-SEP-2002"
FT   CDS             join(<7196042..7196086,7197763..>7197993)
FT                   /codon_start=1
FT                   /gene="BC054059"
FT                   /locus_tag="mCG_15743"
FT                   /product="cDNA sequence BC054059, isoform CRA_a"
FT                   /note="gene_id=mCG15743.2 transcript_id=mCT172981.0
FT                   protein_id=mCP95899.0 isoform=CRA_a"
FT                   /protein_id="EDL06270.1"
FT                   /translation="VSEKHVFQLIQVTFQLQVSYRATWTPGLAHVSSGAAEHYRLFPPQ
FT                   KLCLWSPQSQRKMIQICASTGSPGAKDHLSVAVRRHFLVRRTDSTGD"
FT   CDS             <7200081..>7200279
FT                   /codon_start=1
FT                   /gene="BC054059"
FT                   /locus_tag="mCG_15743"
FT                   /product="cDNA sequence BC054059, isoform CRA_c"
FT                   /note="gene_id=mCG15743.2 transcript_id=mCT172980.0
FT                   protein_id=mCP95900.0 isoform=CRA_c"
FT                   /protein_id="EDL06272.1"
FT                   /translation="PMAFPGISRCQTCQASCQTIPSPSPQMTRNLEEPGPSGLWGPVGQ
FT                   STHRVCWIPIKEMGVLLCPYR"
FT   assembly_gap    7201022..7201041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7202680..7202699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7203726..7203745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7205684..7205703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7207987..7208197
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    7213464..7213483
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <7214345..7238196
FT                   /locus_tag="mCG_15745"
FT                   /note="gene_id=mCG15745.2"
FT   mRNA            join(<7214345..7214549,7218414..7218631,7219118..7219193,
FT                   7219551..7219702,7221985..7222150,7226101..7226192,
FT                   7226729..7226806,7227182..7227341,7229409..7229492,
FT                   7230832..7231035,7234335..7234475,7235242..7235417,
FT                   7237249..7237298,7238140..7238196)
FT                   /locus_tag="mCG_15745"
FT                   /product="mCG15745"
FT                   /note="gene_id=mCG15745.2 transcript_id=mCT20105.2 created
FT                   on 30-SEP-2002"
FT   CDS             join(<7214345..7214549,7218414..7218631,7219118..7219193,
FT                   7219551..7219702,7221985..7222150,7226101..7226192,
FT                   7226729..7226806,7227182..7227341,7229409..7229492,
FT                   7230832..7230992)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15745"
FT                   /product="mCG15745"
FT                   /note="gene_id=mCG15745.2 transcript_id=mCT20105.2
FT                   protein_id=mCP22963.2"
FT                   /protein_id="EDL06273.1"
FT                   /translation="LHSPGLSTGPTNLQQHPQKPRPADCSHSRLSWAESLSMDGFWMEV
FT                   ERIQQRAEVKKEDCGEGRSQLLEGDTESQWLQDTGLSGLAGGLGLDGDHQGLLSTLTQT
FT                   QVAAVCRRLDIYARSARRRQKAPVRDVRDIFGVFTSRELAPENGVSGMKWTKINSEDSA
FT                   SPLRSAEPGGPQELAGMEEVFNMDSAYSEQAAVLLQRAWPSPGGTTAWGKGPLPRFRIP
FT                   KGRLGVTRIGDLSSRDMKKIPPLALIELTALYDILGLDLKRCKGGKWKGPDSGLFGVPL
FT                   HSLLEADHRVFPSTQVPLLLQALLSCLEKRGLDTEGILRVPGSQARVKGLEQKLERDFY
FT                   AGLVSWDKVHPNDASDLLKRFLRKLPVPLLTAEYLPAFASVPDIPDLKQRLQALHLLVL
FT                   LLPEPNRKHLEGTPGIPQEGGSPGAAQQDDLVECFHSDGPQSLPAPRAASQAHQGWKAA
FT                   GRGRS"
FT   assembly_gap    7222335..7222574
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    7229169..7229374
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    7230216..7230360
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   assembly_gap    7242779..7243152
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    7272415..7272858
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    7282015..7282207
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   gene            complement(7284643..>7298851)
FT                   /locus_tag="mCG_141217"
FT                   /note="gene_id=mCG141217.0"
FT   mRNA            complement(join(7284643..7284801,7285512..7285828,
FT                   7298720..>7298851))
FT                   /locus_tag="mCG_141217"
FT                   /product="mCG141217"
FT                   /note="gene_id=mCG141217.0 transcript_id=mCT173814.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(7285741..7285828,7298720..>7298850))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141217"
FT                   /product="mCG141217"
FT                   /note="gene_id=mCG141217.0 transcript_id=mCT173814.0
FT                   protein_id=mCP96733.0"
FT                   /protein_id="EDL06274.1"
FT                   /translation="RREEFSVGWFSKVPTLGTIFQSPGAVRGPRILWLTVRITNRTDSL
FT                   FLHSLMLCLEPVPVMVLGYKNKFTHLL"
FT   assembly_gap    7294208..7294582
FT                   /estimated_length=375
FT                   /gap_type="unknown"
FT   gene            7298407..7303856
FT                   /gene="Slc32a1"
FT                   /locus_tag="mCG_15746"
FT                   /note="gene_id=mCG15746.2"
FT   mRNA            join(7298407..7299823,7302009..7302750,7303543..7303856)
FT                   /gene="Slc32a1"
FT                   /locus_tag="mCG_15746"
FT                   /product="solute carrier family 32 (GABA vesicular
FT                   transporter), member 1"
FT                   /note="gene_id=mCG15746.2 transcript_id=mCT20106.2 created
FT                   on 30-SEP-2002"
FT   CDS             join(7299434..7299823,7302009..7302750,7303543..7303697)
FT                   /codon_start=1
FT                   /gene="Slc32a1"
FT                   /locus_tag="mCG_15746"
FT                   /product="solute carrier family 32 (GABA vesicular
FT                   transporter), member 1"
FT                   /note="gene_id=mCG15746.2 transcript_id=mCT20106.2
FT                   protein_id=mCP22972.2"
FT                   /protein_id="EDL06275.1"
FT                   /translation="MATLLRSKLTNVATSVSNKSQAKVSGMFARMGFQAATDEEAVGFA
FT                   HCDDLDFEHRQGLQMDILKSEGEPCGDEGAEAPVEGDIHYQRGGAPLPPSGSKDQAVGA
FT                   GGEFGGHDKPKITAWEAGWNVTNAIQGMFVLGLPYAILHGGYLGLFLIIFAAVVCCYTG
FT                   KILIACLYEENEDGEVVRVRDSYVAIANACCAPRFPTLGGRVVNVAQIIELVMTCILYV
FT                   VVSGNLMYNSFPGLPVSQKSWSIIATAVLLPCAFLKNLKAVSKFSLLCTLAHFVINILV
FT                   IAYCLSRARDWAWEKVKFYIDVKKFPISIGIIVFSYTSQIFLPSLEGNMQQPSEFHCMM
FT                   NWTHIAACVLKGLFALVAYLTWADETKEVITDNLPGSRRESSQAWKLDLEGGVGPFHSH
FT                   SVLGIYSVQPFPARALPMPWTFQPCGLKG"
FT   assembly_gap    7302752..7303231
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   gene            <7313036..7327602
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /note="gene_id=mCG15733.3"
FT   mRNA            join(<7313036..7313665,7314478..7314707,7316208..7316377,
FT                   7319614..7319835,7320426..7320605,7322698..7322898,
FT                   7322996..7323066,7323464..7323583,7324165..7324304,
FT                   7324825..7324957,7326790..7327353)
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /product="ARP5 actin-related protein 5 homolog (yeast),
FT                   transcript variant mCT189916"
FT                   /note="gene_id=mCG15733.3 transcript_id=mCT189916.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<7313051..7313665,7314478..7315322)
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /product="ARP5 actin-related protein 5 homolog (yeast),
FT                   transcript variant mCT173813"
FT                   /note="gene_id=mCG15733.3 transcript_id=mCT173813.0 created
FT                   on 30-SEP-2002"
FT   mRNA            join(<7313062..7313665,7314478..7314707,7316208..7316377,
FT                   7319614..7319831,7320423..7320605,7323464..7323583,
FT                   7324184..7324304,7324825..7324957,7326790..7327602)
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /product="ARP5 actin-related protein 5 homolog (yeast),
FT                   transcript variant mCT20093"
FT                   /note="gene_id=mCG15733.3 transcript_id=mCT20093.2 created
FT                   on 30-SEP-2002"
FT   mRNA            join(<7313081..7313665,7314478..7314707,7316208..7316377,
FT                   7319614..7319835,7320426..7320605,7323464..7324304,
FT                   7324825..7324957,7326790..7327357)
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /product="ARP5 actin-related protein 5 homolog (yeast),
FT                   transcript variant mCT189915"
FT                   /note="gene_id=mCG15733.3 transcript_id=mCT189915.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<7313105..7313665,7314478..7314707,7316208..7316377,
FT                   7319614..7319831,7320423..7320605,7323464..7323583,
FT                   7324184..7324255)
FT                   /codon_start=1
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /product="ARP5 actin-related protein 5 homolog (yeast),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG15733.3 transcript_id=mCT20093.2
FT                   protein_id=mCP22987.2 isoform=CRA_d"
FT                   /protein_id="EDL06279.1"
FT                   /translation="GLDQRGIETHRKFWSARRESGAETSESSRKEEASGRFGAQRLRRG
FT                   PGFRDALGFGAGPALAKMEANVFRFRDARSAPDPVLEAGPVAFGSQPVPLVLDNGSFQA
FT                   RAGWACPGPDPGPEPRLQFRAVCARGRGGARGGPGPQVGNALGSLEPLRWMLRSPFDRN
FT                   VPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYRIPK
FT                   VAYGIDSLFSFYHNVPKNALSSGLIISSGYQCTHILPVLEGRLDAKNCKRINLGGSQAA
FT                   GYLQRLLQLKYPGHLAAITLSRMEEILQEHSYIAEDYGAELQKWQCPDYYENNVHKMQL
FT                   PFSSKLLGSTLTAEEKQERRQQQLRRLQELNARRREEKLQLDQERLERLLYVQELLEEG
FT                   QMDQFHKALIELNMDSPEELQSYIQKLTLAVEQAKQKILQAEASLEVDVVDSKPETPDL
FT                   EPLEPTMEDVENISDFEPLFSEETPEVEKPQVTTVQRIISCLLGQRGSVLRRLFSSHPS
FT                   "
FT   CDS             join(<7313105..7313665,7314478..7314707,7316208..7316377,
FT                   7319614..7319835,7320426..7320605,7323464..7323471)
FT                   /codon_start=1
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /product="ARP5 actin-related protein 5 homolog (yeast),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG15733.3 transcript_id=mCT189915.0
FT                   protein_id=mCP110905.0 isoform=CRA_b"
FT                   /protein_id="EDL06277.1"
FT                   /translation="GLDQRGIETHRKFWSARRESGAETSESSRKEEASGRFGAQRLRRG
FT                   PGFRDALGFGAGPALAKMEANVFRFRDARSAPDPVLEAGPVAFGSQPVPLVLDNGSFQA
FT                   RAGWACPGPDPGPEPRLQFRAVCARGRGGARGGPGPQVGNALGSLEPLRWMLRSPFDRN
FT                   VPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYRIPK
FT                   VAYGIDSLFSFYHNVPKNALSSGLIISSGYQCTHILPVLEGRLDAKNCKRINLGGSQAA
FT                   GYLQRLLQLKYPGHLAAITLSRMEEILQEHSYIAEDYGAELQKWQCPDYYENNVHKMQL
FT                   PFSSKLLGSTLTAEEKQERRQQQLRRLQELNARRREEKLQLDQERLERLLYVQAAPRGR
FT                   TDGPVSQSSDRAEHGLPRRTAVLHTEAHLGGGAGQTENPAGRSQPGGGCGRQQARDP"
FT   CDS             join(<7313105..7313665,7314478..7314707,7316208..7316377,
FT                   7319614..7319835,7320426..7320605,7322698..7322732)
FT                   /codon_start=1
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /product="ARP5 actin-related protein 5 homolog (yeast),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG15733.3 transcript_id=mCT189916.0
FT                   protein_id=mCP110906.0 isoform=CRA_c"
FT                   /protein_id="EDL06278.1"
FT                   /translation="GLDQRGIETHRKFWSARRESGAETSESSRKEEASGRFGAQRLRRG
FT                   PGFRDALGFGAGPALAKMEANVFRFRDARSAPDPVLEAGPVAFGSQPVPLVLDNGSFQA
FT                   RAGWACPGPDPGPEPRLQFRAVCARGRGGARGGPGPQVGNALGSLEPLRWMLRSPFDRN
FT                   VPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYRIPK
FT                   VAYGIDSLFSFYHNVPKNALSSGLIISSGYQCTHILPVLEGRLDAKNCKRINLGGSQAA
FT                   GYLQRLLQLKYPGHLAAITLSRMEEILQEHSYIAEDYGAELQKWQCPDYYENNVHKMQL
FT                   PFSSKLLGSTLTAEEKQERRQQQLRRLQELNARRREEKLQLDQERLERLLYVQAAPRGR
FT                   TDGPVSQSSDRAEHGLPRRTAVLHTEAHLGGGAGQTENPAGRSQPGGGCGRQQARVLPQ
FT                   CNSVRMK"
FT   CDS             join(<7313105..7313665,7314478..7314711)
FT                   /codon_start=1
FT                   /gene="Actr5"
FT                   /locus_tag="mCG_15733"
FT                   /product="ARP5 actin-related protein 5 homolog (yeast),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG15733.3 transcript_id=mCT173813.0
FT                   protein_id=mCP96732.0 isoform=CRA_a"
FT                   /protein_id="EDL06276.1"
FT                   /translation="GLDQRGIETHRKFWSARRESGAETSESSRKEEASGRFGAQRLRRG
FT                   PGFRDALGFGAGPALAKMEANVFRFRDARSAPDPVLEAGPVAFGSQPVPLVLDNGSFQA
FT                   RAGWACPGPDPGPEPRLQFRAVCARGRGGARGGPGPQVGNALGSLEPLRWMLRSPFDRN
FT                   VPVNLELQELLLDYSFQHLGVSSQGCVDHPIVLTEAVCNPLYSRQMMSELLFECYRIPK
FT                   VAYGIDSLFSFYHNVPKNALSSGLIISSGYQCTHILPVLEGR"
FT   assembly_gap    7348150..7348317
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            7355273..7450618
FT                   /gene="Ppp1r16b"
FT                   /locus_tag="mCG_15739"
FT                   /note="gene_id=mCG15739.1"
FT   mRNA            join(7355273..7355404,7383810..7384158,7429069..7429139,
FT                   7434997..7435142,7437596..7437699,7439502..7439626,
FT                   7443570..7443695,7444239..7444314,7445347..7445476,
FT                   7445565..7445733,7449792..7450618)
FT                   /gene="Ppp1r16b"
FT                   /locus_tag="mCG_15739"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 16B, transcript variant mCT20100"
FT                   /note="gene_id=mCG15739.1 transcript_id=mCT20100.2 created
FT                   on 30-SEP-2002"
FT   mRNA            join(<7355274..7355404,7383810..7384158,7429069..7429139,
FT                   7434997..7435142,7437596..7437699,7439502..7439626,
FT                   7443570..7443695,7444239..7444314,7445347..7445476,
FT                   7445565..7447767)
FT                   /gene="Ppp1r16b"
FT                   /locus_tag="mCG_15739"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 16B, transcript variant mCT189868"
FT                   /note="gene_id=mCG15739.1 transcript_id=mCT189868.0 created
FT                   on 08-MAR-2004"
FT   assembly_gap    7361720..7361782
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    7374080..7374629
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   CDS             join(<7383822..7384158,7429069..7429139,7434997..7435142,
FT                   7437596..7437699,7439502..7439626,7443570..7443695,
FT                   7444239..7444314,7445347..7445476,7445565..7445772)
FT                   /codon_start=1
FT                   /gene="Ppp1r16b"
FT                   /locus_tag="mCG_15739"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 16B, isoform CRA_a"
FT                   /note="gene_id=mCG15739.1 transcript_id=mCT189868.0
FT                   protein_id=mCP110870.0 isoform=CRA_a"
FT                   /protein_id="EDL06280.1"
FT                   /translation="GSSPLGAPVLPWPRAHRASPRQSKGRRGAMASHVDLLTELQLLEK
FT                   VPTLERLRAAQKRRAQQLKKWAQYEQDLLHRKRKHERKRSTGGRRKKVSFEASVALLEA
FT                   SLRNDAEEVRYFLKNKVSPDLCNEDGLTALHQCCIDNFEEIVKLLLSHGANVNAKDNEL
FT                   WTPLHAAATCGHINLVKILVQYGADLLAVNSDGNMPYDLCEDEPTLDVIETCMAYQGIT
FT                   QEKINEMRAAPEQKMISDIHCMIAAGQDLDWIDGQGATLLHIAGANGYLRAAELLLDHG
FT                   VRVDVKDWDGWEPLHAAAFWGQMPMAELLVSHGASLSARTSMDEMPIDLCEEEEFKVLL
FT                   LELKHKHDVIMKSQLRHKSSLSRRTSSAGSRGKVVRRASLSDRTNLYRKEYEGEAILWQ
FT                   QRSAAEDQRTSTYNGDIRETRTDQENKDPVRDLLPCLSVGH"
FT   CDS             join(7383909..7384158,7429069..7429139,7434997..7435142,
FT                   7437596..7437699,7439502..7439626,7443570..7443695,
FT                   7444239..7444314,7445347..7445476,7445565..7445733,
FT                   7449792..7450301)
FT                   /codon_start=1
FT                   /gene="Ppp1r16b"
FT                   /locus_tag="mCG_15739"
FT                   /product="protein phosphatase 1, regulatory (inhibitor)
FT                   subunit 16B, isoform CRA_b"
FT                   /note="gene_id=mCG15739.1 transcript_id=mCT20100.2
FT                   protein_id=mCP22965.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q544H9"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR017417"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2151841"
FT                   /db_xref="UniProtKB/TrEMBL:Q544H9"
FT                   /protein_id="EDL06281.1"
FT                   /translation="MASHVDLLTELQLLEKVPTLERLRAAQKRRAQQLKKWAQYEQDLL
FT                   HRKRKHERKRSTGGRRKKVSFEASVALLEASLRNDAEEVRYFLKNKVSPDLCNEDGLTA
FT                   LHQCCIDNFEEIVKLLLSHGANVNAKDNELWTPLHAAATCGHINLVKILVQYGADLLAV
FT                   NSDGNMPYDLCEDEPTLDVIETCMAYQGITQEKINEMRAAPEQKMISDIHCMIAAGQDL
FT                   DWIDGQGATLLHIAGANGYLRAAELLLDHGVRVDVKDWDGWEPLHAAAFWGQMPMAELL
FT                   VSHGASLSARTSMDEMPIDLCEEEEFKVLLLELKHKHDVIMKSQLRHKSSLSRRTSSAG
FT                   SRGKVVRRASLSDRTNLYRKEYEGEAILWQQRSAAEDQRTSTYNGDIRETRTDQENKDP
FT                   NPRLEKPVLLSEFSTKISRGELDGPVENGLRAPVSTYQYALANGDIWKMHEMPDYSMAY
FT                   GNPGVADVPPPWSGFKEQSPQTLLELKRQRAAAKLLSHPFLSTHLGSSVARSGESSSEG
FT                   KAPLIGGRTSPYSSNGTSVYYTVTSGDPPLLKFKAPMEEMEEKVHGCCRIS"
FT   assembly_gap    7392589..7392608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7416889..7416968
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    7434189..7434257
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    7435367..7435635
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   CDS             complement(7453945..7454127)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147180"
FT                   /product="mCG147180"
FT                   /note="gene_id=mCG147180.0 transcript_id=mCT187443.0
FT                   protein_id=mCP109240.0"
FT                   /protein_id="EDL06254.1"
FT                   /translation="MRSRPSGQQGRGLGLSRKVVGHFSGAVGPGHMTLGFSVPWGRRGY
FT                   HQATNSDSSDSPNIM"
FT   gene            <7456295..7474883
FT                   /locus_tag="mCG_15735"
FT                   /note="gene_id=mCG15735.1"
FT   mRNA            join(<7456295..7456792,7468062..7468229,7471381..7471505,
FT                   7473408..7474883)
FT                   /locus_tag="mCG_15735"
FT                   /product="mCG15735"
FT                   /note="gene_id=mCG15735.1 transcript_id=mCT20094.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(<7456295..7456792,7468062..7468229,7471381..7471505,
FT                   7473408..7474398)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15735"
FT                   /product="mCG15735"
FT                   /note="gene_id=mCG15735.1 transcript_id=mCT20094.2
FT                   protein_id=mCP22944.2"
FT                   /protein_id="EDL06282.1"
FT                   /translation="SGSVLGTAMAARFELLDDLPAACLSPCGPPNPTELFSEARRLALE
FT                   QLLAGGPDAWAAFLRRERLGRFLNADEVREVLGAAERPGEDGAAVAEDSFGSSHECSSG
FT                   TYFPEQSDLEPPALELGWPSFYQGAYRGATRVEAHFQPRGAGAGGPYGCKDALRQQLRS
FT                   AREVIAVVMDVFSDIDIFRDLQESCRKRGVAVYILLDQTLLPHFLDMCMDLRVHPEQEK
FT                   LMTVRTITGNIYYARSGTKVVGKVHEKFTLIDGIRVATGSYSFTWTDGKLNSSNLVILS
FT                   GQVVEHFDLEFRILYAQSEPISSKLLSNFQINSKFDHLADRKPQSKEPTLGNLLRMRLA
FT                   RLSSTPRKSNLGPEELPKDRAKPKRPDSEASTISDEDYFHSHKDQLEDSKVADAATQTE
FT                   PGEEMAAVSLSEVGTQTSSSMMCVGTQTTVVTRAASSQATVWSKSTTTQTEADESFLPQ
FT                   GAQSKEGSPASKMSVSRSSSVRSSSSVSSQGSLASSVSSHVSLTAADLHTPAYPKYLGL
FT                   GTPHLDLCLRDSFRNLSKERQVHFTGIRSRLTQMLTVLSRRTLFTEHYLSYSPGSFTRA
FT                   STNLVSVRDIALYPPYQ"
FT   gene            7483069..7547878
FT                   /gene="Dhx35"
FT                   /locus_tag="mCG_114772"
FT                   /note="gene_id=mCG114772.1"
FT   mRNA            join(7483069..7483177,7489608..7489741,7494639..7494731,
FT                   7495164..7495241,7503911..7504015,7505844..7505905,
FT                   7506743..7506812,7508867..7508926,7514786..7514898,
FT                   7516384..7516480,7517985..7518143,7520161..7520371,
FT                   7523369..7523493,7525140..7525194,7530328..7530423,
FT                   7532081..7532175,7532632..7532709,7533854..7533983,
FT                   7536610..7536691,7541402..7541513,7546742..7547878)
FT                   /gene="Dhx35"
FT                   /locus_tag="mCG_114772"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 35,
FT                   transcript variant mCT115869"
FT                   /note="gene_id=mCG114772.1 transcript_id=mCT115869.1
FT                   created on 01-OCT-2002"
FT   mRNA            join(<7483130..7483177,7489608..7489741,7494639..7494731,
FT                   7495164..7495241,7503891..7504015,7505844..7505905,
FT                   7506743..7506812,7508867..7508926,7514786..7514898,
FT                   7516384..7516480,7517985..7518143,7520161..7520371,
FT                   7523369..7523493,7525140..7525194,7530328..7530423,
FT                   7532081..7532175,7532632..7532709,7533854..7533983,
FT                   7536610..7536691,7539173..7539244,7541402..7541513,
FT                   7546742..7547878)
FT                   /gene="Dhx35"
FT                   /locus_tag="mCG_114772"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 35,
FT                   transcript variant mCT173812"
FT                   /note="gene_id=mCG114772.1 transcript_id=mCT173812.0
FT                   created on 01-OCT-2002"
FT   CDS             join(7483138..7483177,7489608..7489741,7494639..7494731,
FT                   7495164..7495241,7503911..7504015,7505844..7505905,
FT                   7506743..7506812,7508867..7508926,7514786..7514898,
FT                   7516384..7516480,7517985..7518143,7520161..7520371,
FT                   7523369..7523493,7525140..7525194,7530328..7530423,
FT                   7532081..7532175,7532632..7532709,7533854..7533983,
FT                   7536610..7536691,7541402..7541513,7546742..7546786)
FT                   /codon_start=1
FT                   /gene="Dhx35"
FT                   /locus_tag="mCG_114772"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 35,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114772.1 transcript_id=mCT115869.1
FT                   protein_id=mCP73193.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8K1G9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1918965"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K1G9"
FT                   /protein_id="EDL06283.1"
FT                   /translation="MAAPLGPVKFWKPGTEGPGVSISEERQSVTENSGTTIIYNPYAAL
FT                   SIEQQRQKLPVFKLRNHILYLVENYQTVVIVGETGCGKSTQIPQYLAEAGWTAEGRVVG
FT                   VTQPRRVAAVTVAGRVADERGAVLGHEVGYCIRFDDCTDPLATRIKFLTDGMLVREMMV
FT                   DPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASATLDAEKFRDFFNQ
FT                   NETSDPARDTSVTLTVEGRTFPVDIFYLQSPVPDYIKATVDTVVKIHQTEGDGDILAFL
FT                   TGQEEVETVVSMLIEQARALARTGMKKHLRVLPMYAGLPSFEQMKVFERVSHSVRKVIV
FT                   ATNVAETSITISGIVYVIDCGFMKLRAYNPRTAIECLVVVPVSQASANQRAGRGGRNRS
FT                   GKCYRLYTEEAFDQLPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSPPPAQSMVQ
FT                   ALELLYALGGLDKDCRLTEPLGMRIAEFPLNPMFAKMLLESGNFGCSQEVLSIAAMMQI
FT                   QNVFVFPSNQKSQATRVHRKFAVEEGDHLTMLNVYEAFIKHNKSSQWCQEHFLNYKGLV
FT                   RAATVRDQLKKLLVKFQVPKVSSEGDPDPVLRCIVSGFFANAARFHSSGAYRVIYNEVI
FT                   QTSKYYMRDVTAIESAWLLELAPHFYQQGTHLSLKAKRAKVQDQ"
FT   assembly_gap    7486353..7486641
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    7496847..7497157
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   CDS             join(<7503896..7504015,7505844..7505905,7506743..7506812,
FT                   7508867..7508926,7514786..7514898,7516384..7516480,
FT                   7517985..7518143,7520161..7520371,7523369..7523493,
FT                   7525140..7525194,7530328..7530423,7532081..7532175,
FT                   7532632..7532709,7533854..7533983,7536610..7536691,
FT                   7539173..7539244,7541402..7541513,7546742..7546786)
FT                   /codon_start=1
FT                   /gene="Dhx35"
FT                   /locus_tag="mCG_114772"
FT                   /product="DEAH (Asp-Glu-Ala-His) box polypeptide 35,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114772.1 transcript_id=mCT173812.0
FT                   protein_id=mCP96731.0 isoform=CRA_b"
FT                   /protein_id="EDL06284.1"
FT                   /translation="SFFPKVAGRVADERGAVLGHEVGYCIRFDDCTDPLATRIKFLTDG
FT                   MLVREMMVDPLLTKYSVIMLDEAHERTLYTDIAIGLLKKIQKKRGDLRLIVASATLDAE
FT                   KFRDFFNQNETSDPARDTSVTLTVEGRTFPVDIFYLQSPVPDYIKATVDTVVKIHQTEG
FT                   DGDILAFLTGQEEVETVVSMLIEQARALARTGMKKHLRVLPMYAGLPSFEQMKVFERVS
FT                   HSVRKVIVATNVAETSITISGIVYVIDCGFMKLRAYNPRTAIECLVVVPVSQASANQRA
FT                   GRGGRNRSGKCYRLYTEEAFDQLPQSTVPEMQRSNLAPVILQLKALGIDNVLRFHFMSP
FT                   PPAQSMVQALELLYALGGLDKDCRLTEPLGMRIAEFPLNPMFAKMLLESGNFGCSQEVL
FT                   SIAAMMQIQNVFVFPSNQKSQATRVHRKFAVEEGDHLTMLNVYEAFIKHNKSSQWCQEH
FT                   FLNYKGLVRAATVRDQLKKLLVKFQVPKVSSEGDPDPVLRCIVSGFFANAARFHSSGAY
FT                   RTIRDDHELHIHPASVLYAEKPPRWVIYNEVIQTSKYYMRDVTAIESAWLLELAPHFYQ
FT                   QGTHLSLKAKRAKVQDQ"
FT   assembly_gap    7528307..7528326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7529389..7529408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7536098..7536117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7543533..7544044
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    7574410..7574429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7579228..7579500
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    7581404..7582835
FT                   /estimated_length=1432
FT                   /gap_type="unknown"
FT   assembly_gap    7586829..7587522
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    7608252..7608486
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    7615493..7615512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7617394..7617568
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    7619075..7619094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7627100..7627119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7642519..7642538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7643935..7643954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7666115..7668183
FT                   /estimated_length=2069
FT                   /gap_type="unknown"
FT   assembly_gap    7691671..7691690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7721565..7721656
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    7736430..7736514
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    7756306..7756327
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    7757639..7757658
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7772635..7772780
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    7795643..7795805
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    7818697..7819198
FT                   /estimated_length=502
FT                   /gap_type="unknown"
FT   assembly_gap    7854243..7854262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7927856..7927875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7969903..7969922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8007448..8007600
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    8038788..8042066
FT                   /estimated_length=3279
FT                   /gap_type="unknown"
FT   assembly_gap    8044001..8044082
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    8056664..8057142
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   assembly_gap    8115490..8115509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8133359..8133378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8135153..8135172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8145912..8149594
FT                   /estimated_length=3683
FT                   /gap_type="unknown"
FT   assembly_gap    8213317..8213534
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    8233881..8233900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8274783..8274802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8314391..8314410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8318630..8318649
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8319679..8319698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8322248..8322267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8335454..8337122
FT                   /estimated_length=1669
FT                   /gap_type="unknown"
FT   assembly_gap    8428760..8428779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8455879..8462174
FT                   /estimated_length=6296
FT                   /gap_type="unknown"
FT   assembly_gap    8471646..8477973
FT                   /estimated_length=6328
FT                   /gap_type="unknown"
FT   assembly_gap    8479170..8479934
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   assembly_gap    8480895..8480914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8496331..8496350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8519804..8519823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8520848..8520867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8522002..8522021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8523130..8523149
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8525501..8525520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8526988..8527007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8528133..8528152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8531319..8532405
FT                   /estimated_length=1087
FT                   /gap_type="unknown"
FT   assembly_gap    8564090..8564109
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8566689..8566760
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    8593671..8593690
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8599322..8599367
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    8622335..8623763
FT                   /estimated_length=1429
FT                   /gap_type="unknown"
FT   gene            <8634201..8669622
FT                   /locus_tag="mCG_113487"
FT                   /note="gene_id=mCG113487.0"
FT   mRNA            join(<8634201..8634338,8637834..8637973,8655694..8655850,
FT                   8661088..8661166,8665588..8665663,8666569..8666689,
FT                   8669205..8669622)
FT                   /locus_tag="mCG_113487"
FT                   /product="mCG113487"
FT                   /note="gene_id=mCG113487.0 transcript_id=mCT114571.1
FT                   created on 01-OCT-2002"
FT   CDS             join(<8661104..8661166,8665588..8665663,8666569..8666666)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113487"
FT                   /product="mCG113487"
FT                   /note="gene_id=mCG113487.0 transcript_id=mCT114571.1
FT                   protein_id=mCP72835.0"
FT                   /protein_id="EDL06285.1"
FT                   /translation="NKMFTVEPLYAPDLHPTLTYQASPILSLMKMNCTMDKHQGSMKRN
FT                   KVPGTAEVMGLTYRHGHVQEPQHTQPVLQMAHE"
FT   assembly_gap    8662357..8662376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8682282..8682301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8705307..8729232
FT                   /locus_tag="mCG_141216"
FT                   /note="gene_id=mCG141216.0"
FT   mRNA            join(<8705307..8705406,8713921..8713976,8714729..8714841,
FT                   8728895..8729232)
FT                   /locus_tag="mCG_141216"
FT                   /product="mCG141216"
FT                   /note="gene_id=mCG141216.0 transcript_id=mCT173811.0
FT                   created on 01-OCT-2002"
FT   CDS             join(<8714787..8714841,8728895..8728992)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141216"
FT                   /product="mCG141216"
FT                   /note="gene_id=mCG141216.0 transcript_id=mCT173811.0
FT                   protein_id=mCP96730.0"
FT                   /protein_id="EDL06286.1"
FT                   /translation="HIHTSLKKKKGQQYSFWRRYLSCTLEEAHYVLEDSIPGKTMRISE
FT                   VRTTF"
FT   assembly_gap    8731736..8731755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8774203..8774222
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8782701..8786290
FT                   /estimated_length=3590
FT                   /gap_type="unknown"
FT   assembly_gap    8803401..8803420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8825591..8826214
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    8836717..8837015
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    8939006..8939423
FT                   /estimated_length=418
FT                   /gap_type="unknown"
FT   assembly_gap    8945933..8945952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8997411..>8999639)
FT                   /locus_tag="mCG_60974"
FT                   /note="gene_id=mCG60974.2"
FT   mRNA            complement(join(8997411..8998084,8999512..>8999639))
FT                   /locus_tag="mCG_60974"
FT                   /product="mCG60974"
FT                   /note="gene_id=mCG60974.2 transcript_id=mCT61157.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(join(8997878..8998084,8999512..>8999637))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60974"
FT                   /product="mCG60974"
FT                   /note="gene_id=mCG60974.2 transcript_id=mCT61157.2
FT                   protein_id=mCP28467.2"
FT                   /protein_id="EDL06287.1"
FT                   /translation="LCACSPGLRPASQASQKPSSYTDAMKLGTGIVMGERVGVVAWVLR
FT                   NFWRSPCVCVSFSRQLHQAASDVSGWSHRKLQDTEDQEMKPQSYPFLHPYPHPDPRVPQ
FT                   RLWRSG"
FT   assembly_gap    9001219..9001294
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    9005021..9005916
FT                   /estimated_length=896
FT                   /gap_type="unknown"
FT   assembly_gap    9032513..9032532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9050885..9052910)
FT                   /gene="Mafb"
FT                   /locus_tag="mCG_12443"
FT                   /note="gene_id=mCG12443.2"
FT   mRNA            complement(9050885..9052910)
FT                   /gene="Mafb"
FT                   /locus_tag="mCG_12443"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   family, protein B (avian)"
FT                   /note="gene_id=mCG12443.2 transcript_id=mCT13163.2 created
FT                   on 01-OCT-2002"
FT   CDS             complement(9051552..9052523)
FT                   /codon_start=1
FT                   /gene="Mafb"
FT                   /locus_tag="mCG_12443"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   family, protein B (avian)"
FT                   /note="gene_id=mCG12443.2 transcript_id=mCT13163.2
FT                   protein_id=mCP5929.1"
FT                   /db_xref="GOA:P54841"
FT                   /db_xref="InterPro:IPR004826"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="InterPro:IPR013592"
FT                   /db_xref="InterPro:IPR024874"
FT                   /db_xref="InterPro:IPR028571"
FT                   /db_xref="MGI:MGI:104555"
FT                   /db_xref="PDB:2WT7"
FT                   /db_xref="PDB:2WTY"
FT                   /db_xref="PDB:4AUW"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54841"
FT                   /protein_id="EDL06288.1"
FT                   /translation="MAAELSMGQELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRP
FT                   CTRLQPAGSVSSTPLSTPCSSVPSSPSFSPTEPKTHLEDLYWMASNYQQMNPEALNLTP
FT                   EDAVEALIGSHPVPQPLQSFDGFRSAHHHHHHHHPHPHHGYPGAGVTHDDLGQHAHPHH
FT                   HHHHQASPPPSSAASPAQQLPTSHPGPGPHATAAATAAGGNGSVEDRFSDDQLVSMSVR
FT                   ELNRHLRGFTKDEVIRLKQKRRTLKNRGYAQSCRYKRVQQKHHLENEKTQLIQQVEQLK
FT                   QEVSRLARERDAYKVKCEKLANSGFREAGSTSDSPSSPEFFL"
FT   assembly_gap    9067345..9067364
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9078098..9078117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9096057..9096076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9186681..9186807
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    9222507..9222654
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    9223490..9223682
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    9224676..9224715
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    9227120..9227142
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   assembly_gap    9246253..9247563
FT                   /estimated_length=1311
FT                   /gap_type="unknown"
FT   assembly_gap    9249949..9249968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9253080..9253464
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    9264822..9264841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9292146..9292214
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    9308901..9308920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9316516..9316771
FT                   /estimated_length=256
FT                   /gap_type="unknown"
FT   assembly_gap    9323272..9323724
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   gene            9332645..9409499
FT                   /gene="Top1"
FT                   /locus_tag="mCG_15357"
FT                   /note="gene_id=mCG15357.2"
FT   mRNA            join(9332645..9332950,9333296..9333320,9356807..9356909,
FT                   9369381..9369504,9371178..9371233,9374378..9374473,
FT                   9377007..9377082,9380426..9380532,9384854..9384969,
FT                   9389433..9389554,9390303..9390425,9391514..9391701,
FT                   9391908..9392052,9399376..9399519,9400812..9400997,
FT                   9401777..9401845,9402444..9402558,9404118..9404245,
FT                   9407308..9407402,9407656..9407805,9408181..9409499)
FT                   /gene="Top1"
FT                   /locus_tag="mCG_15357"
FT                   /product="topoisomerase (DNA) I"
FT                   /note="gene_id=mCG15357.2 transcript_id=mCT15844.2 created
FT                   on 24-OCT-2002"
FT   CDS             join(9332918..9332950,9333296..9333320,9356807..9356909,
FT                   9369381..9369504,9371178..9371233,9374378..9374473,
FT                   9377007..9377082,9380426..9380532,9384854..9384969,
FT                   9389433..9389554,9390303..9390425,9391514..9391701,
FT                   9391908..9392052,9399376..9399519,9400812..9400997,
FT                   9401777..9401845,9402444..9402558,9404118..9404245,
FT                   9407308..9407402,9407656..9407805,9408181..9408283)
FT                   /codon_start=1
FT                   /gene="Top1"
FT                   /locus_tag="mCG_15357"
FT                   /product="topoisomerase (DNA) I"
FT                   /note="gene_id=mCG15357.2 transcript_id=mCT15844.2
FT                   protein_id=mCP6013.0"
FT                   /protein_id="EDL06289.1"
FT                   /translation="MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKDKDKD
FT                   REKSKHSNSEHKDSEKKHKEKEKTKHKDGSSEKHKDKHKDRDKERRKEEKIRAAGDAKI
FT                   KKEKENGFSSPPRIKDEPEDDGYFAPPKEDIKPLKRLRDEDDADYKPKKIKTEDIKKEK
FT                   KRKSEEEEDGKLKKPKNKDKDKKVAEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFL
FT                   EHKGPVFAPPYEPLPESVKFYYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFF
FT                   KDWRKEMTNDEKNTITNLSKCDFTQMSQYFKAQSEARKQMSKEEKLKIKEENEKLLKEY
FT                   GFCVMDNHRERIANFKIEPPGLFRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPP
FT                   GHKWKEVRHDNKVTWLVSWTENIQGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDK
FT                   IRNQYREDWKSKEMKVRQRAVALYFIDKLALRAGNEKEEGETADTVGCCSLRVEHINLH
FT                   PELDGQEYVVEFDFPGKDSIRYYNKVPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILN
FT                   KHLQDLMEGLTAKVFRTYNASITLQQQLKELTAPDENVPAKILSYNRANRAVAILCNHQ
FT                   RAPPKTFEKSMMNLQSKIDAKKDQLADARRDLKSAKADAKVMKDAKTKKVVESKKKAVQ
FT                   RLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREK
FT                   FAWAIDMTDEDYEF"
FT   gene            9418033..9462374
FT                   /gene="Plcg1"
FT                   /locus_tag="mCG_15356"
FT                   /note="gene_id=mCG15356.2"
FT   mRNA            join(9418033..9418077,9418447..9418762,9434504..9434656,
FT                   9434763..9434856,9435011..9435058,9437692..9437776,
FT                   9437872..9437955,9438165..9438199,9438362..9438434,
FT                   9438513..9438614,9438817..9438935,9439024..9439109,
FT                   9439183..9439303,9439914..9440082,9440171..9440293,
FT                   9440372..9440473,9440553..9440740,9441014..9441214,
FT                   9441292..9441411,9441490..9441670,9442470..9442547,
FT                   9443270..9443373,9443599..9443695,9443943..9444012,
FT                   9444701..9444858,9446183..9446279,9446411..9446635,
FT                   9446712..9446860,9447809..9447923,9448034..9448195,
FT                   9448289..9448377,9448468..9448652,9461257..9461316,
FT                   9462079..9462374)
FT                   /gene="Plcg1"
FT                   /locus_tag="mCG_15356"
FT                   /product="phospholipase C, gamma 1, transcript variant
FT                   mCT174669"
FT                   /note="gene_id=mCG15356.2 transcript_id=mCT174669.0 created
FT                   on 24-OCT-2002"
FT   mRNA            join(9418033..9418077,9418447..9418762,9434504..9434656,
FT                   9434763..9434856,9435011..9435058,9437692..9437776,
FT                   9437872..9437955,9438165..9438199,9438362..9438434,
FT                   9438513..9438614,9438817..9438935,9439024..9439109,
FT                   9439183..9439303,9439914..9440082,9440171..9440293,
FT                   9440372..9440473,9440553..9440740,9441014..9441214,
FT                   9441292..9441411,9441490..9441670,9442470..9442547,
FT                   9443270..9443373,9443599..9443695,9443943..9444012,
FT                   9444701..9444858,9446183..9446279,9446411..9446635,
FT                   9446712..9446860,9447809..9447923,9448034..9448195,
FT                   9448289..9448377,9448468..9448652,9448823..9450018)
FT                   /gene="Plcg1"
FT                   /locus_tag="mCG_15356"
FT                   /product="phospholipase C, gamma 1, transcript variant
FT                   mCT174668"
FT                   /note="gene_id=mCG15356.2 transcript_id=mCT174668.0 created
FT                   on 24-OCT-2002"
FT   mRNA            9418511..9419596
FT                   /gene="Plcg1"
FT                   /locus_tag="mCG_15356"
FT                   /product="phospholipase C, gamma 1, transcript variant
FT                   mCT15843"
FT                   /note="gene_id=mCG15356.2 transcript_id=mCT15843.1 created
FT                   on 24-OCT-2002"
FT   CDS             join(9418546..9418762,9434504..9434656,9434763..9434856,
FT                   9435011..9435058,9437692..9437776,9437872..9437955,
FT                   9438165..9438199,9438362..9438434,9438513..9438614,
FT                   9438817..9438935,9439024..9439109,9439183..9439303,
FT                   9439914..9440082,9440171..9440293,9440372..9440473,
FT                   9440553..9440740,9441014..9441214,9441292..9441411,
FT                   9441490..9441670,9442470..9442547,9443270..9443373,
FT                   9443599..9443695,9443943..9444012,9444701..9444858,
FT                   9446183..9446279,9446411..9446635,9446712..9446860,
FT                   9447809..9447923,9448034..9448195,9448289..9448377,
FT                   9448468..9448652,9461257..9461316,9462079..9462097)
FT                   /codon_start=1
FT                   /gene="Plcg1"
FT                   /locus_tag="mCG_15356"
FT                   /product="phospholipase C, gamma 1, isoform CRA_b"
FT                   /note="gene_id=mCG15356.2 transcript_id=mCT174669.0
FT                   protein_id=mCP97588.0 isoform=CRA_b"
FT                   /protein_id="EDL06291.1"
FT                   /translation="MAGVATPCANGCGPGAPSEAEVLHLCRSLEVGTVMTLFYSKKSQR
FT                   PERKTFQVKLETRQITWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQS
FT                   HCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYS
FT                   VDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMY
FT                   SAQKTMDLPFLETNALRTGERPEHCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFL
FT                   RDPLREIEEPYFFLDELVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLT
FT                   GDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKE
FT                   HAFVASEYPVILSIEDHCSIAQQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLRRK
FT                   ILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKI
FT                   YYSEETSSDQGNEDEEEPKEASSSTELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIET
FT                   GAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDL
FT                   ITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVR
FT                   KRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLR
FT                   YPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTF
FT                   TKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMINPAVLEPEREHLDENSPLGDL
FT                   LRGVLDVPACQIAIRPEGKNNRLFVFSISMPSVAQWSLDVAADSQEELQDWVKKIREVA
FT                   QTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAE
FT                   KYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQ
FT                   MNQALFMAGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCVICIEVLGARHLPKNGRGI
FT                   VCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDM
FT                   FSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLIKIDIFPAKENGDLSPFSG
FT                   ISLRERASDASSQLFHVRAREGSFEARYQQPFEDFRISQEHLADHFDSRERSTSDGPSS
FT                   ATNLIEDPLHDKLWKCSL"
FT   CDS             join(9418546..9418762,9434504..9434656,9434763..9434856,
FT                   9435011..9435058,9437692..9437776,9437872..9437955,
FT                   9438165..9438199,9438362..9438434,9438513..9438614,
FT                   9438817..9438935,9439024..9439109,9439183..9439303,
FT                   9439914..9440082,9440171..9440293,9440372..9440473,
FT                   9440553..9440740,9441014..9441214,9441292..9441411,
FT                   9441490..9441670,9442470..9442547,9443270..9443373,
FT                   9443599..9443695,9443943..9444012,9444701..9444858,
FT                   9446183..9446279,9446411..9446635,9446712..9446860,
FT                   9447809..9447923,9448034..9448195,9448289..9448377,
FT                   9448468..9448652,9448823..9448865)
FT                   /codon_start=1
FT                   /gene="Plcg1"
FT                   /locus_tag="mCG_15356"
FT                   /product="phospholipase C, gamma 1, isoform CRA_c"
FT                   /note="gene_id=mCG15356.2 transcript_id=mCT174668.0
FT                   protein_id=mCP97587.0 isoform=CRA_c"
FT                   /db_xref="GOA:A2A4A6"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR000909"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR001711"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016279"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028380"
FT                   /db_xref="MGI:MGI:97615"
FT                   /db_xref="UniProtKB/TrEMBL:A2A4A6"
FT                   /protein_id="EDL06292.1"
FT                   /translation="MAGVATPCANGCGPGAPSEAEVLHLCRSLEVGTVMTLFYSKKSQR
FT                   PERKTFQVKLETRQITWSRGADKIEGSIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQS
FT                   HCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIERWLRKQFYS
FT                   VDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMY
FT                   SAQKTMDLPFLETNALRTGERPEHCQVSLSEFQQFLLEYQGELWAVDRLQVQEFMLSFL
FT                   RDPLREIEEPYFFLDELVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLT
FT                   GDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKE
FT                   HAFVASEYPVILSIEDHCSIAQQRNMAQHFRKVLGDTLLTKPVDIAADGLPSPNQLRRK
FT                   ILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKI
FT                   YYSEETSSDQGNEDEEEPKEASSSTELHSSEKWFHGKLGAGRDGRHIAERLLTEYCIET
FT                   GAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDL
FT                   ITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVR
FT                   KRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLR
FT                   YPINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQREDELTF
FT                   TKSAIIQNVEKQDGGWWRGDYGGKKQLWFPSNYVEEMINPAVLEPEREHLDENSPLGDL
FT                   LRGVLDVPACQIAIRPEGKNNRLFVFSISMPSVAQWSLDVAADSQEELQDWVKKIREVA
FT                   QTADARLTEGKMMERRKKIALELSELVVYCRPVPFDEEKIGTERACYRDMSSFPETKAE
FT                   KYVNKAKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQ
FT                   MNQALFMAGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPCVICIEVLGARHLPKNGRGI
FT                   VCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDM
FT                   FSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDLELASLLIKIDIFPAKENGDLSPFSG
FT                   ISLRERASDASSQLFHVRAREGSFEARYQQPFEDFRISQEHLADHFDSRERRAPRRTRV
FT                   NGDNRL"
FT   CDS             9418546..9418941
FT                   /codon_start=1
FT                   /gene="Plcg1"
FT                   /locus_tag="mCG_15356"
FT                   /product="phospholipase C, gamma 1, isoform CRA_a"
FT                   /note="gene_id=mCG15356.2 transcript_id=mCT15843.1
FT                   protein_id=mCP5996.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q9Z2S5"
FT                   /db_xref="InterPro:IPR001192"
FT                   /db_xref="InterPro:IPR028380"
FT                   /db_xref="MGI:MGI:97615"
FT                   /db_xref="UniProtKB/TrEMBL:Q9Z2S5"
FT                   /protein_id="EDL06290.1"
FT                   /translation="MAGVATPCANGCGPGAPSEAEVLHLCRSLEVGTVMTLFYSKKSQR
FT                   PERKTFQVKLETRQITWSRGADKIEGSSKCAPLRPASRLPASQTLGQTFGPRAWRPVSA
FT                   QSLVVTLGRVEGGIRVLDHLIGHPLPQ"
FT   gene            complement(9435437..>9558338)
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /note="gene_id=mCG52843.3"
FT   mRNA            complement(join(9435437..9438638,9517689..9517810,
FT                   9558130..>9558338))
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /product="zinc fingers and homeoboxes 3, transcript variant
FT                   mCT174673"
FT                   /note="gene_id=mCG52843.3 transcript_id=mCT174673.1 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(9438303..9438638,9517689..9517810,
FT                   9558130..>9558337))
FT                   /codon_start=1
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /product="zinc fingers and homeoboxes 3, isoform CRA_b"
FT                   /note="gene_id=mCG52843.3 transcript_id=mCT174673.1
FT                   protein_id=mCP97591.1 isoform=CRA_b"
FT                   /protein_id="EDL06294.1"
FT                   /translation="ECHRARPSGRESVGAARLRPRSSPWIWRRHRRRRRLRGACAGRPP
FT                   TKEGGRLAAWGEQRGPRVPPPPPPGLNCSYRGSKRLLKDATGLQKVKGTLEKMMKEKEC
FT                   FSQGQENGGKGEAHLIQEEVWLLNLSQGVSKEAEHEFLHLEPVDSPQLLPGKEVMEEAT
FT                   NDEATLQPNSLAQTYPLVFKEELLELRKGHLAMLRTLSSPVGRKPSVWHWLTKGPRLV"
FT   mRNA            complement(join(9452515..9458354,9466130..9469108,
FT                   9517689..9517810,9558130..9558321))
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /product="zinc fingers and homeoboxes 3, transcript variant
FT                   mCT174671"
FT                   /note="gene_id=mCG52843.3 transcript_id=mCT174671.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(9452515..9458354,9466130..9469108,
FT                   9517689..9517810,9544833..9544997))
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /product="zinc fingers and homeoboxes 3, transcript variant
FT                   mCT174672"
FT                   /note="gene_id=mCG52843.3 transcript_id=mCT174672.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(9452515..9458354,9466130..9469108,
FT                   9517689..9517810,9522619..9522690))
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /product="zinc fingers and homeoboxes 3, transcript variant
FT                   mCT53026"
FT                   /note="gene_id=mCG52843.3 transcript_id=mCT53026.2 created
FT                   on 13-JUN-2003"
FT   gene            <9455438..9456489
FT                   /locus_tag="mCG_141339"
FT                   /note="gene_id=mCG141339.0"
FT   mRNA            <9455438..9456489
FT                   /locus_tag="mCG_141339"
FT                   /product="mCG141339"
FT                   /note="gene_id=mCG141339.0 transcript_id=mCT174670.0
FT                   created on 24-OCT-2002"
FT   CDS             <9455908..9456171
FT                   /codon_start=1
FT                   /locus_tag="mCG_141339"
FT                   /product="mCG141339"
FT                   /note="gene_id=mCG141339.0 transcript_id=mCT174670.0
FT                   protein_id=mCP97589.0"
FT                   /protein_id="EDL06297.1"
FT                   /translation="TWYLPTYTPTPLSVHPCLVPKALPWSAYAMTTSLTIIYQTRSKPQ
FT                   LPSPIQGQRKQLVSYLNNLAITSSEKGVLGPVLLQLPIQKTT"
FT   CDS             complement(join(9458344..9458354,9466130..9468974))
FT                   /codon_start=1
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /product="zinc fingers and homeoboxes 3, isoform CRA_a"
FT                   /note="gene_id=mCG52843.3 transcript_id=mCT174671.1
FT                   protein_id=mCP97590.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UPQ8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR024578"
FT                   /db_xref="MGI:MGI:2444772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPQ8"
FT                   /protein_id="EDL06293.1"
FT                   /translation="MASKRKSTTPCMIPVKTVVLPGASTEPQPVESLPEGPQQDLPSEA
FT                   PDASSEAAPNPSSTDGSALANGHRSTLDGYVYCCKECEFRSQDVTHFIGHMNSEHTDFN
FT                   KDPTFVCTGCSFLAKNPEGLSLHNAKCHSGEASFLWNVTKPDNHVVVEQSVPDSASSSV
FT                   LAGESTTEGTEIIITKTPIMKIMKGKAEAKKIHMLKENAPNQPGSEALPKPLAGEREVK
FT                   EGDHTFINGAAPGSQASAKSTKPPPAANGPLIGTVPVLPAGIAQFLSLQQQPPVHAQHH
FT                   THQPLPTSKTLPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYP
FT                   EEQLKIWFTAQRLKQGISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQ
FT                   HLIQATLPGHAVGQPEGTAGGLLVTQPLMANGLQASSSSLPLTTASVPKPTVAPINTVC
FT                   SNSASAVKVVNAAQSLLTACPSITSQAFLDANIYKNKKSHEQLSALKGSFCRNQFPGQS
FT                   EVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMMPGEHGSVLIDSVPEVPFPLASK
FT                   VPEVTCIPTATSLVSHPATKRQSWHQTPDFTPTKYKERAPEQLRVLENSFAQNPLPPEE
FT                   ELDRLRSETKMTRREIDGWFSERRKKVNTEETKKADGHMPKEEEEGAEQEGRDEELANE
FT                   LRVPGENGSPEMFLSHALAERKVSPIKINLKNLRVTEASGKSEFPGMGVCEPEEDGLNK
FT                   LVEQPPSKVSYKKTAQQRHLLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRY
FT                   ALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLCEEDLQTLCDKTQMSA
FT                   QQVKQWFAEKMGEETRAVADISSEDQGPRNGEPVAVHKVLGDAYSELSENSESWEPSAP
FT                   EASSEPFDTSSPQSGRQLEAD"
FT   CDS             complement(join(9458344..9458354,9466130..9468974))
FT                   /codon_start=1
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /product="zinc fingers and homeoboxes 3, isoform CRA_a"
FT                   /note="gene_id=mCG52843.3 transcript_id=mCT174672.1
FT                   protein_id=mCP97592.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UPQ8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR024578"
FT                   /db_xref="MGI:MGI:2444772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPQ8"
FT                   /protein_id="EDL06295.1"
FT                   /translation="MASKRKSTTPCMIPVKTVVLPGASTEPQPVESLPEGPQQDLPSEA
FT                   PDASSEAAPNPSSTDGSALANGHRSTLDGYVYCCKECEFRSQDVTHFIGHMNSEHTDFN
FT                   KDPTFVCTGCSFLAKNPEGLSLHNAKCHSGEASFLWNVTKPDNHVVVEQSVPDSASSSV
FT                   LAGESTTEGTEIIITKTPIMKIMKGKAEAKKIHMLKENAPNQPGSEALPKPLAGEREVK
FT                   EGDHTFINGAAPGSQASAKSTKPPPAANGPLIGTVPVLPAGIAQFLSLQQQPPVHAQHH
FT                   THQPLPTSKTLPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYP
FT                   EEQLKIWFTAQRLKQGISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQ
FT                   HLIQATLPGHAVGQPEGTAGGLLVTQPLMANGLQASSSSLPLTTASVPKPTVAPINTVC
FT                   SNSASAVKVVNAAQSLLTACPSITSQAFLDANIYKNKKSHEQLSALKGSFCRNQFPGQS
FT                   EVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMMPGEHGSVLIDSVPEVPFPLASK
FT                   VPEVTCIPTATSLVSHPATKRQSWHQTPDFTPTKYKERAPEQLRVLENSFAQNPLPPEE
FT                   ELDRLRSETKMTRREIDGWFSERRKKVNTEETKKADGHMPKEEEEGAEQEGRDEELANE
FT                   LRVPGENGSPEMFLSHALAERKVSPIKINLKNLRVTEASGKSEFPGMGVCEPEEDGLNK
FT                   LVEQPPSKVSYKKTAQQRHLLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRY
FT                   ALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLCEEDLQTLCDKTQMSA
FT                   QQVKQWFAEKMGEETRAVADISSEDQGPRNGEPVAVHKVLGDAYSELSENSESWEPSAP
FT                   EASSEPFDTSSPQSGRQLEAD"
FT   CDS             complement(join(9458344..9458354,9466130..9468974))
FT                   /codon_start=1
FT                   /gene="Zhx3"
FT                   /locus_tag="mCG_52843"
FT                   /product="zinc fingers and homeoboxes 3, isoform CRA_a"
FT                   /note="gene_id=mCG52843.3 transcript_id=mCT53026.2
FT                   protein_id=mCP28488.3 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UPQ8"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="InterPro:IPR024578"
FT                   /db_xref="MGI:MGI:2444772"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UPQ8"
FT                   /protein_id="EDL06296.1"
FT                   /translation="MASKRKSTTPCMIPVKTVVLPGASTEPQPVESLPEGPQQDLPSEA
FT                   PDASSEAAPNPSSTDGSALANGHRSTLDGYVYCCKECEFRSQDVTHFIGHMNSEHTDFN
FT                   KDPTFVCTGCSFLAKNPEGLSLHNAKCHSGEASFLWNVTKPDNHVVVEQSVPDSASSSV
FT                   LAGESTTEGTEIIITKTPIMKIMKGKAEAKKIHMLKENAPNQPGSEALPKPLAGEREVK
FT                   EGDHTFINGAAPGSQASAKSTKPPPAANGPLIGTVPVLPAGIAQFLSLQQQPPVHAQHH
FT                   THQPLPTSKTLPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYP
FT                   EEQLKIWFTAQRLKQGISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVASAGNVQ
FT                   HLIQATLPGHAVGQPEGTAGGLLVTQPLMANGLQASSSSLPLTTASVPKPTVAPINTVC
FT                   SNSASAVKVVNAAQSLLTACPSITSQAFLDANIYKNKKSHEQLSALKGSFCRNQFPGQS
FT                   EVEHLTKVTGLSTREVRKWFSDRRYHCRNLKGSRAMMPGEHGSVLIDSVPEVPFPLASK
FT                   VPEVTCIPTATSLVSHPATKRQSWHQTPDFTPTKYKERAPEQLRVLENSFAQNPLPPEE
FT                   ELDRLRSETKMTRREIDGWFSERRKKVNTEETKKADGHMPKEEEEGAEQEGRDEELANE
FT                   LRVPGENGSPEMFLSHALAERKVSPIKINLKNLRVTEASGKSEFPGMGVCEPEEDGLNK
FT                   LVEQPPSKVSYKKTAQQRHLLRQLFVQTQWPSNQDYDSIMAQTGLPRPEVVRWFGDSRY
FT                   ALKNGQLKWYEDYKRGNFPPGLLVIAPGNRELLQDYYMTHKMLCEEDLQTLCDKTQMSA
FT                   QQVKQWFAEKMGEETRAVADISSEDQGPRNGEPVAVHKVLGDAYSELSENSESWEPSAP
FT                   EASSEPFDTSSPQSGRQLEAD"
FT   assembly_gap    9510231..9510250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9530890..9531831
FT                   /pseudo
FT                   /locus_tag="mCG_15350"
FT                   /note="gene_id=mCG15350.1"
FT   mRNA            9530890..9531831
FT                   /pseudo
FT                   /locus_tag="mCG_15350"
FT                   /note="gene_id=mCG15350.1 transcript_id=mCT15790.1 created
FT                   on 24-OCT-2002"
FT   gene            9565496..9592781
FT                   /gene="Lpin3"
FT                   /locus_tag="mCG_15354"
FT                   /note="gene_id=mCG15354.2"
FT   mRNA            join(9565496..9566135,9577323..9577715,9579321..9579416,
FT                   9580638..9580888,9581066..9581146,9582065..9582185,
FT                   9582330..9582681,9583945..9584044,9584184..9584344,
FT                   9584885..9584978,9585075..9585144,9586973..9587065,
FT                   9587148..9587191,9587878..9588016,9588918..9589066,
FT                   9589239..9589325,9589798..9589950,9590115..9590229,
FT                   9590318..9590421,9590573..9592781)
FT                   /gene="Lpin3"
FT                   /locus_tag="mCG_15354"
FT                   /product="lipin 3"
FT                   /note="gene_id=mCG15354.2 transcript_id=mCT15842.2 created
FT                   on 24-OCT-2002"
FT   CDS             join(9577524..9577715,9579321..9579416,9580638..9580888,
FT                   9581066..9581146,9582065..9582185,9582330..9582681,
FT                   9583945..9584044,9584184..9584344,9584885..9584978,
FT                   9585075..9585144,9586973..9587065,9587148..9587191,
FT                   9587878..9588016,9588918..9589066,9589239..9589325,
FT                   9589798..9589950,9590115..9590229,9590318..9590421,
FT                   9590573..9590717)
FT                   /codon_start=1
FT                   /gene="Lpin3"
FT                   /locus_tag="mCG_15354"
FT                   /product="lipin 3"
FT                   /note="gene_id=mCG15354.2 transcript_id=mCT15842.2
FT                   protein_id=mCP5958.2"
FT                   /db_xref="InterPro:IPR007651"
FT                   /db_xref="InterPro:IPR013209"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR031315"
FT                   /db_xref="InterPro:IPR031703"
FT                   /db_xref="MGI:MGI:1891342"
FT                   /db_xref="UniProtKB/TrEMBL:Q149B0"
FT                   /protein_id="EDL06298.1"
FT                   /translation="MNYVGQLAETVFGTVKELYRGLNPATLSGGIDVLVVRQRDGSFRC
FT                   SPFHVRFGKLGVLRSREKVVDIEINGEPVDLHMKLGDSGEAFFVQELDSDEEDVPPRLC
FT                   TSPIPWGGLSGFPSDSQIGTASEPEGLVITGRRKRRRRRKPRRREEDAVDSSSEELEAG
FT                   AESELTLLEKPTPESPSAQEAEEPSSQPKDIHPYSDGECTPQANLSSGDLMSPKSDSEL
FT                   ELRSLEPSPLRAESHMQWVWGRLPKVAKAERPEFSLILESMAEAICALPEEPSPSSSPS
FT                   EAGVDTLSPPVLHPGVRADTFHPAVEAHCEETAVDSPLAAPESKETKTQNSRGAGHPPA
FT                   TKSWSWTTPESHTPSGHPQVSRGKGSLKRNQHLGPSDIYLDDLPSLDSENVALYFPKSE
FT                   YGMGARRWSEPSNQKLLESPNPEHIAECTLDSVDKIELSLCGGLADNRDISLEKFTQHM
FT                   VSYEDLTKNPGLLDDPNLVVKINEKHYNWAVAAPMILSLQAFQKNLPESTVDKLEKEKM
FT                   PRKGGRWWFSWRRRDFPAEEHSSQREKAATRKQQGEKTEVLSSDDDVPDSPVILEVPPL
FT                   PSSTPGYVPTYKKSLRLSSDQIRCLNLNEGANDVVFSVTTQYQGTCRCKATIYLWNWDD
FT                   KVVISDIDGTITKSDALGHILPQLGKDWTHQGITSLYHKIHLNGYKFLYCSARAIGMAD
FT                   LTKGYLQWVSEHGCGLPKGPILLSPSSLFSALHREVIEKKPEVFKVACLSDIQQLFLPQ
FT                   RQPFHAAFGNRPNDVFAYRQVGLPESRIFTVNPRGELIQELIKSHKSTYQRLGEVVELL
FT                   FPPVVRGPSTDLASPEYSNLSYWRKPLPYVDFEALA"
FT   gene            complement(9590820..9597631)
FT                   /gene="Emilin3"
FT                   /locus_tag="mCG_15352"
FT                   /note="gene_id=mCG15352.1"
FT   mRNA            complement(join(9590820..9594631,9594922..9595145,
FT                   9596057..9596179,9597323..9597631))
FT                   /gene="Emilin3"
FT                   /locus_tag="mCG_15352"
FT                   /product="elastin microfibril interfacer 3, transcript
FT                   variant mCT15839"
FT                   /note="gene_id=mCG15352.1 transcript_id=mCT15839.2 created
FT                   on 24-OCT-2002"
FT   CDS             complement(join(9592866..9594631,9594922..9595145,
FT                   9596057..9596179,9597323..9597486))
FT                   /codon_start=1
FT                   /gene="Emilin3"
FT                   /locus_tag="mCG_15352"
FT                   /product="elastin microfibril interfacer 3, isoform CRA_a"
FT                   /note="gene_id=mCG15352.1 transcript_id=mCT15839.2
FT                   protein_id=mCP5917.2 isoform=CRA_a"
FT                   /protein_id="EDL06299.1"
FT                   /translation="MGRRLSVWLCTVAALLSGAQAKGTPLLARPAQPSASRYSLYTTGW
FT                   RPRLRPGPHKSLCAYVVHRNVTCVLQEGAESYIKAEYRNCGWGPNCPSTVRYRTVFRPR
FT                   YKIGYKTVTDLAWRCCPGLTGESCPEHLTDHGATPPHQEPEPQIPLGQLGPGPRPSPYS
FT                   REAPRPRGRKGQGPFGERLEQRLSQAYGTLSGLVASHENPNRITGDSRAPVVPIGFGVI
FT                   PEGLVAPEDRGRGPLIPPLSEILSKVTEVSNTLQTKVQLLDEVRGLALGHEAHLQRLRE
FT                   APPSPLTSLALLEEYVDQRLQRLWGSLLDGFEQKLQGVQSECDLRVQEVRQQCEEGQAA
FT                   SQRLHQSLDGRELALRRELSQLGTQLQGLTLTGGGTCCSQLALISARVDSLERNLQAVT
FT                   ETQGGPGTLAADELARLSAAMLQGGVDGLLEGLETINGTENGARGCCLRMEVGGWGVGG
FT                   FGSTLEQRVQSLEERLATLTGELSPESAIPDRSARPLVHSELAVLEQRLVSLETSCTPS
FT                   TTTAILDNLVAEVKAWQSRSEALLHQVARHTALLQQLNGTVAEVQGQLAEGTGSSLQGE
FT                   ITLLKVNLNSVSKSLTGLSDSVSQYSDAFSAANTSLDERERRVEAEVHTIQEQISSQGS
FT                   RLQAGHRQVLNLRGELEQLKAGMANVARGLSRCRDTAQELQHTVGHFDQRVAQVEGACE
FT                   RLGLLATHLNSLPTEQLRSREGLWGHIDKLNHTLAQHTQDIARLRDDLLDCRAQLAEVR
FT                   PGRAD"
FT   mRNA            complement(join(<9592866..9594490,9594922..9595145,
FT                   9596057..>9596164))
FT                   /gene="Emilin3"
FT                   /locus_tag="mCG_15352"
FT                   /product="elastin microfibril interfacer 3, transcript
FT                   variant mCT174667"
FT                   /note="gene_id=mCG15352.1 transcript_id=mCT174667.0 created
FT                   on 24-OCT-2002"
FT   CDS             complement(join(9592866..9594490,9594922..9595145,
FT                   9596057..>9596163))
FT                   /codon_start=1
FT                   /gene="Emilin3"
FT                   /locus_tag="mCG_15352"
FT                   /product="elastin microfibril interfacer 3, isoform CRA_b"
FT                   /note="gene_id=mCG15352.1 transcript_id=mCT174667.0
FT                   protein_id=mCP97586.0 isoform=CRA_b"
FT                   /protein_id="EDL06300.1"
FT                   /translation="VVHRNVTCVLQEGAESYIKAEYRNCGWGPNCPSTVRYRTVFRPRY
FT                   KIGYKTVTDLAWRCCPGLTGESCPEHLTDHGATPPHQEPEPQIPLGQLGPGPRPSPYSR
FT                   EAPRPRGFGVIPEGLVAPEDRGRGPLIPPLSEILSKVTEVSNTLQTKVQLLDEVRGLAL
FT                   GHEAHLQRLREAPPSPLTSLALLEEYVDQRLQRLWGSLLDGFEQKLQGVQSECDLRVQE
FT                   VRQQCEEGQAASQRLHQSLDGRELALRRELSQLGTQLQGLTLTGGGTCCSQLALISARV
FT                   DSLERNLQAVTETQGGPGTLAADELARLSAAMLQGGVDGLLEGLETINGTENGARGCCL
FT                   RMEVGGWGVGGFGSTLEQRVQSLEERLATLTGELSPESAIPDRSARPLVHSELAVLEQR
FT                   LVSLETSCTPSTTTAILDNLVAEVKAWQSRSEALLHQVARHTALLQQLNGTVAEVQGQL
FT                   AEGTGSSLQGEITLLKVNLNSVSKSLTGLSDSVSQYSDAFSAANTSLDERERRVEAEVH
FT                   TIQEQISSQGSRLQAGHRQVLNLRGELEQLKAGMANVARGLSRCRDTAQELQHTVGHFD
FT                   QRVAQVEGACERLGLLATHLNSLPTEQLRSREGLWGHIDKLNHTLAQHTQDIARLRDDL
FT                   LDCRAQLAEVRPGRAD"
FT   gene            complement(9610853..9611961)
FT                   /locus_tag="mCG_1028018"
FT                   /note="gene_id=mCG1028018.1"
FT   mRNA            complement(join(9610853..9611401,9611477..9611660,
FT                   9611896..9611961))
FT                   /locus_tag="mCG_1028018"
FT                   /product="mCG1028018"
FT                   /note="gene_id=mCG1028018.1 transcript_id=mCT145722.1
FT                   created on 24-OCT-2002"
FT   CDS             complement(9611103..9611327)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028018"
FT                   /product="mCG1028018"
FT                   /note="gene_id=mCG1028018.1 transcript_id=mCT145722.1
FT                   protein_id=mCP72668.1"
FT                   /protein_id="EDL06301.1"
FT                   /translation="MLMEERPHVLCRKEFLLPPQTSASPASRGLGNAFFLVRPGTELKA
FT                   GFFSPFPPHSHLCHNHKVYRSSPSRLPAT"
FT   gene            complement(9632330..9794699)
FT                   /gene="Chd6"
FT                   /locus_tag="mCG_15349"
FT                   /note="gene_id=mCG15349.2"
FT   mRNA            complement(join(9632330..9635532,9641429..9641548,
FT                   9642382..9642573,9645323..9645775,9646620..9646826,
FT                   9647209..9647360,9650515..9652086,9653134..9653342,
FT                   9654685..9654862,9655492..9655552,9662805..9662865,
FT                   9664718..9664847,9666924..9667027,9667973..9668062,
FT                   9668407..9668566,9669012..9669211,9669807..9670009,
FT                   9673606..9673716,9675594..9675773,9677464..9677628,
FT                   9693694..9693889,9698361..9698571,9699423..9699678,
FT                   9702515..9702658,9703365..9703541,9704791..9705034,
FT                   9706306..9706427,9711278..9711412,9711588..9711674,
FT                   9714517..9714634,9715242..9715300,9716086..9716148,
FT                   9724533..9724682,9727324..9727468,9737727..9738244,
FT                   9745259..9745314,9794612..9794699))
FT                   /gene="Chd6"
FT                   /locus_tag="mCG_15349"
FT                   /product="chromodomain helicase DNA binding protein 6"
FT                   /note="gene_id=mCG15349.2 transcript_id=mCT15837.2 created
FT                   on 24-OCT-2002"
FT   CDS             complement(join(9634645..9635532,9641429..9641548,
FT                   9642382..9642573,9645323..9645775,9646620..9646826,
FT                   9647209..9647360,9650515..9652086,9653134..9653342,
FT                   9654685..9654862,9655492..9655552,9662805..9662865,
FT                   9664718..9664847,9666924..9667027,9667973..9668062,
FT                   9668407..9668566,9669012..9669211,9669807..9670009,
FT                   9673606..9673716,9675594..9675773,9677464..9677628,
FT                   9693694..9693889,9698361..9698571,9699423..9699678,
FT                   9702515..9702658,9703365..9703541,9704791..9705034,
FT                   9706306..9706427,9711278..9711412,9711588..9711674,
FT                   9714517..9714634,9715242..9715300,9716086..9716148,
FT                   9724533..9724682,9727324..9727468,9737727..9738244,
FT                   9745259..9745285))
FT                   /codon_start=1
FT                   /gene="Chd6"
FT                   /locus_tag="mCG_15349"
FT                   /product="chromodomain helicase DNA binding protein 6"
FT                   /note="gene_id=mCG15349.2 transcript_id=mCT15837.2
FT                   protein_id=mCP5896.2"
FT                   /protein_id="EDL06302.1"
FT                   /translation="MKIQKKEKQLSKLRALNHSPMSDASVNFDYKSPSPFDCSPDQGEN
FT                   IEEAANHCLPHKNLYTTEEEADTLFSRKLTSHNGMEDSGGRGTGVKKKRKKKEPGEQEG
FT                   TKGSKDREPKPKRKREPKEPKEPRRAKEPKRAKEPKETKQKDGVKKPRKHREASGTKEG
FT                   KEKRSCTDYGSRTKSKKAREQGPTPVERKKKGKRKNETTVESLELDHSLPNPSLQSPEE
FT                   PSESADSQKRRSGRQVKRRKYNEDLDFKVVDDDGETIAVLGAGRTSALSASTLAWQAEE
FT                   PPEDDANIIEKILASKTVQEVHPGEPPFDLELFYVKYRNFSYLHCKWATMEELEKDPRI
FT                   AQKIKRFRNKQAQMKHIFTEPDEDLFNPDYIEIDRILEVAHTKDAETGEEVTHYLVKWC
FT                   SLPYEESTWELEEDVDPAKVKEFESLQILPEVKHVERPASDAWQKLETSREYRNSNRLR
FT                   EYQLEGMNWLLFNWYNRKNCILADEMGLGKTIQSIAFLSEIFVRGIHGPFLIIAPLSTI
FT                   TNWEREFRTWTEMNAIVYHGSQISRQMIQQYEMVYRDAQGNPLSGVFKFHVVITTFEMI
FT                   LADCPELKKIHWSCVIIDEAHRLKNRNCKLLEGLKLMALEHKVLLTGTPLQNSVEELFS
FT                   LLNFLEPSQFPSETAFLEEFGDLKTEEQVKKLQSILKPMMLRRLKDDVEKNLAPKQETI
FT                   IEVELTNIQKKYYRAILEKNFSFLTKGANQHNMPNLINTMMELRKCCNHPYLINGAEEK
FT                   ILEDFRKAHSSEASDFQLQAMIQAAGKLVLIDKLLPKLIAGGHKVLIFSQMVRCLDILE
FT                   DYLIQRRYTYERIDGRVRGNLRQAAIDRFCKPDSDRFVFLLCTRAGGLGINLTAADTCI
FT                   IFDSDWNPQNDLQAQARCHRIGQSKAVKVYRLITRNSYEREMFDKASLKLGLDKAILQD
FT                   INRKGSTNGVQQLSKMEVEDLLRKGAYGALMDEEDEGSKFCEEDIDQILQRRTHTITIQ
FT                   SEGKGSTFAKASFVASGNRTDISLDDPNFWQKWAKIAELDTEANNEKESLVIDRPRVRK
FT                   QTKHYNSFEEDELMEFSELDSDSDERPTRSRRLSDRARRYLRAECFRVEKNLLIFGWGR
FT                   WKDILTHGRFKWPLNEKDMEMICRALLVYCVKHYKGDEKIKSFIWELITPSKDGQVQTL
FT                   QNHSGLSAPVPRGRKGKKTKNQLLLPELKNADWLATCNPEVVLHDDGYKKHLKQHCNKV
FT                   LLRVRMLYYLKAEILGEAADKAFEGTPARELDVLLPDIDYVEIPVDWWDAEADKSLLIG
FT                   VFKHGYERYNAMRADPALCFLEKVGMPDEKSLSAEQGVTDGTSDIPERGNIDKEDSAED
FT                   KLDGLQKQTASPSDGSDGIFGEKKDDSQAVSSALTARLRRLVTIYQRCNRKELCRPEIL
FT                   GPGNQGYWVQEEVFRRTSEMDLINKEAQKRWTRREQADFYRTVSSFGVVYDQEKKAFDW
FT                   TQFRIISRLDKKSDESLEHYFYSFVAMCRNVCRLPAWKDDGPPDASIYVEPITEERAAK
FT                   TLYRIELLRKVREQVLMCPQLHERLQLCRPSLYLPVWWECGKHDRDLLIGTAKHGLNRT
FT                   DYYIMNDPQLSFLDAYRNYAQHKRTDTQAPGSLCCLYQSNSKLYESLTYTPVSRTSESL
FT                   ESEPENLMRMESRDDHLCLPEGGLPDITCENFVSKVQEVISLDHDENLLPESLENMIYG
FT                   KTGLSQEPHSFQEAPTTNTQSRKNTITISASRNESCQPPGIEAEITSASSLMSSLEAGV
FT                   AKMNIKNGKHLLVSISKEGEPCCSETGRRPETIGHREAKCLVSPTLDTGHESGFVDLCS
FT                   LSVYDPKRNFSSDQQLIDLLENKSLESKLILNQSDEEEEENEDETLAIVASATEKPEVL
FT                   DFPKPTVNIPRGKNLSFHQDEAKKGRLEVVSKTAGPQRVFPPPANQCHCKHIERWAHGL
FT                   GSEDSEVEKPKAYQPDLYRSKANNSTVEGETAVIPTEPFKLKHELLKEPWKESSEGGKS
FT                   FSMYAPEGSEPKPEDMDFENKDDYEKDGTCLSQDYPGKYSEEESKSSASGIAGDLGEEA
FT                   QEVRAPTIAQLLQEKTLYSFSEWPKDRVIINRLDNICHVVLKGKWPCSHQYEPSGALPT
FT                   PVLSSSAGSRSSLSEPEATEHGFSNGAALAAQIQKESFLAPVFTKDEQKHRRPYEFEVE
FT                   RDAKARSLEEYSATHGRPPIVLNGWHGESAIDLSCSSEGSPGATSPFPVSASTPKIGAI
FT                   SSLQGALGMDLSGILQAGLIHPVTGQIVNGSLRRDDAAMRRRRGRRKHIEGGMDLIFLK
FT                   EQTLQAGILEVHEDAGQTTLSTTHPEVPGATSSAPEPTAAASSQAEKAVPSKSLLDWLR
FT                   QQADYSLDVPGFGTSFSDKPKQRRPRCKEPGKLDISSLGGEERVPAVPKEPGLRGFLPE
FT                   SKFNHTLAEPVLRDAGPRRRGRRPRNELLKAPAIVADSPSGMGPLFMNGLIAGMDLVGL
FT                   QNVRNIPGIPLTGLVGFPAGFATMPTGEEVKNTLSMLPMMLPGMAAVPQMFGVGGLLNT
FT                   PMATTCTTTASASLASTKSGTSATEKSTEDKLSGHDVNTDALVDDKPGPSPFSDQSEPT
FT                   ITTSSPVAFNPFLIPGVSPGLIYPSMFLSPGMGMALPAMQQARHSEMVGLETQKRKKKK
FT                   TKGDSPTQEPASVCEKEPGSDQNCTESSATVSPEREHVAQAREEGLKDSNEDTN"
FT   assembly_gap    9794115..9794134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9808987..9809006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9810806..9810825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9811967..9814221
FT                   /estimated_length=2255
FT                   /gap_type="unknown"
FT   assembly_gap    9858921..9858940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9860749..9860768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9867903..9869247
FT                   /estimated_length=1345
FT                   /gap_type="unknown"
FT   gene            9873107..9911183
FT                   /locus_tag="mCG_1050955"
FT                   /note="gene_id=mCG1050955.0"
FT   mRNA            join(9873107..9873248,9875834..9875999,9909688..9911183)
FT                   /locus_tag="mCG_1050955"
FT                   /product="mCG1050955"
FT                   /note="gene_id=mCG1050955.0 transcript_id=mCT194744.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    9882858..9882877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9886450..9886469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             9910689..9910838
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050955"
FT                   /product="mCG1050955"
FT                   /note="gene_id=mCG1050955.0 transcript_id=mCT194744.0
FT                   protein_id=mCP115773.0"
FT                   /protein_id="EDL06303.1"
FT                   /translation="MEITLEGRILLLKRGVMASQDGRFSALQSNKPGQIGMSGSPWASS
FT                   LLHP"
FT   assembly_gap    9920687..9920706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9930569..9930752
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    9936018..9936037
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9938624..9938946
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    9941791..9941813
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            complement(9949735..9950776)
FT                   /pseudo
FT                   /locus_tag="mCG_15355"
FT                   /note="gene_id=mCG15355.2"
FT   mRNA            complement(9949735..9950776)
FT                   /pseudo
FT                   /locus_tag="mCG_15355"
FT                   /note="gene_id=mCG15355.2 transcript_id=mCT15840.2 created
FT                   on 24-OCT-2002"
FT   assembly_gap    9961538..9961592
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    9963787..9964035
FT                   /estimated_length=249
FT                   /gap_type="unknown"
FT   assembly_gap    9977111..9977273
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   gene            9982396..9983439
FT                   /pseudo
FT                   /locus_tag="mCG_1027896"
FT                   /note="gene_id=mCG1027896.1"
FT   mRNA            9982396..9983439
FT                   /pseudo
FT                   /locus_tag="mCG_1027896"
FT                   /note="gene_id=mCG1027896.1 transcript_id=mCT145600.1
FT                   created on 24-OCT-2002"
FT   assembly_gap    10015332..10015530
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   assembly_gap    10052794..10052980
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    10090722..10090741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10092493..10092512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10093624..10093643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10173803..10174429)
FT                   /pseudo
FT                   /locus_tag="mCG_141336"
FT                   /note="gene_id=mCG141336.0"
FT   mRNA            complement(10173803..10174429)
FT                   /pseudo
FT                   /locus_tag="mCG_141336"
FT                   /note="gene_id=mCG141336.0 transcript_id=mCT174664.0
FT                   created on 24-OCT-2002"
FT   assembly_gap    10176414..10176688
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   gene            complement(10218737..>11349311)
FT                   /gene="Ptprt"
FT                   /locus_tag="mCG_141338"
FT                   /note="gene_id=mCG141338.0"
FT   mRNA            complement(join(10218737..10220683,10221551..10221686,
FT                   10224595..10224758,10225583..10225708,10238398..10238529,
FT                   10242861..10243034,10244844..10244993,10246528..10246663,
FT                   10249934..10250088,10251286..10251402,10256792..10256889,
FT                   10258290..10258326,10277985..10278061,10289807..10289894,
FT                   10309518..10309708,10358212..10358360,10400067..10400202,
FT                   10434951..10434987,10467509..10467782,10509546..10509648,
FT                   10510919..10511120,10602776..10602885,10629265..10629561,
FT                   10837489..10837782,10930523..10930697,10946257..10946372,
FT                   10960494..10960575,10970551..10970822,11055253..11055378,
FT                   11349222..>11349311))
FT                   /gene="Ptprt"
FT                   /locus_tag="mCG_141338"
FT                   /product="protein tyrosine phosphatase, receptor type, T"
FT                   /note="gene_id=mCG141338.0 transcript_id=mCT174666.0
FT                   created on 25-OCT-2002"
FT   CDS             complement(join(10220630..10220683,10221551..10221686,
FT                   10224595..10224758,10225583..10225708,10238398..10238529,
FT                   10242861..10243034,10244844..10244993,10246528..10246663,
FT                   10249934..10250088,10251286..10251402,10256792..10256889,
FT                   10258290..10258326,10277985..10278061,10289807..10289894,
FT                   10309518..10309708,10358212..10358360,10400067..10400202,
FT                   10434951..10434987,10467509..10467782,10509546..10509648,
FT                   10510919..10511120,10602776..10602885,10629265..10629561,
FT                   10837489..10837782,10930523..10930697,10946257..10946372,
FT                   10960494..10960575,10970551..10970822,11055253..11055378,
FT                   11349222..>11349309))
FT                   /codon_start=1
FT                   /gene="Ptprt"
FT                   /locus_tag="mCG_141338"
FT                   /product="protein tyrosine phosphatase, receptor type, T"
FT                   /note="gene_id=mCG141338.0 transcript_id=mCT174666.0
FT                   protein_id=mCP97585.0"
FT                   /protein_id="EDL06304.1"
FT                   /translation="GALALCLLRLLLLGLQRPPLPGAGAQSAAGGCSFDEHYSNCGYSV
FT                   ALGTNGFTWEQINTWEKPMLDPAVPTGSFMMVNSSGRASGQKAHLLLPTLKENDTHCID
FT                   FHYYFSSRDRSSPGALNVYVKVNGGPQGNPVWNVSGVVTEGWVKAELAISTFWPHFYQV
FT                   IFESVSLKGHPGYIAVDEVRVLAHPCRKAPHFLRLQNVEVNVGQNATFQCIAGGKWSQH
FT                   DKLWLQQWNGRDTALMVTRVVNHRRFSATVSVADTSQRSISKYRCVIRSDGGSGVSNYA
FT                   ELIVKEPPTPIAPPELLAVGATYLWIKPNANSIIGDGPIILKEVEYRTTTGTWAETHIV
FT                   DSPNYKLWHLDPDVEYEIRVLLTRPGEGGTGPPGPPLTTRTKCADPVHGPQNVEIVDIR
FT                   ARQLTLQWEPFGYAVTRCHSYNLTVQYQYVFNQQQYEAEEVIQTSSHYTLRGLRPFMTI
FT                   RLRLLLSNPEGRMESEELVVQTEEDVPGAVPLESIQGGPFEEKIYIQWKPPNETNGVIT
FT                   LYEINYKAVGSLDPSADLSSQRGKVFKLRNETHHLFVGLYPGTTYSFTIKASTAKGFGP
FT                   PVTTRIATKISAPSMPEYDADTPLNETDTTITVMLKPAQSRGAPVSVYQLVVKEERLQK
FT                   SRRAADIIECFSVPVSYRNASNLDSLHYFAAELKPSNLPVTQPFTVGDNKTYNGYWNPP
FT                   LSPLKSYSIYFQALSKANGETKINCVRLATKGASTQNSNTVEPEKQVDNTVKMAGVIAG
FT                   LLMFIIILLGVMLTIKRRKLAKKQKETQSGAQREMGPVASTDKPTAKLGTNRNDEGFSS
FT                   SSQDVNGFTDGSRGELSQPTLTIQTHPYRTCDPVEMSYPRDQFQPAIRVADLLQHITQM
FT                   KRGQGYGFKEEYEALPEGQTASWDTAKEDENRNKNRYGNIISYDHSRVRLLVLDGDPHS
FT                   DYINANYIDGYHRPRHYIATQGPMQETVKDFWRMIWQENSASIVMVTNLVEVGRVKCVR
FT                   YWPDDTEVYGDIKVTLIETEPLAEYVIRTFTVQKKGYHEIRELRLFHFTSWPDHGVPCY
FT                   ATGLLGFVRQVKFLNPPEAGPIVVHCSAGAGRTGCFIAIDTMLDMAENEGVVDIFNCVR
FT                   ELRAQRVNLVQTEEQYVFVHDAILEACLCGNTAIPVCEFRSLYYNISRLDPQTNSSQIK
FT                   DEFQTLNIVTPRVRPEDCSIGLLPRNHDKNRSMDVLPLDRCLPFLISVDGESSNYINAA
FT                   LMDSHKQPAAFVVTQHPLPNTVADFWRLVFDYNCSSVVMLNEMDTAQLCMQYWPEKTSG
FT                   CYGPIQVEFVSADIDEDIIHRIFRICNMARPQDGYRIVQHLQYIGWPAYRDTPPSKRSL
FT                   LKVVRRLEKWQEQYDGREGRTVVHCLNGGGRSGTFCAICSVCEMIQQQNIIDVFHIVKT
FT                   LRNNKSNMVETLEQYKFVYEVALEYLSSF"
FT   assembly_gap    10253640..10253659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10264275..10273804
FT                   /estimated_length=9530
FT                   /gap_type="unknown"
FT   assembly_gap    10318173..10318352
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    10323285..10323520
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    10334974..10335060
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    10350970..10357711
FT                   /estimated_length=6742
FT                   /gap_type="unknown"
FT   assembly_gap    10374015..10374034
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10419662..10419681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10451277..10455899
FT                   /estimated_length=4623
FT                   /gap_type="unknown"
FT   assembly_gap    10485548..10486043
FT                   /estimated_length=496
FT                   /gap_type="unknown"
FT   assembly_gap    10498692..10498771
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    10547036..10551427
FT                   /estimated_length=4392
FT                   /gap_type="unknown"
FT   assembly_gap    10552950..10552969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10554207..10554226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10592440..10592556
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    10621721..10621740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10634790..10635182
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    10668555..10668574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10671455..10671474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10673972..10673991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10688292..10691632
FT                   /estimated_length=3341
FT                   /gap_type="unknown"
FT   assembly_gap    10751660..10751679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10799215..10799234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10807205..10807224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10816503..10816522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10849889..10849908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10852777..10852796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10918891..10920213
FT                   /estimated_length=1323
FT                   /gap_type="unknown"
FT   assembly_gap    10921391..10921410
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11079921..11083052
FT                   /locus_tag="mCG_141337"
FT                   /note="gene_id=mCG141337.0"
FT   mRNA            join(<11079921..11079948,11080409..11080509,
FT                   11082550..11083052)
FT                   /locus_tag="mCG_141337"
FT                   /product="mCG141337"
FT                   /note="gene_id=mCG141337.0 transcript_id=mCT174665.0
FT                   created on 26-OCT-2002"
FT   CDS             join(<11080497..11080509,11082550..11082944)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141337"
FT                   /product="mCG141337"
FT                   /note="gene_id=mCG141337.0 transcript_id=mCT174665.0
FT                   protein_id=mCP97584.0"
FT                   /protein_id="EDL06305.1"
FT                   /translation="TGAEDPSQDWLTTKEHCQSLYLSGYFSFHSLWGGYFCIHVTQTPG
FT                   RDSKRWKRSPLAHSFRHLIMDSSWQRSHGEVPDDKSMWQRLPDITLNKEAGTVNRMGAL
FT                   CLVLRRLAPHNDLPLLASPQHPKVPKSLKIA"
FT   assembly_gap    11120850..11120869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11162727..11162746
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11168710..11168729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11170315..11170334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11176506..11176628
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    11193738..11193757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11206176..11206195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11276102..11276121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11283344..11290590
FT                   /estimated_length=7247
FT                   /gap_type="unknown"
FT   assembly_gap    11307728..11307850
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    11316365..11316673
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    11349312..11349539
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   gene            <11349540..11355323
FT                   /locus_tag="mCG_1028026"
FT                   /note="gene_id=mCG1028026.0"
FT   mRNA            join(<11349540..11349668,11354023..11354238,
FT                   11354603..11355323)
FT                   /locus_tag="mCG_1028026"
FT                   /product="mCG1028026"
FT                   /note="gene_id=mCG1028026.0 transcript_id=mCT145730.0
FT                   created on 26-OCT-2002"
FT   assembly_gap    11352056..11352125
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   CDS             <11354904..11355110
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028026"
FT                   /product="mCG1028026"
FT                   /note="gene_id=mCG1028026.0 transcript_id=mCT145730.0
FT                   protein_id=mCP72733.1"
FT                   /protein_id="EDL06306.1"
FT                   /translation="ETIQHTGGRVVFMPGSCFQPSGFPDRIGVGGGERSTVHTAACLLI
FT                   DYWLIGFFQDSLWEALDILELTL"
FT   gene            <11367408..11368720
FT                   /locus_tag="mCG_1028027"
FT                   /note="gene_id=mCG1028027.1"
FT   mRNA            join(<11367408..11368206,11368603..11368720)
FT                   /locus_tag="mCG_1028027"
FT                   /product="mCG1028027"
FT                   /note="gene_id=mCG1028027.1 transcript_id=mCT145731.1
FT                   created on 15-NOV-2002"
FT   CDS             join(<11367981..11368206,11368603..11368613)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1028027"
FT                   /product="mCG1028027"
FT                   /note="gene_id=mCG1028027.1 transcript_id=mCT145731.1
FT                   protein_id=mCP72745.1"
FT                   /protein_id="EDL06307.1"
FT                   /translation="GRKIFIDSLSLDQKRNGTRERLANLWKMKWLERDKPWHQTQAQSL
FT                   CGKPTTPGRTTQSQSALAALPWLLETDDRASLF"
FT   assembly_gap    11388811..11388830
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11389902..11389921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11398954..11398973
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11404676..11404695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11405754..11405773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11411232..11411323
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    11415959..11416077
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    11419877..11419896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11421384..11421403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11422418..11422437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11423059..11423078
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11426352..11426371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11428143..11428162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11442136..11442930
FT                   /estimated_length=795
FT                   /gap_type="unknown"
FT   assembly_gap    11455557..11455669
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            11500476..11500871
FT                   /pseudo
FT                   /locus_tag="mCG_50668"
FT                   /note="gene_id=mCG50668.2"
FT   mRNA            11500476..11500871
FT                   /pseudo
FT                   /locus_tag="mCG_50668"
FT                   /note="gene_id=mCG50668.2 transcript_id=mCT50851.2 created
FT                   on 15-NOV-2002"
FT   assembly_gap    11513168..11513187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11517220..11517239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11535853..11535872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11542902..11542921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11565798..11565997
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    11584802..11584856
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    11585460..11585595
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   gene            complement(11600507..11601433)
FT                   /pseudo
FT                   /locus_tag="mCG_1676"
FT                   /note="gene_id=mCG1676.1"
FT   mRNA            complement(11600507..11601433)
FT                   /pseudo
FT                   /locus_tag="mCG_1676"
FT                   /note="gene_id=mCG1676.1 transcript_id=mCT1021.1 created on
FT                   15-NOV-2002"
FT   gene            11633242..11638836
FT                   /gene="Sfrs6"
FT                   /locus_tag="mCG_1675"
FT                   /note="gene_id=mCG1675.2"
FT   mRNA            join(11633242..11633493,11633710..11633858,
FT                   11635140..11635264,11635368..11635576,11635943..11636026,
FT                   11636127..11638836)
FT                   /gene="Sfrs6"
FT                   /locus_tag="mCG_1675"
FT                   /product="splicing factor, arginine/serine-rich 6"
FT                   /note="gene_id=mCG1675.2 transcript_id=mCT1020.2 created on
FT                   15-NOV-2002"
FT   CDS             join(11633387..11633493,11633710..11633858,
FT                   11635140..11635264,11635368..11635576,11635943..11636026,
FT                   11636127..11636472)
FT                   /codon_start=1
FT                   /gene="Sfrs6"
FT                   /locus_tag="mCG_1675"
FT                   /product="splicing factor, arginine/serine-rich 6"
FT                   /note="gene_id=mCG1675.2 transcript_id=mCT1020.2
FT                   protein_id=mCP5876.2"
FT                   /db_xref="GOA:Q3TWW8"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="MGI:MGI:1915246"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3TWW8"
FT                   /protein_id="EDL06308.1"
FT                   /translation="MPRVYIGRLSYNVREKDIQRFFSGYGRLLEIDLKNGYGFVEFEDS
FT                   RDADDAVYELNSKELCGERVIVEHARGPRRDRDGYSYGSRSGGGGYSSRRTSGRDKYGP
FT                   PVRTEYRLIVENLSSRCSWQDLKDFMRQAGEVTYADAHKERTNEGVIEFRSYSDMKRAL
FT                   DKLDGTEINGRNIRLIEDKPRTSHRRSYSGSRSRSRSRRRSRSRSRRSSRSRSRSISKS
FT                   RSRSRSRSKGRSRSRSKGRKSRSKSKSKPKSDRGSHSHSRSRSKDKYGKSRSRSRSRSP
FT                   KENGKGDIKSKSRSRSQSRSHSPLPAPPSKARSMSPPPKRASRSRSRSRSRSRSSSRD"
FT   gene            <11645124..>11676208
FT                   /locus_tag="mCG_1668"
FT                   /note="gene_id=mCG1668.3"
FT   mRNA            join(<11645124..11645194,11646088..11646253,
FT                   11648838..11648983,11649339..11649553,11649817..11649931,
FT                   11650140..11650287,11650429..11650546,11651118..11651199,
FT                   11661019..11661107,11661523..11661688,11662450..11662585,
FT                   11662906..11662997,11665935..11666086,11666510..11666586,
FT                   11667277..11667362,11667506..11667616,11668054..11668593,
FT                   11668760..11668957,11669065..11669114,11671670..11671827,
FT                   11672786..11673643)
FT                   /locus_tag="mCG_1668"
FT                   /product="mCG1668, transcript variant mCT189870"
FT                   /note="gene_id=mCG1668.3 transcript_id=mCT189870.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(11645128..11645194,11646088..11646253,
FT                   11648838..11648983,11649339..11649553,11649817..11649931,
FT                   11650140..11650287,11650429..11650546,11651118..11651199,
FT                   11661019..11661107,11661584..11661688,11662450..11662585,
FT                   11662906..11662997,11665935..11666086,11666510..11666586,
FT                   11667277..11667362,11667506..11667616,11668054..11668168,
FT                   11668494..11668593,11668760..11668957,11669065..11669114,
FT                   11671670..11671827,11672786..11672848,11676074..>11676208)
FT                   /locus_tag="mCG_1668"
FT                   /product="mCG1668, transcript variant mCT1030"
FT                   /note="gene_id=mCG1668.3 transcript_id=mCT1030.2 created on
FT                   15-NOV-2002"
FT   assembly_gap    11645978..11645997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<11646252..11646253,11648838..11648983,
FT                   11649339..11649553,11649817..11649931,11650140..11650287,
FT                   11650429..11650546,11651118..11651199,11661019..11661107,
FT                   11661523..11661540)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1668"
FT                   /product="mCG1668, isoform CRA_b"
FT                   /note="gene_id=mCG1668.3 transcript_id=mCT189870.0
FT                   protein_id=mCP110872.0 isoform=CRA_b"
FT                   /protein_id="EDL06310.1"
FT                   /translation="RHIWMEGHTDMEILRTVKGSSTGEVNVHLVARDSAGPHPQLPTTA
FT                   FIIPTNAATLGLPSTALDVPYPREPVHVGALERVAGSEPVTATILPQLSTGTGTNSTVR
FT                   LLDWTGVSAPLPGSGMRFRINEYAPLNMIGVERPRSPEQRHEGGMARRDAGIQHPDVHQ
FT                   DRQDITSLEPPVDASSCKCQACGPQQSSGLDVGSSGDRCSQPFQKRSVIVENSGCTIAS
FT                   ELLKPMKKRKHKEYQSPSEESEPEAVKQGEGKDAEREPTPSTPENEEWSRSQLVSSEKK
FT                   DGWSWESYLEEQKAVTAPVSLFQDPTRQG"
FT   CDS             join(11648848..11648983,11649339..11649553,
FT                   11649817..11649931,11650140..11650287,11650429..11650546,
FT                   11651118..11651199,11661019..11661107,11661584..11661688,
FT                   11662450..11662585,11662906..11662997,11665935..11666086,
FT                   11666510..11666586,11667277..11667362,11667506..11667616,
FT                   11668054..11668168,11668494..11668593,11668760..11668957,
FT                   11669065..11669114,11671670..11671827,11672786..11672848,
FT                   11676074..11676208)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1668"
FT                   /product="mCG1668, isoform CRA_a"
FT                   /note="gene_id=mCG1668.3 transcript_id=mCT1030.2
FT                   protein_id=mCP5991.2 isoform=CRA_a"
FT                   /db_xref="GOA:A2A5N8"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002515"
FT                   /db_xref="InterPro:IPR004092"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="MGI:MGI:2676663"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2A5N8"
FT                   /protein_id="EDL06309.1"
FT                   /translation="MEGHTDMEILRTVKGSSTGEVNVHLVARDSAGPHPQLPTTAFIIP
FT                   TNAATLGLPSTALDVPYPREPVHVGALERVAGSEPVTATILPQLSTGTGTNSTVRLLDW
FT                   TGVSAPLPGSGMRFRINEYAPLNMIGVERPRSPEQRHEGGMARRDAGIQHPDVHQDRQD
FT                   ITSLEPPVDASSCKCQACGPQQSSGLDVGSSGDRCSQPFQKRSVIVENSGCTIASELLK
FT                   PMKKRKHKEYQSPSEESEPEAVKQGEGKDAEREPTPSTPENEEWSRSQLVSSEKKDGWS
FT                   WESYLEEQKAVTAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGY
FT                   RLRLHFDGYSECHDFWVNANSPDIHPAGWFEKTGHKLQLPKGYKEEEFSWSQYLRSTKA
FT                   QAAPKHLFVSQSHSTPPVGFQVGMKLEAVDRMNPSLVCVASVTDVVDSRFLVHFDDWGD
FT                   TYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPDSFCWEKYLEETGTSAVPNWAFKV
FT                   RPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKLHFDGWSHNYDFWIDADHPDIH
FT                   PAGWCSKTGHPLEPPLRPRESSSVSPGGCPPLSHRSPPHTKTSKYNFHHRKCPTPGCDG
FT                   SGHVTGKFTAHHCLSGCPLAEKNQSRLKAELSDSETAARKKNPSNLSPRKKPRHQGRIG
FT                   RPPKYRKIPEEDLQALPPSVVHQSLFMSTLPTHADRPLSVCWEQHCKLLPGVAGISAST
FT                   VSKWTIEEVFGFVQTLTGSEDQARLFKDEMIDGEAFLLLTQADIVKIMSVKLGPALKIY
FT                   NAILMFKNTDDAFK"
FT   assembly_gap    11653738..11653985
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    11663026..11663156
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    11672359..11672378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11675955..11676007
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(11683942..11685023)
FT                   /pseudo
FT                   /locus_tag="mCG_1670"
FT                   /note="gene_id=mCG1670.2"
FT   mRNA            complement(11683942..11685023)
FT                   /pseudo
FT                   /locus_tag="mCG_1670"
FT                   /note="gene_id=mCG1670.2 transcript_id=mCT1026.2 created on
FT                   15-NOV-2002"
FT   gene            11689007..11715789
FT                   /gene="Sgk2"
FT                   /locus_tag="mCG_1674"
FT                   /note="gene_id=mCG1674.2"
FT   mRNA            join(11689007..11689272,11693058..11693303,
FT                   11694584..11694643,11695533..11695582,11696108..11696165,
FT                   11696313..11696396,11697330..11697461,11699479..11699591,
FT                   11699875..11699911,11700827..11700913,11704928..11705023,
FT                   11705803..11705958,11708450..11708539,11714576..11715789)
FT                   /gene="Sgk2"
FT                   /locus_tag="mCG_1674"
FT                   /product="serum/glucocorticoid regulated kinase 2,
FT                   transcript variant mCT1024"
FT                   /note="gene_id=mCG1674.2 transcript_id=mCT1024.2 created on
FT                   15-NOV-2002"
FT   mRNA            join(<11689176..11689873,11693058..11693303,
FT                   11694584..11694643,11695533..11695582,11696108..11696165,
FT                   11696313..11696396,11697330..11697461,11699479..11699591,
FT                   11699875..11699911,11704928..11705023,11705803..11705958,
FT                   11708450..11708539,11714576..11715788)
FT                   /gene="Sgk2"
FT                   /locus_tag="mCG_1674"
FT                   /product="serum/glucocorticoid regulated kinase 2,
FT                   transcript variant mCT189898"
FT                   /note="gene_id=mCG1674.2 transcript_id=mCT189898.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<11694584..11694643,11695533..11695582,
FT                   11696108..11696165,11696313..11696396,11697330..11697461,
FT                   11699479..11699591,11699875..11699911,11704928..11705023,
FT                   11705803..11705958,11708450..11708539,11714576..11714740)
FT                   /codon_start=1
FT                   /gene="Sgk2"
FT                   /locus_tag="mCG_1674"
FT                   /product="serum/glucocorticoid regulated kinase 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1674.2 transcript_id=mCT189898.0
FT                   protein_id=mCP110873.0 isoform=CRA_b"
FT                   /protein_id="EDL06312.1"
FT                   /translation="SLPDHSSRMASSPVGVPSPQPSRANGNINLGPSANPNARPTDFDF
FT                   LKVIGKGNYGKVLLAKRKSDGAFYAVKVLQKKSILKNKEQNHIMAERNVLLKNVRHPFL
FT                   VGLRYSFQTPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYTAEVASAIGYLHSLNI
FT                   IYRDLKPENILLDCQYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFFNTDVAQMY
FT                   ENILHQPLQIPGGRTVAACDLLQGLLHKDQRQRLGSKEDFLDIKNHMFFSPINWDDLYH
FT                   KRLTPPFNPNVEGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAQDD
FT                   DDILDS"
FT   mRNA            join(11694593..11694643,11695533..11695582,
FT                   11696108..11696165,11696313..11696396,11697333..11697461,
FT                   11699479..11699591,11699875..11699911,11700827..11700913,
FT                   11704928..11705023,11705803..11705958,11708450..11708539,
FT                   11714576..11715788)
FT                   /gene="Sgk2"
FT                   /locus_tag="mCG_1674"
FT                   /product="serum/glucocorticoid regulated kinase 2,
FT                   transcript variant mCT175626"
FT                   /note="gene_id=mCG1674.2 transcript_id=mCT175626.0 created
FT                   on 15-NOV-2002"
FT   CDS             join(11694608..11694643,11695533..11695582,
FT                   11696108..11696165,11696313..11696396,11697330..11697461,
FT                   11699479..11699591,11699875..11699911,11700827..11700913,
FT                   11704928..11705023,11705803..11705958,11708450..11708539,
FT                   11714576..11714740)
FT                   /codon_start=1
FT                   /gene="Sgk2"
FT                   /locus_tag="mCG_1674"
FT                   /product="serum/glucocorticoid regulated kinase 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1674.2 transcript_id=mCT1024.2
FT                   protein_id=mCP5858.2 isoform=CRA_a"
FT                   /protein_id="EDL06311.1"
FT                   /translation="MASSPVGVPSPQPSRANGNINLGPSANPNARPTDFDFLKVIGKGN
FT                   YGKVLLAKRKSDGAFYAVKVLQKKSILKNKEQNHIMAERNVLLKNVRHPFLVGLRYSFQ
FT                   TPEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYTAEVASAIGYLHSLNIIYRDLKPE
FT                   NILLDCQGHVVLTDFGLCKECVEPEETTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGA
FT                   VLYEMLHGLPPFFNTDVAQMYENILHQPLQIPGGRTVAACDLLQGLLHKDQRQRLGSKE
FT                   DFLDIKNHMFFSPINWDDLYHKRLTPPFNPNVEGPADLKHFDPEFTQEAVSKSIGCTPD
FT                   TVASSSGASSAFLGFSYAQDDDDILDS"
FT   CDS             join(11694608..11694643,11695533..11695582,
FT                   11696108..11696165,11696313..11696396,11697333..11697461,
FT                   11699479..11699591,11699875..11699911,11700827..11700913,
FT                   11704928..11705023,11705803..11705958,11708450..11708539,
FT                   11714576..11714740)
FT                   /codon_start=1
FT                   /gene="Sgk2"
FT                   /locus_tag="mCG_1674"
FT                   /product="serum/glucocorticoid regulated kinase 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1674.2 transcript_id=mCT175626.0
FT                   protein_id=mCP98548.0 isoform=CRA_c"
FT                   /protein_id="EDL06313.1"
FT                   /translation="MASSPVGVPSPQPSRANGNINLGPSANPNARPTDFDFLKVIGKGN
FT                   YGKVLLAKRKSDGAFYAVKVLQKKSILKNKENHIMAERNVLLKNVRHPFLVGLRYSFQT
FT                   PEKLYFVLDYVNGGELFFHLQRERRFLEPRARFYTAEVASAIGYLHSLNIIYRDLKPEN
FT                   ILLDCQGHVVLTDFGLCKECVEPEETTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAV
FT                   LYEMLHGLPPFFNTDVAQMYENILHQPLQIPGGRTVAACDLLQGLLHKDQRQRLGSKED
FT                   FLDIKNHMFFSPINWDDLYHKRLTPPFNPNVEGPADLKHFDPEFTQEAVSKSIGCTPDT
FT                   VASSSGASSAFLGFSYAQDDDDILDS"
FT   assembly_gap    11702535..11702738
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    11711387..11711406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11719016..11747896
FT                   /gene="Ift52"
FT                   /locus_tag="mCG_113410"
FT                   /note="gene_id=mCG113410.0"
FT   mRNA            join(11719016..11719319,11724038..11724162,
FT                   11725013..11725100,11727017..11727146,11727574..11727649,
FT                   11729717..11729788,11731421..11731547,11732867..11732956,
FT                   11734919..11734987,11738243..11738397,11741977..11742064,
FT                   11744043..11744151,11746555..11747896)
FT                   /gene="Ift52"
FT                   /locus_tag="mCG_113410"
FT                   /product="intraflagellar transport 52 homolog
FT                   (Chlamydomonas), transcript variant mCT114494"
FT                   /note="gene_id=mCG113410.0 transcript_id=mCT114494.1
FT                   created on 15-NOV-2002"
FT   mRNA            join(<11719017..11719196,11724038..11724162,
FT                   11725013..11725100,11727017..11727146,11727574..11727649,
FT                   11729717..11729788,11731421..11731547,11732867..11732956,
FT                   11734919..11734987,11738243..11738397,11741977..11742064,
FT                   11744043..11744151,11746555..11746886)
FT                   /gene="Ift52"
FT                   /locus_tag="mCG_113410"
FT                   /product="intraflagellar transport 52 homolog
FT                   (Chlamydomonas), transcript variant mCT175625"
FT                   /note="gene_id=mCG113410.0 transcript_id=mCT175625.0
FT                   created on 15-NOV-2002"
FT   CDS             join(<11719017..11719196,11724038..11724162,
FT                   11725013..11725100,11727017..11727146,11727574..11727649,
FT                   11729717..11729788,11731421..11731547,11732867..11732956,
FT                   11734919..11734987,11738243..11738397,11741977..11742064,
FT                   11744043..11744151,11746555..11746712)
FT                   /codon_start=1
FT                   /gene="Ift52"
FT                   /locus_tag="mCG_113410"
FT                   /product="intraflagellar transport 52 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG113410.0 transcript_id=mCT175625.0
FT                   protein_id=mCP98547.0 isoform=CRA_a"
FT                   /protein_id="EDL06314.1"
FT                   /translation="ETGQPSASPEPLPNSPQRPQPPDTARLSRCRHHATTEVTRGPEPR
FT                   LLGARPWIPGGLWPQVTMEKELRSTILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLK
FT                   DEITSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINF
FT                   LLEEYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNN
FT                   AQALTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHM
FT                   FSDQYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYTMVPDTATLSEQLRVCL
FT                   QEGDENPRDFTTLFDLSIYQLDTTCLPKVIKAHEELNVKHEPLQLVQPQFEMPLPALQP
FT                   AVFPPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTDEDLEFYVRKCGDILGVTSK
FT                   LPKDQQDAKHILEHIFFQVVEFKKLNQEAH"
FT   CDS             join(11724044..11724162,11725013..11725100,
FT                   11727017..11727146,11727574..11727649,11729717..11729788,
FT                   11731421..11731547,11732867..11732956,11734919..11734987,
FT                   11738243..11738397,11741977..11742064,11744043..11744151,
FT                   11746555..11746712)
FT                   /codon_start=1
FT                   /gene="Ift52"
FT                   /locus_tag="mCG_113410"
FT                   /product="intraflagellar transport 52 homolog
FT                   (Chlamydomonas), isoform CRA_b"
FT                   /note="gene_id=mCG113410.0 transcript_id=mCT114494.1
FT                   protein_id=mCP72850.1 isoform=CRA_b"
FT                   /protein_id="EDL06315.1"
FT                   /translation="MEKELRSTILFNAYKKEVFTTNTGYKSLQKRLRSNWKIQSLKDEI
FT                   TSEKLIGVKLWITAGPREKFTAAEFEVLKKYLDSGGDILVMLGEGGESRFDTNINFLLE
FT                   EYGIMVNNDAVVRNVYYKYFHPKEALVSDGVLNREISRAAGKAVPGVIDEENSGNNAQA
FT                   LTFVYPFGATLSVMKPAVAVLSTGSVCFPLNRPILAFYHSKNQGFGKLAVLGSCHMFSD
FT                   QYLDKEENSKIMDVVFQWLTTGDIHLNQIDAEDPEISDYTMVPDTATLSEQLRVCLQEG
FT                   DENPRDFTTLFDLSIYQLDTTCLPKVIKAHEELNVKHEPLQLVQPQFEMPLPALQPAVF
FT                   PPSFRELPPPPLELFDLDETFSSEKARLAQITNKCTDEDLEFYVRKCGDILGVTSKLPK
FT                   DQQDAKHILEHIFFQVVEFKKLNQEAH"
FT   gene            11755968..11785990
FT                   /gene="Mybl2"
FT                   /locus_tag="mCG_1673"
FT                   /note="gene_id=mCG1673.3"
FT   mRNA            join(11755968..11756200,11760851..11760944,
FT                   11762875..11762946,11763795..11763887,11765617..11765837,
FT                   11769493..11769652,11773961..11774251,11775719..11776141,
FT                   11776973..11777112,11779123..11779225,11780930..11781043,
FT                   11782054..11782158,11783853..11784002,11784469..11785990)
FT                   /gene="Mybl2"
FT                   /locus_tag="mCG_1673"
FT                   /product="myeloblastosis oncogene-like 2"
FT                   /note="gene_id=mCG1673.3 transcript_id=mCT1029.3 created on
FT                   29-NOV-2004"
FT   CDS             join(11756181..11756200,11760851..11760944,
FT                   11762875..11762946,11763795..11763887,11765617..11765837,
FT                   11769493..11769652,11773961..11774251,11775719..11776141,
FT                   11776973..11777112,11779123..11779225,11780930..11781043,
FT                   11782054..11782158,11783853..11784002,11784469..11784597)
FT                   /codon_start=1
FT                   /gene="Mybl2"
FT                   /locus_tag="mCG_1673"
FT                   /product="myeloblastosis oncogene-like 2"
FT                   /note="gene_id=mCG1673.3 transcript_id=mCT1029.3
FT                   protein_id=mCP5978.3"
FT                   /protein_id="EDL06316.1"
FT                   /translation="MSRRTRCEDLDELHYQDVDSDLLEQRDNRCKVKWTHEEDEQLRAL
FT                   VRQFGQQDWKFLASHFPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTK
FT                   QWTLIAKHLKGRLGKQCRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKM
FT                   LPGRTDNAVKNHWNSTIKRKVDTGGFPAESRDCKPVYLLLELEDKEQHQGVQPVDGQGS
FT                   LVSSWPLVPSIVKEESSEEEIAIAATSAKELGHEPVPADLGEVRTPEPPESLKREYQEF
FT                   SSPETSLPYKWVVEAANLLIPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSTEGSV
FT                   VSSPVQPQTSQQQQEEALQSSQQAATPGPSVTEYRLDGHTISDLSRSSRGELIPISPST
FT                   EFGGSGIGTPPSVLKRQKKRRVALSPVTENSASLSFLDSCNSLTPKSTPVKTLPFSPSQ
FT                   FLNFWNKQDTLELESPSLTSTPVCSQKVVVTTPLHRDKTPLHQKYPSSEVLPDQKYSMD
FT                   NTPHTPTPFKNALEKYGPLKPLPQTPHLEEDLKEVLRSEAGMELIIEDDMRPEKQKRKP
FT                   GLRRSPIKKVRKSLALDIMDEDGKLMSSTMPKPLSLPTSVTPSSCGFTSPGSKEGNSLL
FT                   NQGFLQAKPEKVVAAQKTRSHIPTPAPMTHAWKTVACGGTKDQLFMQEKARQLLSRLKS
FT                   SHTSRTLILS"
FT   assembly_gap    11763388..11763407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11782997..11783016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11788334..11790905)
FT                   /locus_tag="mCG_1672"
FT                   /note="gene_id=mCG1672.1"
FT   mRNA            complement(join(11788334..11789150,11790842..11790905))
FT                   /locus_tag="mCG_1672"
FT                   /product="mCG1672"
FT                   /note="gene_id=mCG1672.1 transcript_id=mCT1028.0 created on
FT                   15-NOV-2002"
FT   CDS             complement(11788409..11788864)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1672"
FT                   /product="mCG1672"
FT                   /note="gene_id=mCG1672.1 transcript_id=mCT1028.0
FT                   protein_id=mCP5976.1"
FT                   /protein_id="EDL06317.1"
FT                   /translation="MEPESIEICPYNPHHRIPLSRFQYHLASCRKKNPKKAKKMASCKY
FT                   NACHVVPIRKLAEHEATCVNRSSVEEEDTLGPLQVSLPQPQNQDTLQVRWLSNPDIWNV
FT                   DGANCHPMFVLKSFVPQKLVCESDIQESRGGDQCPEDPQTRTRKANF"
FT   assembly_gap    11796395..11796664
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    11819496..11819515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11823894..11845237
FT                   /locus_tag="mCG_141554"
FT                   /note="gene_id=mCG141554.0"
FT   mRNA            join(<11823894..11824046,11844743..11845237)
FT                   /locus_tag="mCG_141554"
FT                   /product="mCG141554"
FT                   /note="gene_id=mCG141554.0 transcript_id=mCT175954.0
FT                   created on 22-NOV-2002"
FT   CDS             join(<11823935..11824046,11844743..11844927)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141554"
FT                   /product="mCG141554"
FT                   /note="gene_id=mCG141554.0 transcript_id=mCT175954.0
FT                   protein_id=mCP98876.0"
FT                   /protein_id="EDL06318.1"
FT                   /translation="DEILSSHSERCDSSSLRTQFDLEYTSNSSSFIICGGADVMKQDAV
FT                   GAVRSHNTVIFEDSTVWIFFPSSPYQDLPIMSNSSARVCLHYLPFTPTPNQRL"
FT   assembly_gap    11826215..11826234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11837522..11837735
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    11854445..11854464
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11904368..>11980100
FT                   /locus_tag="mCG_113411"
FT                   /note="gene_id=mCG113411.1"
FT   mRNA            join(<11904368..11904484,11949012..11949077,
FT                   11979850..>11980100)
FT                   /locus_tag="mCG_113411"
FT                   /product="mCG113411, transcript variant mCT114495"
FT                   /note="gene_id=mCG113411.1 transcript_id=mCT114495.1
FT                   created on 22-NOV-2002"
FT   CDS             join(<11904425..11904484,11949012..11949077,
FT                   11979850..>11980100)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113411"
FT                   /product="mCG113411, isoform CRA_a"
FT                   /note="gene_id=mCG113411.1 transcript_id=mCT114495.1
FT                   protein_id=mCP72866.1 isoform=CRA_a"
FT                   /protein_id="EDL06319.1"
FT                   /translation="VPPGAEPAGMAHLDYYHCGKFDGDSAYVGMSDGNPELLSTSQTYN
FT                   SQGESNEDYEIPPITPPNLPEPSLLHLGDHEAGYHSLCHGLAPNGLLPAYSYQAMDLPA
FT                   IMVSNMLAQDGHLLSGQLPTV"
FT   mRNA            join(<11905674..11906003,11949012..11949077,
FT                   11979850..>11979983)
FT                   /locus_tag="mCG_113411"
FT                   /product="mCG113411, transcript variant mCT175938"
FT                   /note="gene_id=mCG113411.1 transcript_id=mCT175938.0
FT                   created on 22-NOV-2002"
FT   CDS             join(<11905770..11906003,11949012..11949077,
FT                   11979850..>11979983)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113411"
FT                   /product="mCG113411, isoform CRA_b"
FT                   /note="gene_id=mCG113411.1 transcript_id=mCT175938.0
FT                   protein_id=mCP98860.0 isoform=CRA_b"
FT                   /protein_id="EDL06320.1"
FT                   /translation="PSGGLSLPYRLSAQPLAAGMLSGCCSSRASGRSLGLRGWASLQVH
FT                   PQALRERLRPGALCSSPWSGRRGPRRPGRPGAEFDGDSAYVGMSDGNPELLSTSQTYNS
FT                   QGESNEDYEIPPITPPNLPEPSLLHLGDHEAGYHSLCHGLA"
FT   mRNA            join(<11926683..11926816,11949012..11949077,
FT                   11979850..>11980100)
FT                   /locus_tag="mCG_113411"
FT                   /product="mCG113411, transcript variant mCT175939"
FT                   /note="gene_id=mCG113411.1 transcript_id=mCT175939.0
FT                   created on 22-NOV-2002"
FT   CDS             join(<11926685..11926816,11949012..11949077,
FT                   11979850..>11980100)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113411"
FT                   /product="mCG113411, isoform CRA_c"
FT                   /note="gene_id=mCG113411.1 transcript_id=mCT175939.0
FT                   protein_id=mCP98861.0 isoform=CRA_c"
FT                   /protein_id="EDL06321.1"
FT                   /translation="SVLIMQQHLTEAVAGAFSRCLGFRGMRLRLLTRHWCIAGASLQKF
FT                   DGDSAYVGMSDGNPELLSTSQTYNSQGESNEDYEIPPITPPNLPEPSLLHLGDHEAGYH
FT                   SLCHGLAPNGLLPAYSYQAMDLPAIMVSNMLAQDGHLLSGQLPTV"
FT   assembly_gap    11966931..11969031
FT                   /estimated_length=2101
FT                   /gap_type="unknown"
FT   assembly_gap    11996656..11996705
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            <12018712..>12027527
FT                   /locus_tag="mCG_117361"
FT                   /note="gene_id=mCG117361.1"
FT   mRNA            join(<12018712..12018962,12020196..12020423,
FT                   12023963..12024043,12024699..12025091,12025822..12025949,
FT                   12027145..12027178,12027345..>12027527)
FT                   /locus_tag="mCG_117361"
FT                   /product="mCG117361"
FT                   /note="gene_id=mCG117361.1 transcript_id=mCT118500.1
FT                   created on 22-NOV-2002"
FT   CDS             join(<12018714..12018962,12020196..12020423,
FT                   12023963..12024043,12024699..12025091,12025822..12025949,
FT                   12027145..12027178,12027345..12027527)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117361"
FT                   /product="mCG117361"
FT                   /note="gene_id=mCG117361.1 transcript_id=mCT118500.1
FT                   protein_id=mCP73155.1"
FT                   /protein_id="EDL06322.1"
FT                   /translation="LSQIQEMVHSEVAAYDSGRPGPLLGRPAMLASHMSALSQSQLISQ
FT                   MGIRSGIAHGSPSPPGSKSATPSPSSSTQEEESDAHFKISGEKRPSVDPGKKAKNPKKK
FT                   KKKDPNEPQKPVSAYALFFRDTQAAIKGQNPSATFGDVSKIVASMWDSLGEEQKQAYKR
FT                   KTEAAKKEYLKALAAYRASLVSKSPPDQGEAKNTQANPPAKMLPPKQPMYAMPGLASFL
FT                   TPSDLQAFRSGASPASLARTLGSKALLPGLSTSPPPPSFPLSPSLHQQLPLPPHAQGTL
FT                   LSPPLSMSPAPQPPVLPASMALQVQLAMSPSPPGPQDFPHISDFSSGSGSRSPGPSNPS
FT                   SSGDWDGSYPSGERGLGTCSLLPRDKSLYLTTLQRQPTAHHQPKEPAGTFCPLTCLLQG
FT                   SCGPRSLACTQSPASGLLAPAPTHRAAPFEVA"
FT   gene            complement(12040649..12102333)
FT                   /gene="Jph2"
FT                   /locus_tag="mCG_1669"
FT                   /note="gene_id=mCG1669.2"
FT   mRNA            complement(join(12040649..12042323,12043004..12043098,
FT                   12043632..12044371,12045861..12045979,12079990..12080760,
FT                   12101531..12102333))
FT                   /gene="Jph2"
FT                   /locus_tag="mCG_1669"
FT                   /product="junctophilin 2"
FT                   /note="gene_id=mCG1669.2 transcript_id=mCT1025.2 created on
FT                   22-NOV-2002"
FT   CDS             complement(join(12080423..12080760,12101531..12101909))
FT                   /codon_start=1
FT                   /gene="Jph2"
FT                   /locus_tag="mCG_1669"
FT                   /product="junctophilin 2"
FT                   /note="gene_id=mCG1669.2 transcript_id=mCT1025.2
FT                   protein_id=mCP5960.2"
FT                   /protein_id="EDL06323.1"
FT                   /translation="MSGGRFDFDDGGAYCGGWEGGKAHGHGLCTGPKGQGEYSGSWNFG
FT                   FEVAGVYTWPSGNTFEGYWSQGKRHGLGIETKGRWLYKGEWTHGFKGRYGIRQSTNSGA
FT                   KYEGTWNNGLQDGYGTETYADGGTYQGQFTNGMRHGYGVRQSVPYGMAVVVRSPLRTSL
FT                   SSLRSEHSNGTVAPDSPAADGPMLPSPPVPRGGFALTLLATAEAARPQGLFTRGHCWVG
FT                   CDAQNHAHHWAASGAA"
FT   gene            complement(12110208..>12123872)
FT                   /gene="3230401D17Rik"
FT                   /locus_tag="mCG_117353"
FT                   /note="gene_id=mCG117353.1"
FT   mRNA            complement(join(12110208..12111472,12115780..12115893,
FT                   12119918..12120038,12123795..>12123872))
FT                   /gene="3230401D17Rik"
FT                   /locus_tag="mCG_117353"
FT                   /product="RIKEN cDNA 3230401D17, transcript variant
FT                   mCT118496"
FT                   /note="gene_id=mCG117353.1 transcript_id=mCT118496.1
FT                   created on 22-NOV-2002"
FT   mRNA            complement(join(12110359..12111472,12115780..12115893,
FT                   12119918..12120038,12123424..>12123527))
FT                   /gene="3230401D17Rik"
FT                   /locus_tag="mCG_117353"
FT                   /product="RIKEN cDNA 3230401D17, transcript variant
FT                   mCT175940"
FT                   /note="gene_id=mCG117353.1 transcript_id=mCT175940.0
FT                   created on 22-NOV-2002"
FT   CDS             complement(join(12110788..12111472,12115780..12115893,
FT                   12119918..12120038,12123795..>12123870))
FT                   /codon_start=1
FT                   /gene="3230401D17Rik"
FT                   /locus_tag="mCG_117353"
FT                   /product="RIKEN cDNA 3230401D17, isoform CRA_a"
FT                   /note="gene_id=mCG117353.1 transcript_id=mCT118496.1
FT                   protein_id=mCP72919.0 isoform=CRA_a"
FT                   /protein_id="EDL06324.1"
FT                   /translation="DRRGGRGETLGADGAGFPGAPQLRGVLTGGNINRRTETFTMKSEA
FT                   KDGEEESLQTAFKKLRVDASGSIISLSVGEGPSVRASARTAADDTKPKTMCASKDSWHG
FT                   STRKSSRGAVRTQRRRRSKSPVLHPPKFIHCSTTAPPSSSQLKHRSQTEPPDGISGRGI
FT                   STPKEFNAGENSTSLDVNHTGAAIEPLRSSVLRLPSESKTEELSDATQVSQESLTANDL
FT                   SDFQSVSKLSQGKPCVCVGKECQCKRWHDMEVYSFSGLQNVPPLAPERRSLEDYSQSLH
FT                   TRTLSGSPRSCSEQARVYVDDVTIEDLAGYMEYYLYIPKKMSHMAEMMYT"
FT   CDS             complement(join(12110788..12111472,12115780..12115893,
FT                   12119918..12120038,12123424..>12123526))
FT                   /codon_start=1
FT                   /gene="3230401D17Rik"
FT                   /locus_tag="mCG_117353"
FT                   /product="RIKEN cDNA 3230401D17, isoform CRA_b"
FT                   /note="gene_id=mCG117353.1 transcript_id=mCT175940.0
FT                   protein_id=mCP98862.0 isoform=CRA_b"
FT                   /protein_id="EDL06325.1"
FT                   /translation="RPASRTPLRLRPAASAPQLHSCLLSESVVGRGGQVLTGGNINRRT
FT                   ETFTMKSEAKDGEEESLQTAFKKLRVDASGSIISLSVGEGPSVRASARTAADDTKPKTM
FT                   CASKDSWHGSTRKSSRGAVRTQRRRRSKSPVLHPPKFIHCSTTAPPSSSQLKHRSQTEP
FT                   PDGISGRGISTPKEFNAGENSTSLDVNHTGAAIEPLRSSVLRLPSESKTEELSDATQVS
FT                   QESLTANDLSDFQSVSKLSQGKPCVCVGKECQCKRWHDMEVYSFSGLQNVPPLAPERRS
FT                   LEDYSQSLHTRTLSGSPRSCSEQARVYVDDVTIEDLAGYMEYYLYIPKKMSHMAEMMYT
FT                   "
FT   gene            <12124178..12124738
FT                   /locus_tag="mCG_117367"
FT                   /note="gene_id=mCG117367.1"
FT   mRNA            <12124178..12124738
FT                   /locus_tag="mCG_117367"
FT                   /product="mCG117367"
FT                   /note="gene_id=mCG117367.1 transcript_id=mCT118504.1
FT                   created on 22-NOV-2002"
FT   CDS             <12124178..12124483
FT                   /codon_start=1
FT                   /locus_tag="mCG_117367"
FT                   /product="mCG117367"
FT                   /note="gene_id=mCG117367.1 transcript_id=mCT118504.1
FT                   protein_id=mCP73060.1"
FT                   /protein_id="EDL06326.1"
FT                   /translation="REAAACLAAIEPLPLPWHSLLPSCPLEVPKPTGFGGLREYLRQLM
FT                   PPGMLGGVSYMQPRALALGPQPSPWVVSLGPQRSQEGINWTRPRRWMLPGIGMEII"
FT   gene            complement(12127260..>12128933)
FT                   /locus_tag="mCG_141551"
FT                   /note="gene_id=mCG141551.0"
FT   mRNA            complement(join(12127260..12127651,12128851..>12128933))
FT                   /locus_tag="mCG_141551"
FT                   /product="mCG141551"
FT                   /note="gene_id=mCG141551.0 transcript_id=mCT175941.0
FT                   created on 22-NOV-2002"
FT   CDS             complement(join(12127409..12127651,12128851..>12128859))
FT                   /codon_start=1
FT                   /locus_tag="mCG_141551"
FT                   /product="mCG141551"
FT                   /note="gene_id=mCG141551.0 transcript_id=mCT175941.0
FT                   protein_id=mCP98863.0"
FT                   /protein_id="EDL06327.1"
FT                   /translation="ATQVCEHTVAVFRHTRRGHRISLQMVISHHVIGWEWNSGTLKGQS
FT                   VLLTAKPSLQPTSFLLLKGFCTALGKQSVISEVCVRSK"
FT   gene            <12142841..12159362
FT                   /gene="Gdap1l1"
FT                   /locus_tag="mCG_5446"
FT                   /note="gene_id=mCG5446.2"
FT   mRNA            join(<12142841..12143115,12150424..12150616,
FT                   12151889..12152062,12154956..12155053,12155891..12156005,
FT                   12157974..12159362)
FT                   /gene="Gdap1l1"
FT                   /locus_tag="mCG_5446"
FT                   /product="ganglioside-induced differentiation-associated
FT                   protein 1-like 1"
FT                   /note="gene_id=mCG5446.2 transcript_id=mCT4175.2 created on
FT                   22-NOV-2002"
FT   CDS             join(<12142843..12143115,12150424..12150616,
FT                   12151889..12152062,12154956..12155053,12155891..12156005,
FT                   12157974..12158317)
FT                   /codon_start=1
FT                   /gene="Gdap1l1"
FT                   /locus_tag="mCG_5446"
FT                   /product="ganglioside-induced differentiation-associated
FT                   protein 1-like 1"
FT                   /note="gene_id=mCG5446.2 transcript_id=mCT4175.2
FT                   protein_id=mCP5897.2"
FT                   /protein_id="EDL06328.1"
FT                   /translation="RGAGSKRPCDAGRQRAAAEPPPSSFLGSRAVMATPNNLTPTNCSW
FT                   WPISALESDAAKPVETPDAPEASSPAHWPKESLVLYHWTQSFSSQKVRLVIAEKGLACE
FT                   ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFTGEHVVALMP
FT                   EAGSPQHARVLQYRELLDALPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANATTD
FT                   LMKLDHEEEPQLSEPYLSKQKKLMAKILEHDDVSYLKKILGELAMVLDQIEAELEKRKL
FT                   ENEGQTCELWLCGCAFTLADVLLGATLHRLKFLGLSKKYWEDGSRPNLQSFFERVQRRF
FT                   AFRKVLGDIHTTLLSAVIPNAFRLVKRKPPSFFGASFLMGSLGGMGYFAYWYLKKKYI"
FT   gene            complement(12170697..>12177095)
FT                   /gene="D930001I22Rik"
FT                   /locus_tag="mCG_5451"
FT                   /note="gene_id=mCG5451.1"
FT   mRNA            complement(join(12170697..12174508,12176793..>12177095))
FT                   /gene="D930001I22Rik"
FT                   /locus_tag="mCG_5451"
FT                   /product="RIKEN cDNA D930001I22, transcript variant
FT                   mCT4170"
FT                   /note="gene_id=mCG5451.1 transcript_id=mCT4170.1 created on
FT                   22-NOV-2002"
FT   gene            <12172607..12173855
FT                   /locus_tag="mCG_141553"
FT                   /note="gene_id=mCG141553.0"
FT   mRNA            join(<12172607..12172809,12173264..12173837)
FT                   /locus_tag="mCG_141553"
FT                   /product="mCG141553, transcript variant mCT175951"
FT                   /note="gene_id=mCG141553.0 transcript_id=mCT175951.0
FT                   created on 22-NOV-2002"
FT   CDS             join(<12172608..12172809,12173264..12173451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141553"
FT                   /product="mCG141553, isoform CRA_a"
FT                   /note="gene_id=mCG141553.0 transcript_id=mCT175951.0
FT                   protein_id=mCP98874.0 isoform=CRA_a"
FT                   /protein_id="EDL06331.1"
FT                   /translation="TLLCLYHQPVGRKASEQVSTELLSQLNIHQLIQVCFSVLFLPSFF
FT                   LLPVRSSQCGPGKVTSTSQRSACQPGLQSEFQNTQGYTEKQQQQPSRHFGVMGPCWESW
FT                   PGEMSTFHRGRGCYSQRVSLRHWGI"
FT   mRNA            join(<12173220..12173272,12173378..12173855)
FT                   /locus_tag="mCG_141553"
FT                   /product="mCG141553, transcript variant mCT175952"
FT                   /note="gene_id=mCG141553.0 transcript_id=mCT175952.0
FT                   created on 22-NOV-2002"
FT   CDS             <12173583..12173810
FT                   /codon_start=1
FT                   /locus_tag="mCG_141553"
FT                   /product="mCG141553, isoform CRA_b"
FT                   /note="gene_id=mCG141553.0 transcript_id=mCT175952.0
FT                   protein_id=mCP98873.0 isoform=CRA_b"
FT                   /protein_id="EDL06332.1"
FT                   /translation="SPDSLLTHTMRQAALPLLSLSSPSGDRLRSHLAIDEKNLTGVALL
FT                   ATWWHRQQSLPTKLVPQAPPTPKVPSKGPL"
FT   CDS             complement(join(12173893..12174508,12176793..>12176980))
FT                   /codon_start=1
FT                   /gene="D930001I22Rik"
FT                   /locus_tag="mCG_5451"
FT                   /product="RIKEN cDNA D930001I22, isoform CRA_a"
FT                   /note="gene_id=mCG5451.1 transcript_id=mCT4170.1
FT                   protein_id=mCP6008.0 isoform=CRA_a"
FT                   /protein_id="EDL06329.1"
FT                   /translation="PRRTGMEHLERCAWFLRGTLVRATVRRHLPWALVAAMLAGSVVKE
FT                   LSPLPESYLSNKRNVLNVYFVKLAWAWTVCLLLPFIALTNYHLTGKTSLVLRRLSTLLV
FT                   GTAIWYICTALFSNIEHYTGSCYQSPALEGIRQEHRSKQQCHREGGFWHGFDISGHSFL
FT                   LTFCALMIVEEMAVLHEVKTDRGHHLHAAITTLVVALGFLTFIWVWMFLCTAVYFHDLT
FT                   QKVFGTMFGLLGWYGTYGYWYLKSFSPGLPPQSCSLTLKRDTYKK"
FT   mRNA            complement(join(12174377..12174508,12176640..>12176752))
FT                   /gene="D930001I22Rik"
FT                   /locus_tag="mCG_5451"
FT                   /product="RIKEN cDNA D930001I22, transcript variant
FT                   mCT175950"
FT                   /note="gene_id=mCG5451.1 transcript_id=mCT175950.0 created
FT                   on 22-NOV-2002"
FT   CDS             complement(join(12174432..12174508,12176640..>12176703))
FT                   /codon_start=1
FT                   /gene="D930001I22Rik"
FT                   /locus_tag="mCG_5451"
FT                   /product="RIKEN cDNA D930001I22, isoform CRA_b"
FT                   /note="gene_id=mCG5451.1 transcript_id=mCT175950.0
FT                   protein_id=mCP98872.0 isoform=CRA_b"
FT                   /protein_id="EDL06330.1"
FT                   /translation="QARPRACRDTGTLGKQVTFAPSILLNWPGPGQSVSSCLSLPLPTT
FT                   T"
FT   assembly_gap    12196206..12196225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12196753..>12206888
FT                   /locus_tag="mCG_5440"
FT                   /note="gene_id=mCG5440.2"
FT   mRNA            join(<12196753..12197187,12200123..12200241,
FT                   12202729..12202861,12204249..12204364,12206756..>12206888)
FT                   /locus_tag="mCG_5440"
FT                   /product="mCG5440"
FT                   /note="gene_id=mCG5440.2 transcript_id=mCT4187.2 created on
FT                   22-NOV-2002"
FT   CDS             join(<12196894..12197187,12200123..12200241,
FT                   12202729..12202861,12204249..12204364,12206756..12206888)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5440"
FT                   /product="mCG5440"
FT                   /note="gene_id=mCG5440.2 transcript_id=mCT4187.2
FT                   protein_id=mCP5953.2"
FT                   /protein_id="EDL06333.1"
FT                   /translation="LHQTGTPSQTAMPLLSSIVGLTGLLLWMGHTVGALRMPNTTLVQG
FT                   RPKNTAVWPLSGLGVPRHRRKRHISARDMSALLDYHNHIRASVHPPAANMEYMVWDEQL
FT                   ARSAEAWATQCIWTHGPSQLMKYVGQNLSIHSGRFRSVVDLVRSWSEEKRHYSFPAPKD
FT                   CTPHCPWLCSGPVCSHYTQMVWASSSRLGCAINTCSSINVWGNTWQQAVYLVCNYAIKG
FT                   NWIGEAPYKAGKPCSACPPSYQGNCNSNMCFSGLKSNRLPWV"
FT   gene            complement(12198238..>12239775)
FT                   /gene="0610008F07Rik"
FT                   /locus_tag="mCG_1028032"
FT                   /note="gene_id=mCG1028032.0"
FT   mRNA            complement(join(12198238..12198592,12201001..12201065,
FT                   12201169..12201372,12239556..>12239775))
FT                   /gene="0610008F07Rik"
FT                   /locus_tag="mCG_1028032"
FT                   /product="RIKEN cDNA 0610008F07, transcript variant
FT                   mCT175937"
FT                   /note="gene_id=mCG1028032.0 transcript_id=mCT175937.0
FT                   created on 19-JUN-2003"
FT   CDS             complement(join(12198427..12198592,12201001..12201065,
FT                   12201169..12201372,12239556..>12239561))
FT                   /codon_start=1
FT                   /gene="0610008F07Rik"
FT                   /locus_tag="mCG_1028032"
FT                   /product="RIKEN cDNA 0610008F07, isoform CRA_b"
FT                   /note="gene_id=mCG1028032.0 transcript_id=mCT175937.0
FT                   protein_id=mCP98859.0 isoform=CRA_b"
FT                   /protein_id="EDL06335.1"
FT                   /translation="NQQEKRVCEPGEDHGHQDHQLCRTLRHHSWLPRPSTASNQLVTCQ
FT                   DGDAPNGMRNSVRTNLDPCSGYGKLMCRHMFSRGARVSIWRPEVNLRSQEGELLSLNLA
FT                   HGHRPPRRQEMKALKEAKDAPIVAVCCCLLLPAAACCCLLHW"
FT   mRNA            complement(join(12198614..12198742,12201001..12201065,
FT                   12239556..>12239745))
FT                   /gene="0610008F07Rik"
FT                   /locus_tag="mCG_1028032"
FT                   /product="RIKEN cDNA 0610008F07, transcript variant
FT                   mCT175936"
FT                   /note="gene_id=mCG1028032.0 transcript_id=mCT175936.0
FT                   created on 19-JUN-2003"
FT   CDS             complement(join(12198675..12198742,12201001..12201065,
FT                   12239556..>12239698))
FT                   /codon_start=1
FT                   /gene="0610008F07Rik"
FT                   /locus_tag="mCG_1028032"
FT                   /product="RIKEN cDNA 0610008F07, isoform CRA_a"
FT                   /note="gene_id=mCG1028032.0 transcript_id=mCT175936.0
FT                   protein_id=mCP98858.0 isoform=CRA_a"
FT                   /protein_id="EDL06334.1"
FT                   /translation="ESWAAGTCQAILYLPWGSRPRDPRSYLRGPLLPEAGTRYLLVPTT
FT                   ETRCADTCFHVEHVCPFGGQKSTSVLFTQQILNNILWHRGLSLARK"
FT   gene            12211277..12270945
FT                   /gene="Hnf4a"
FT                   /locus_tag="mCG_5450"
FT                   /note="gene_id=mCG5450.2"
FT   mRNA            join(12211277..12211421,12249633..12249807,
FT                   12250616..12250710,12256231..12256337,12257001..12257156,
FT                   12260563..12260650,12262198..12262353,12264161..12264397,
FT                   12266927..12267079,12267989..12270945)
FT                   /gene="Hnf4a"
FT                   /locus_tag="mCG_5450"
FT                   /product="hepatic nuclear factor 4, alpha, transcript
FT                   variant mCT175948"
FT                   /note="gene_id=mCG5450.2 transcript_id=mCT175948.0 created
FT                   on 22-NOV-2002"
FT   CDS             join(12211373..12211421,12249633..12249807,
FT                   12250616..12250710,12256231..12256337,12257001..12257156,
FT                   12260563..12260650,12262198..12262353,12264161..12264397,
FT                   12266927..12267079,12267989..12268131)
FT                   /codon_start=1
FT                   /gene="Hnf4a"
FT                   /locus_tag="mCG_5450"
FT                   /product="hepatic nuclear factor 4, alpha, isoform CRA_a"
FT                   /note="gene_id=mCG5450.2 transcript_id=mCT175948.0
FT                   protein_id=mCP98870.0 isoform=CRA_a"
FT                   /protein_id="EDL06336.1"
FT                   /translation="MVSVNAPLGAPVASPYDTSPSEGANLNSSNSLGVSALCAICGDRA
FT                   TGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCRYCRLKKCFRAGMK
FT                   KEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPISGINGDIRAKKIANIT
FT                   DVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLGATKRSMVFKDVLL
FT                   LGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLKAIIFFDPDAKGLS
FT                   DPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFG
FT                   MAKIDNLLQEMLLGGSASDAPHTHHPLHPHLMQEHMGTNVIVANTMPSHLSNGQMCEWP
FT                   RPRGQAATPETPQPSPPSGSGSESYKLLPGAITTIVKPPSAIPQPTITKQEAI"
FT   assembly_gap    12221375..12221475
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   mRNA            join(12245235..12245475,12249633..12249807,
FT                   12250616..12250710,12256231..12256337,12257001..12257156,
FT                   12260563..12260650,12262198..12262353,12264161..12264397,
FT                   12266927..12267079,12267989..12270945)
FT                   /gene="Hnf4a"
FT                   /locus_tag="mCG_5450"
FT                   /product="hepatic nuclear factor 4, alpha, transcript
FT                   variant mCT4174"
FT                   /note="gene_id=mCG5450.2 transcript_id=mCT4174.1 created on
FT                   22-NOV-2002"
FT   CDS             join(12245388..12245475,12249633..12249807,
FT                   12250616..12250710,12256231..12256337,12257001..12257156,
FT                   12260563..12260650,12262198..12262353,12264161..12264397,
FT                   12266927..12267079,12267989..12268131)
FT                   /codon_start=1
FT                   /gene="Hnf4a"
FT                   /locus_tag="mCG_5450"
FT                   /product="hepatic nuclear factor 4, alpha, isoform CRA_b"
FT                   /note="gene_id=mCG5450.2 transcript_id=mCT4174.1
FT                   protein_id=mCP5995.1 isoform=CRA_b"
FT                   /db_xref="GOA:Z4YKX0"
FT                   /db_xref="InterPro:IPR000536"
FT                   /db_xref="InterPro:IPR001628"
FT                   /db_xref="InterPro:IPR001723"
FT                   /db_xref="InterPro:IPR003068"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="MGI:MGI:109128"
FT                   /db_xref="UniProtKB/TrEMBL:Z4YKX0"
FT                   /protein_id="EDL06337.1"
FT                   /translation="MDMADYSAALDPAYTTLEFENVQVLTMGNDTSPSEGANLNSSNSL
FT                   GVSALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKDKRNQCR
FT                   YCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQAEVLSQQITSPISGI
FT                   NGDIRAKKIANITDVCESMKEQLLVLVEWAKYIPAFCELLLDDQVALLRAHAGEHLLLG
FT                   ATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRILDELVLPFQELQIDDNEYACLK
FT                   AIIFFDPDAKGLSDPGKIKRLRSQVQVSLEDYINDRQYDSRGRFGELLLLLPTLQSITW
FT                   QMIEQIQFIKLFGMAKIDNLLQEMLLGGSASDAPHTHHPLHPHLMQEHMGTNVIVANTM
FT                   PSHLSNGQMCEWPRPRGQAATPETPQPSPPSGSGSESYKLLPGAITTIVKPPSAIPQPT
FT                   ITKQEAI"
FT   gene            complement(12263352..>12270950)
FT                   /locus_tag="mCG_141552"
FT                   /note="gene_id=mCG141552.0"
FT   mRNA            complement(join(12263352..12263544,12270731..>12270950))
FT                   /locus_tag="mCG_141552"
FT                   /product="mCG141552"
FT                   /note="gene_id=mCG141552.0 transcript_id=mCT175949.0
FT                   created on 22-NOV-2002"
FT   CDS             complement(12263411..>12263536)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141552"
FT                   /product="mCG141552"
FT                   /note="gene_id=mCG141552.0 transcript_id=mCT175949.0
FT                   protein_id=mCP98871.0"
FT                   /protein_id="EDL06338.1"
FT                   /translation="CELGAPSPQIRSHHLDPEFGTLRDSPSLACCHLPPVTWGLS"
FT   gene            <12300400..12317065
FT                   /gene="5830472M02Rik"
FT                   /locus_tag="mCG_5452"
FT                   /note="gene_id=mCG5452.2"
FT   mRNA            join(<12300400..12300467,12305264..12305726,
FT                   12309813..12310006,12311789..12311899,12313417..12317065)
FT                   /gene="5830472M02Rik"
FT                   /locus_tag="mCG_5452"
FT                   /product="RIKEN cDNA 5830472M02, transcript variant
FT                   mCT4166"
FT                   /note="gene_id=mCG5452.2 transcript_id=mCT4166.2 created on
FT                   22-NOV-2002"
FT   mRNA            join(<12300401..12300467,12305261..12305726,
FT                   12309813..12310006,12311789..12311899,12313417..12314265)
FT                   /gene="5830472M02Rik"
FT                   /locus_tag="mCG_5452"
FT                   /product="RIKEN cDNA 5830472M02, transcript variant
FT                   mCT175953"
FT                   /note="gene_id=mCG5452.2 transcript_id=mCT175953.0 created
FT                   on 22-NOV-2002"
FT   mRNA            join(<12300402..12300467,12305264..12305726,
FT                   12311789..12311899,12313417..12314554)
FT                   /gene="5830472M02Rik"
FT                   /locus_tag="mCG_5452"
FT                   /product="RIKEN cDNA 5830472M02, transcript variant
FT                   mCT189901"
FT                   /note="gene_id=mCG5452.2 transcript_id=mCT189901.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<12305276..12305726,12309813..12310006,
FT                   12311789..12311899,12313417..12313695)
FT                   /codon_start=1
FT                   /gene="5830472M02Rik"
FT                   /locus_tag="mCG_5452"
FT                   /product="RIKEN cDNA 5830472M02, isoform CRA_b"
FT                   /note="gene_id=mCG5452.2 transcript_id=mCT175953.0
FT                   protein_id=mCP98875.0 isoform=CRA_b"
FT                   /protein_id="EDL06340.1"
FT                   /translation="LMSEESDSLRTSPSVASLSENELPLPPPDPPGYVCSLTEDLVTKA
FT                   REELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNY
FT                   HGCRRSWPEVFSNLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITEN
FT                   IRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRI
FT                   KAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRNILPKEYGGTAG
FT                   ELDTASWNAVLLASEEDFVKEFCQPMPACDNLLGQPLLPEGLISDAQCDDSMRAMKSQL
FT                   YSCY"
FT   CDS             join(<12305276..12305726,12309813..12310006,
FT                   12311789..12311899,12313417..12313695)
FT                   /codon_start=1
FT                   /gene="5830472M02Rik"
FT                   /locus_tag="mCG_5452"
FT                   /product="RIKEN cDNA 5830472M02, isoform CRA_b"
FT                   /note="gene_id=mCG5452.2 transcript_id=mCT4166.2
FT                   protein_id=mCP5854.2 isoform=CRA_b"
FT                   /protein_id="EDL06341.1"
FT                   /translation="LMSEESDSLRTSPSVASLSENELPLPPPDPPGYVCSLTEDLVTKA
FT                   REELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNY
FT                   HGCRRSWPEVFSNLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPDRWIPSNYPITEN
FT                   IRAVYLTLEKLIQSEETQVNGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRI
FT                   KAVHIVNEPRIFKGIFAIIKPFLKEKIANRFFLHGSDLNSLHTNLPRNILPKEYGGTAG
FT                   ELDTASWNAVLLASEEDFVKEFCQPMPACDNLLGQPLLPEGLISDAQCDDSMRAMKSQL
FT                   YSCY"
FT   CDS             join(<12305276..12305726,12311789..12311847)
FT                   /codon_start=1
FT                   /gene="5830472M02Rik"
FT                   /locus_tag="mCG_5452"
FT                   /product="RIKEN cDNA 5830472M02, isoform CRA_a"
FT                   /note="gene_id=mCG5452.2 transcript_id=mCT189901.0
FT                   protein_id=mCP110896.0 isoform=CRA_a"
FT                   /protein_id="EDL06339.1"
FT                   /translation="LMSEESDSLRTSPSVASLSENELPLPPPDPPGYVCSLTEDLVTKA
FT                   REELQEKPEWRLRDVQALRDMVRKEYPYLSTSLDDAFLLRFLRARKFDYDRALQLLVNY
FT                   HGCRRSWPEVFSNLRPSALKDVLNSGFLTVLPHTDPRGCHVLCIRPGWLPHSDKSSSHS
FT                   ERTSDI"
FT   gene            complement(12321313..12343131)
FT                   /gene="Serinc3"
FT                   /locus_tag="mCG_5448"
FT                   /note="gene_id=mCG5448.2"
FT   mRNA            complement(join(12321313..12323617,12324291..12324515,
FT                   12325910..12326090,12327165..12327255,12328964..12329133,
FT                   12330144..12330281,12332477..12332556,12334844..12335037,
FT                   12337199..12337360,12343032..12343131))
FT                   /gene="Serinc3"
FT                   /locus_tag="mCG_5448"
FT                   /product="serine incorporator 3"
FT                   /note="gene_id=mCG5448.2 transcript_id=mCT4173.2 created on
FT                   22-NOV-2002"
FT   CDS             complement(join(12323479..12323617,12324291..12324515,
FT                   12325910..12326090,12327165..12327255,12328964..12329133,
FT                   12330144..12330281,12332477..12332556,12334844..12335037,
FT                   12337199..12337360,12343032..12343070))
FT                   /codon_start=1
FT                   /gene="Serinc3"
FT                   /locus_tag="mCG_5448"
FT                   /product="serine incorporator 3"
FT                   /note="gene_id=mCG5448.2 transcript_id=mCT4173.2
FT                   protein_id=mCP5974.1"
FT                   /protein_id="EDL06342.1"
FT                   /translation="MGAVLGVFSLASWVPCLCSGASCLLCSCCPISKNSTVTRLIYAFI
FT                   LFLGTIVSCIMMTEGIQTQLKKIPGFCEGGFQIKMVDTKAEKDCDVLVGFKAVYRINFA
FT                   VAIFFFAFFLLMLKVKTSKDPRAAVHNGFWFFKIAAIIGIMIGSFYIPGGSFTEVWFVA
FT                   GMLGASFFIIIQLVLLVDMAHSWNELWVNRMEEGNPRLWYAALLSFTSLFYILSIVFAA
FT                   LLYVFYTKPDDCTENKVFISLNLIFCVAVSIVSILPKVQEHQPRSGLLQSSIITLYTLY
FT                   LTWSAMTNEPERSCNPSLMSIITHLTSPTVSPANSTTLAPAYAPPSQSGHFMNLDDIWG
FT                   LIIFVFCLIYSSFRTSSNSQVNKLTLSGSDSVILGDTTNGANDEEDGQPRRAVDNEKEG
FT                   VQYSYSFFHLMLCCASLYIMMTITSWYSPDAKFQKVSSKWLAVWFKMGSSWLCLLLYLW
FT                   TLVAPLVLTGRDFS"
FT   gene            12342882..12343834
FT                   /locus_tag="mCG_147188"
FT                   /note="gene_id=mCG147188.0"
FT   mRNA            12342882..12343834
FT                   /locus_tag="mCG_147188"
FT                   /product="mCG147188"
FT                   /note="gene_id=mCG147188.0 transcript_id=mCT187451.0
FT                   created on 13-JAN-2004"
FT   CDS             12343456..12343770
FT                   /codon_start=1
FT                   /locus_tag="mCG_147188"
FT                   /product="mCG147188"
FT                   /note="gene_id=mCG147188.0 transcript_id=mCT187451.0
FT                   protein_id=mCP109241.0"
FT                   /protein_id="EDL06343.1"
FT                   /translation="MECWQTQRQTGYVGPFNNQLASVIPELKRMRLEDQEFKTILCYIE
FT                   FQTNKKATLLTPHPTGNFSSLVSPSPFPLPLFPCPPFPLPPPSAGVSLLARFSSLLSLS
FT                   "
FT   assembly_gap    12350833..12350852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12355132..12355151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12356666..12424547
FT                   /locus_tag="mCG_5444"
FT                   /note="gene_id=mCG5444.2"
FT   mRNA            join(12356666..12356747,12401858..12401927,
FT                   12419523..12419696,12423852..12424545)
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, transcript variant mCT175947"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175947.0 created
FT                   on 22-NOV-2002"
FT   mRNA            join(12356707..12356747,12357405..12357490,
FT                   12401858..12401927,12419523..12419696,12423852..12423981)
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, transcript variant mCT175945"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175945.0 created
FT                   on 22-NOV-2002"
FT   mRNA            join(12356707..12356747,12401858..12401927,
FT                   12419523..12419696,12423855..12423936)
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, transcript variant mCT175946"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175946.0 created
FT                   on 22-NOV-2002"
FT   mRNA            join(12356716..12356747,12419523..12419696,
FT                   12423852..12424148)
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, transcript variant mCT175944"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175944.0 created
FT                   on 22-NOV-2002"
FT   mRNA            join(<12356726..12356747,12419523..12419692,
FT                   12424010..>12424073)
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, transcript variant mCT175943"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175943.0 created
FT                   on 22-NOV-2002"
FT   CDS             join(<12356726..12356747,12419523..12419692,
FT                   12424010..>12424073)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, isoform CRA_c"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175943.0
FT                   protein_id=mCP98866.0 isoform=CRA_c"
FT                   /protein_id="EDL06347.1"
FT                   /translation="LRGDKAAGLRSDETGMMEVESSYSDFISCDRTGRRNAVPDIQGDS
FT                   EAVSVRKLAGDMGELALEGSLMESSVAPTPAKSSTHSTGS"
FT   mRNA            join(12356805..12356914,12401858..12401927,
FT                   12419523..12419696,12423852..12424315)
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, transcript variant mCT175942"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175942.0 created
FT                   on 22-NOV-2002"
FT   mRNA            join(12392236..12392356,12401858..12401927,
FT                   12419523..12419696,12423852..12424547)
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, transcript variant mCT4179"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT4179.1 created on
FT                   22-NOV-2002"
FT   assembly_gap    12396311..12396378
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   CDS             join(12419546..12419696,12423852..12423931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, isoform CRA_a"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175944.0
FT                   protein_id=mCP98864.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TP50"
FT                   /db_xref="InterPro:IPR004171"
FT                   /db_xref="MGI:MGI:1343086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TP50"
FT                   /protein_id="EDL06344.1"
FT                   /translation="MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGEL
FT                   ALEGAEGQAEGSTPDKEASSQPESSDANTSS"
FT   CDS             join(12419546..12419696,12423852..12423931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, isoform CRA_a"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175945.0
FT                   protein_id=mCP98868.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TP50"
FT                   /db_xref="InterPro:IPR004171"
FT                   /db_xref="MGI:MGI:1343086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TP50"
FT                   /protein_id="EDL06345.1"
FT                   /translation="MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGEL
FT                   ALEGAEGQAEGSTPDKEASSQPESSDANTSS"
FT   CDS             join(12419546..12419696,12423852..12423931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, isoform CRA_a"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175947.0
FT                   protein_id=mCP98867.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TP50"
FT                   /db_xref="InterPro:IPR004171"
FT                   /db_xref="MGI:MGI:1343086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TP50"
FT                   /protein_id="EDL06348.1"
FT                   /translation="MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGEL
FT                   ALEGAEGQAEGSTPDKEASSQPESSDANTSS"
FT   CDS             join(12419546..12419696,12423852..12423931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, isoform CRA_a"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT4179.1
FT                   protein_id=mCP5959.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TP50"
FT                   /db_xref="InterPro:IPR004171"
FT                   /db_xref="MGI:MGI:1343086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TP50"
FT                   /protein_id="EDL06349.1"
FT                   /translation="MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGEL
FT                   ALEGAEGQAEGSTPDKEASSQPESSDANTSS"
FT   CDS             join(12419546..12419696,12423852..12423931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, isoform CRA_a"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175942.0
FT                   protein_id=mCP98869.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TP50"
FT                   /db_xref="InterPro:IPR004171"
FT                   /db_xref="MGI:MGI:1343086"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TP50"
FT                   /protein_id="EDL06350.1"
FT                   /translation="MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGEL
FT                   ALEGAEGQAEGSTPDKEASSQPESSDANTSS"
FT   CDS             join(12419546..12419696,12423855..12423931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5444"
FT                   /product="mCG5444, isoform CRA_b"
FT                   /note="gene_id=mCG5444.2 transcript_id=mCT175946.0
FT                   protein_id=mCP98865.0 isoform=CRA_b"
FT                   /protein_id="EDL06346.1"
FT                   /translation="MMEVESSYSDFISCDRTGRRNAVPDIQGDSEAVSVRKLAGDMGEL
FT                   ALEGAGQAEGSTPDKEASSQPESSDANTSS"
FT   gene            complement(12424708..12448633)
FT                   /gene="Ada"
FT                   /locus_tag="mCG_5441"
FT                   /note="gene_id=mCG5441.2"
FT   mRNA            complement(join(12424708..12425443,12425939..12426038,
FT                   12426529..12426658,12428438..12428502,12428724..12428825,
FT                   12428907..12428978,12429531..12429658,12430683..12430798,
FT                   12431280..12431423,12433775..12433897,12436589..12436650,
FT                   12448485..12448633))
FT                   /gene="Ada"
FT                   /locus_tag="mCG_5441"
FT                   /product="adenosine deaminase, transcript variant mCT4176"
FT                   /note="gene_id=mCG5441.2 transcript_id=mCT4176.2 created on
FT                   26-NOV-2002"
FT   mRNA            complement(join(12424708..12425446,12425939..12426038,
FT                   12426529..12426658,12428438..12428502,12428724..12428825,
FT                   12428907..12428978,12429531..12429658,12430683..12430798,
FT                   12431280..12431423,12433775..12433897,12436589..12436650,
FT                   12448485..12448633))
FT                   /gene="Ada"
FT                   /locus_tag="mCG_5441"
FT                   /product="adenosine deaminase, transcript variant
FT                   mCT176220"
FT                   /note="gene_id=mCG5441.2 transcript_id=mCT176220.0 created
FT                   on 26-NOV-2002"
FT   CDS             complement(join(12425955..12426038,12426529..12426658,
FT                   12428438..12428502,12428724..12428825,12428907..12428978,
FT                   12429531..12429658,12430683..12430798,12431280..12431423,
FT                   12433775..12433897,12436589..12436650,12448485..12448517))
FT                   /codon_start=1
FT                   /gene="Ada"
FT                   /locus_tag="mCG_5441"
FT                   /product="adenosine deaminase, isoform CRA_a"
FT                   /note="gene_id=mCG5441.2 transcript_id=mCT4176.2
FT                   protein_id=mCP5932.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK28"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="MGI:MGI:87916"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK28"
FT                   /protein_id="EDL06351.1"
FT                   /translation="MAQTPAFNKPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEE
FT                   LRNIIGMDKPLSLPGFLAKFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSP
FT                   HLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSL
FT                   EVLELCKKYNQKTVVAMDLAGDETIEGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGSPE
FT                   VVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAVV
FT                   RFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEK
FT                   KELLERLYREYQ"
FT   CDS             complement(join(12425955..12426038,12426529..12426658,
FT                   12428438..12428502,12428724..12428825,12428907..12428978,
FT                   12429531..12429658,12430683..12430798,12431280..12431423,
FT                   12433775..12433897,12436589..12436650,12448485..12448517))
FT                   /codon_start=1
FT                   /gene="Ada"
FT                   /locus_tag="mCG_5441"
FT                   /product="adenosine deaminase, isoform CRA_a"
FT                   /note="gene_id=mCG5441.2 transcript_id=mCT176220.0
FT                   protein_id=mCP99142.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK28"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR028893"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="MGI:MGI:87916"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK28"
FT                   /protein_id="EDL06352.1"
FT                   /translation="MAQTPAFNKPKVELHVHLDGAIKPETILYFGKKRGIALPADTVEE
FT                   LRNIIGMDKPLSLPGFLAKFDYYMPVIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSP
FT                   HLLANSKVDPMPWNQTEGDVTPDDVVDLVNQGLQEGEQAFGIKVRSILCCMRHQPSWSL
FT                   EVLELCKKYNQKTVVAMDLAGDETIEGSSLFPGHVEAYEGAVKNGIHRTVHAGEVGSPE
FT                   VVREAVDILKTERVGHGYHTIEDEALYNRLLKENMHFEVCPWSSYLTGAWDPKTTHAVV
FT                   RFKNDKANYSLNTDDPLIFKSTLDTDYQMTKKDMGFTEEEFKRLNINAAKSSFLPEEEK
FT                   KELLERLYREYQ"
FT   assembly_gap    12459022..12461183
FT                   /estimated_length=2162
FT                   /gap_type="unknown"
FT   assembly_gap    12485557..12485576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12488989..12489008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12490114..12490133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12492951..12493115
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    12498592..12498611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12514648..12537484
FT                   /gene="Wisp2"
FT                   /locus_tag="mCG_5435"
FT                   /note="gene_id=mCG5435.2"
FT   mRNA            join(12514648..12514923,12515103..12515195,
FT                   12518952..12519168,12522649..12522906,12536558..12537484)
FT                   /gene="Wisp2"
FT                   /locus_tag="mCG_5435"
FT                   /product="WNT1 inducible signaling pathway protein 2,
FT                   transcript variant mCT4183"
FT                   /note="gene_id=mCG5435.2 transcript_id=mCT4183.2 created on
FT                   26-NOV-2002"
FT   mRNA            join(12514648..12514923,12515103..12515195,
FT                   12518952..12519168,12522649..12522906,12526293..>12526513)
FT                   /gene="Wisp2"
FT                   /locus_tag="mCG_5435"
FT                   /product="WNT1 inducible signaling pathway protein 2,
FT                   transcript variant mCT176219"
FT                   /note="gene_id=mCG5435.2 transcript_id=mCT176219.0 created
FT                   on 26-NOV-2002"
FT   CDS             join(12515136..12515195,12518952..12519168,
FT                   12522649..12522906,12536558..12536661)
FT                   /codon_start=1
FT                   /gene="Wisp2"
FT                   /locus_tag="mCG_5435"
FT                   /product="WNT1 inducible signaling pathway protein 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5435.2 transcript_id=mCT4183.2
FT                   protein_id=mCP5908.2 isoform=CRA_b"
FT                   /protein_id="EDL06354.1"
FT                   /translation="MRGNPLIHLLAISFLCILSMVYAQLCPAPCACPWTPPQCPPGVPL
FT                   VLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNG
FT                   RRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVC
FT                   DQAVMQPAIQPSSAQDTNFLPLSLLHLPMAPVQTGAQPGAPAQPPVGWA"
FT   CDS             join(12515136..12515195,12518952..12519168,
FT                   12522649..12522906,12526293..12526513)
FT                   /codon_start=1
FT                   /gene="Wisp2"
FT                   /locus_tag="mCG_5435"
FT                   /product="WNT1 inducible signaling pathway protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5435.2 transcript_id=mCT176219.0
FT                   protein_id=mCP99141.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2AHD1"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR000884"
FT                   /db_xref="InterPro:IPR001007"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="MGI:MGI:1328326"
FT                   /db_xref="UniProtKB/TrEMBL:A2AHD1"
FT                   /protein_id="EDL06353.1"
FT                   /translation="MRGNPLIHLLAISFLCILSMVYAQLCPAPCACPWTPPQCPPGVPL
FT                   VLDGCGCCRVCARRLGESCDHLHVCDPSQGLVCQPGAGPSGRGAVCLFEEDDGSCEVNG
FT                   RRYLDGETFKPNCRVLCRCDDGGFTCLPLCSEDVRLPSWDCPRPRRIQVPGRCCPEWVC
FT                   DQAVMQPAIQPSSAQGHQLSALVTPASADGPCPNWSTAWGPCSTTCGLGIATRVSNQNR
FT                   FCQLEIQRRLCLSRPCLASRSHGSWNSAF"
FT   assembly_gap    12525002..12525021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12526639..12527375
FT                   /estimated_length=737
FT                   /gap_type="unknown"
FT   assembly_gap    12528462..12530555
FT                   /estimated_length=2094
FT                   /gap_type="unknown"
FT   assembly_gap    12536538..12536557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12537633..12537652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12538788..12538807
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12543728..12544360
FT                   /estimated_length=633
FT                   /gap_type="unknown"
FT   assembly_gap    12547693..12548790
FT                   /estimated_length=1098
FT                   /gap_type="unknown"
FT   gene            <12549518..>12550210
FT                   /gene="Kcnk15"
FT                   /locus_tag="mCG_5431"
FT                   /note="gene_id=mCG5431.1"
FT   mRNA            <12549518..>12550210
FT                   /gene="Kcnk15"
FT                   /locus_tag="mCG_5431"
FT                   /product="potassium channel, subfamily K, member 15"
FT                   /note="gene_id=mCG5431.1 transcript_id=mCT4190.2 created on
FT                   26-NOV-2002"
FT   CDS             <12549518..12550210
FT                   /codon_start=1
FT                   /gene="Kcnk15"
FT                   /locus_tag="mCG_5431"
FT                   /product="potassium channel, subfamily K, member 15"
FT                   /note="gene_id=mCG5431.1 transcript_id=mCT4190.2
FT                   protein_id=mCP5920.2"
FT                   /protein_id="EDL06355.1"
FT                   /translation="GYGHAAPGTDSGKVFCMFYALLGIPLTLVTFQSLGERLNTLVRCL
FT                   LLTAKRCLGLRRPHVSAENMVVAGLLLCAATLALGAIAFAHFEGWTFFHAYYYCFITLT
FT                   TIGFGDFVALQRDEALQRKPPYVAFSFLYILLGLTVIGAFLNLVVLRFLASADAPERAV
FT                   HRRVSVFRRGAPESRVRAGASTCIPYPFHQLETWARDNPAFSPPLSPEATHHCHSSPDR
FT                   PRARRKSI"
FT   gene            complement(<12555242..>12609131)
FT                   /gene="Rims4"
FT                   /locus_tag="mCG_5449"
FT                   /note="gene_id=mCG5449.2"
FT   mRNA            complement(join(<12555242..12555460,12556031..12556170,
FT                   12556618..12556719,12556957..12557069,12570236..12570374,
FT                   12609035..>12609131))
FT                   /gene="Rims4"
FT                   /locus_tag="mCG_5449"
FT                   /product="regulating synaptic membrane exocytosis 4"
FT                   /note="gene_id=mCG5449.2 transcript_id=mCT4182.2 created on
FT                   26-NOV-2002"
FT   CDS             complement(join(12555242..12555460,12556031..12556170,
FT                   12556618..12556719,12556957..12557069,12570236..12570374,
FT                   12609035..12609131))
FT                   /codon_start=1
FT                   /gene="Rims4"
FT                   /locus_tag="mCG_5449"
FT                   /product="regulating synaptic membrane exocytosis 4"
FT                   /note="gene_id=mCG5449.2 transcript_id=mCT4182.2
FT                   protein_id=mCP5918.2"
FT                   /protein_id="EDL06356.1"
FT                   /translation="MERSQSRLSLSASFEALAIYFPCMNSFDDEDAADSRRLKGAIQRS
FT                   TETGLAVEMPSRTLRQASHESIEDSMNSYGSEGNLNYGGVCLASDAQFSDFLGSMGPAQ
FT                   FVGRQTLATTPMGDVEIGLQERNGQLEVDIIQARGLTAKPGSKTLPAAYIKAYLLENGV
FT                   CIAKKKTKVARKSLDPLYNQVLLFPESPQGKVLQVIVWGNYGRMERKQFMGVARVLLEE
FT                   LDLTTLAVGWYKLFPTSSMVDPATGPLLRQASQLSLESTVGPCGERS"
FT   assembly_gap    12555924..12555972
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    12560172..12560191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12603575..12603594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12609406..12609709
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    12662736..12662755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12667409..12669051
FT                   /estimated_length=1643
FT                   /gap_type="unknown"
FT   gene            12679991..12703469
FT                   /gene="Ywhab"
FT                   /locus_tag="mCG_5429"
FT                   /note="gene_id=mCG5429.2"
FT   mRNA            join(12679991..12680198,12696487..12696789,
FT                   12698891..12699014,12700116..12700279,12700988..12701083,
FT                   12701554..12703469)
FT                   /gene="Ywhab"
FT                   /locus_tag="mCG_5429"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, beta polypeptide,
FT                   transcript variant mCT4198"
FT                   /note="gene_id=mCG5429.2 transcript_id=mCT4198.2 created on
FT                   26-NOV-2002"
FT   mRNA            join(12680004..12680198,12696487..12696789,
FT                   12698894..12699014,12700116..12700279,12700988..12701083,
FT                   12701554..12702182)
FT                   /gene="Ywhab"
FT                   /locus_tag="mCG_5429"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, beta polypeptide,
FT                   transcript variant mCT176218"
FT                   /note="gene_id=mCG5429.2 transcript_id=mCT176218.0 created
FT                   on 26-NOV-2002"
FT   mRNA            join(<12680004..12680067,12696653..12696789,
FT                   12698891..12699014,12700116..12700279,12700988..12701083,
FT                   12701554..12702182)
FT                   /gene="Ywhab"
FT                   /locus_tag="mCG_5429"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, beta polypeptide,
FT                   transcript variant mCT176217"
FT                   /note="gene_id=mCG5429.2 transcript_id=mCT176217.0 created
FT                   on 26-NOV-2002"
FT   CDS             join(<12680004..12680067,12696653..12696789,
FT                   12698891..12699014,12700116..12700279,12700988..12701083,
FT                   12701554..12701610)
FT                   /codon_start=1
FT                   /gene="Ywhab"
FT                   /locus_tag="mCG_5429"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, beta polypeptide,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5429.2 transcript_id=mCT176217.0
FT                   protein_id=mCP99139.0 isoform=CRA_b"
FT                   /protein_id="EDL06358.1"
FT                   /translation="VQLPPPPPPPPIPEPGSRRPHRARRSSWRVISSIEQKTERNEKKQ
FT                   QMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASG
FT                   ENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKT
FT                   AFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN"
FT   CDS             join(12696490..12696789,12698891..12699014,
FT                   12700116..12700279,12700988..12701083,12701554..12701610)
FT                   /codon_start=1
FT                   /gene="Ywhab"
FT                   /locus_tag="mCG_5429"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, beta polypeptide,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG5429.2 transcript_id=mCT4198.2
FT                   protein_id=mCP5869.1 isoform=CRA_c"
FT                   /db_xref="GOA:A2A5N2"
FT                   /db_xref="InterPro:IPR000308"
FT                   /db_xref="InterPro:IPR023409"
FT                   /db_xref="InterPro:IPR023410"
FT                   /db_xref="MGI:MGI:1891917"
FT                   /db_xref="UniProtKB/TrEMBL:A2A5N2"
FT                   /protein_id="EDL06359.1"
FT                   /translation="MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNL
FT                   LSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLD
FT                   KYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQ
FT                   PTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQL
FT                   LRDNLTLWTSENQGDEGDAGEGEN"
FT   CDS             join(12696490..12696789,12698894..12699014,
FT                   12700116..12700279,12700988..12701083,12701554..12701610)
FT                   /codon_start=1
FT                   /gene="Ywhab"
FT                   /locus_tag="mCG_5429"
FT                   /product="tyrosine 3-monooxygenase/tryptophan
FT                   5-monooxygenase activation protein, beta polypeptide,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5429.2 transcript_id=mCT176218.0
FT                   protein_id=mCP99140.0 isoform=CRA_a"
FT                   /protein_id="EDL06357.1"
FT                   /translation="MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNL
FT                   LSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLLLDK
FT                   YLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQP
FT                   THPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLL
FT                   RDNLTLWTSENQGDEGDAGEGEN"
FT   gene            <12710362..12734895
FT                   /locus_tag="mCG_5434"
FT                   /note="gene_id=mCG5434.2"
FT   mRNA            join(<12710362..12710554,12712356..12712549,
FT                   12716020..12716135,12717001..12717140,12717309..12717403,
FT                   12720122..12720259,12721988..12722083,12727190..12727438,
FT                   12728423..12728513,12729152..12729253,12734222..12734356,
FT                   12734705..12734895)
FT                   /locus_tag="mCG_5434"
FT                   /product="mCG5434"
FT                   /note="gene_id=mCG5434.2 transcript_id=mCT4188.2 created on
FT                   26-NOV-2002"
FT   CDS             join(12710362..12710554,12712356..12712549,
FT                   12716020..12716135,12717001..12717140,12717309..12717403,
FT                   12720122..12720259,12721988..12722083,12727190..12727438,
FT                   12728423..12728513,12729152..12729253,12734222..12734356,
FT                   12734705..12734760)
FT                   /codon_start=1
FT                   /locus_tag="mCG_5434"
FT                   /product="mCG5434"
FT                   /note="gene_id=mCG5434.2 transcript_id=mCT4188.2
FT                   protein_id=mCP5921.2"
FT                   /protein_id="EDL06360.1"
FT                   /translation="MDTGGHGCSLSSLYVGDLHPDVTESMLYEMFSPIGNILSIRVCRD
FT                   VATRRSLGYAYINFQQPADAERALDTMNFEVIKGQPIRIMWSHRDPGLRKSGMGNIFIK
FT                   NLENSIDNKALYDTFSTFGSILSSKVVYNEHGSRGFGFVHFETHEAAQKAINTMNGMLL
FT                   NDRKVFVGHFKSRQKREAELGARALGFTNIYVKNLHANVDEQRLQDLFSQFGNMQSVKV
FT                   MRDSNGQSRGFGFVNFEKHEEAQKAVDHMNGKEVSGQLLYVGRAQKRAERQSELKRRFE
FT                   QMKQERQNRYQGVNLYVKNLDDSINDERLKEVFSTYGVITSAKVMTESSHSKGFGFVCF
FT                   SSPEEATKAVTEMNGRIVGTKPLYVALAQRKEERKAILTNQYRRRPSHPVLSSFQQPTS
FT                   YLLPAVPQSTAQAVYYSSGSITPMQPDPRWTAQPHGPPSASVVQPLSTTQHPCIHLSGA
FT                   SQVSSQVPHTQRVGERLYSLIHDACAPLTGKITGMLLELDNLELLLLLESPESLHAKAD
FT                   RRGGGSTAGASRNGVNR"
FT   assembly_gap    12714066..12714141
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    12718729..12718802
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    12732177..12732636
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   gene            complement(12738270..12755857)
FT                   /gene="Tomm34"
FT                   /locus_tag="mCG_5447"
FT                   /note="gene_id=mCG5447.2"
FT   mRNA            complement(join(12738270..12739236,12739430..12739556,
FT                   12743356..12743503,12745529..12745698,12749582..12749734,
FT                   12751260..12751359,12755604..12755857))
FT                   /gene="Tomm34"
FT                   /locus_tag="mCG_5447"
FT                   /product="translocase of outer mitochondrial membrane 34,
FT                   transcript variant mCT176221"
FT                   /note="gene_id=mCG5447.2 transcript_id=mCT176221.0 created
FT                   on 27-NOV-2002"
FT   mRNA            complement(join(12738270..12739236,12739430..12739556,
FT                   12743356..12743503,12745529..12745698,12749582..12749734,
FT                   12751260..12751359,12755158..12755795))
FT                   /gene="Tomm34"
FT                   /locus_tag="mCG_5447"
FT                   /product="translocase of outer mitochondrial membrane 34,
FT                   transcript variant mCT4172"
FT                   /note="gene_id=mCG5447.2 transcript_id=mCT4172.1 created on
FT                   27-NOV-2002"
FT   CDS             complement(join(12739132..12739236,12739430..12739556,
FT                   12743356..12743503,12745529..12745698,12749582..12749734,
FT                   12751260..12751359,12755604..12755730))
FT                   /codon_start=1
FT                   /gene="Tomm34"
FT                   /locus_tag="mCG_5447"
FT                   /product="translocase of outer mitochondrial membrane 34,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG5447.2 transcript_id=mCT176221.0
FT                   protein_id=mCP99143.0 isoform=CRA_a"
FT                   /protein_id="EDL06361.1"
FT                   /translation="MAPKVSDSVEQLRAAGNQNFRNGQYGEASALYERALRLLQARGSA
FT                   DPEEESVLYSNRAACYLKDGNCTDCIKDCTSALALVPFSIKPLLRRASAYEALEKYALA
FT                   YVDYKTVLQIDNSVASALEGINRITRALMDSLGPEWRLKLPPIPVVPVSAQKRWNSLPS
FT                   DNHKETAKTKSKEATATKSRVPSAGDVERAKALKEEGNDLVKKGNHKKAIEKYSESLLC
FT                   SSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSL
FT                   SDISSLLQIEPRNGPAQKLRQEVNQNMN"
FT   CDS             complement(join(12739132..12739236,12739430..12739556,
FT                   12743356..12743503,12745529..12745698,12749582..12749734,
FT                   12751260..12751359,12755158..12755284))
FT                   /codon_start=1
FT                   /gene="Tomm34"
FT                   /locus_tag="mCG_5447"
FT                   /product="translocase of outer mitochondrial membrane 34,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG5447.2 transcript_id=mCT4172.1
FT                   protein_id=mCP6000.1 isoform=CRA_b"
FT                   /protein_id="EDL06362.1"
FT                   /translation="MAPKLSDSVEELRAAGNQSFRNGQYAEASALYERALRLLQARGSA
FT                   DPEEESVLYSNRAACYLKDGNCTDCIKDCTSALALVPFSIKPLLRRASAYEALEKYALA
FT                   YVDYKTVLQIDNSVASALEGINRITRALMDSLGPEWRLKLPPIPVVPVSAQKRWNSLPS
FT                   DNHKETAKTKSKEATATKSRVPSAGDVERAKALKEEGNDLVKKGNHKKAIEKYSESLLC
FT                   SSLESATYSNRALCHLVLKQYKEAVKDCTEALKLDGKNVKAFYRRAQAYKALKDYKSSL
FT                   SDISSLLQIEPRNGPAQKLRQEVNQNMN"
FT   assembly_gap    12756767..12756786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12758998..12838685
FT                   /gene="Stk4"
FT                   /locus_tag="mCG_5442"
FT                   /note="gene_id=mCG5442.2"
FT   mRNA            join(12758998..12759085,12764328..12764408,
FT                   12768444..12768572,12771298..12771412,12773642..12773806,
FT                   12781539..12781706,12784208..12784345,12785466..12785594,
FT                   12786179..12786365,12803742..12803899,12837893..12838685)
FT                   /gene="Stk4"
FT                   /locus_tag="mCG_5442"
FT                   /product="serine/threonine kinase 4"
FT                   /note="gene_id=mCG5442.2 transcript_id=mCT4177.1 created on
FT                   27-NOV-2002"
FT   CDS             join(12759051..12759085,12764328..12764408,
FT                   12768444..12768572,12771298..12771412,12773642..12773806,
FT                   12781539..12781706,12784208..12784345,12785466..12785594,
FT                   12786179..12786365,12803742..12803899,12837893..12838051)
FT                   /codon_start=1
FT                   /gene="Stk4"
FT                   /locus_tag="mCG_5442"
FT                   /product="serine/threonine kinase 4"
FT                   /note="gene_id=mCG5442.2 transcript_id=mCT4177.1
FT                   protein_id=mCP5977.1"
FT                   /protein_id="EDL06363.1"
FT                   /translation="METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVY
FT                   KAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEY
FT                   CGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHA
FT                   KLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGITAIEMAEGKP
FT                   PYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFV
FT                   KSAKGVSILRDLINEAMDVKLKRQEAQQREVDQDDEENSEEDEMDSGTMVRAAGDEMGT
FT                   VRVASTMSGGANTMIEHGDTLPSQLGTMVINTEDEEEEGTMKRRDETMQPAKPSFLEYF
FT                   EQKEKENQINSFGKNVSGSLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQE
FT                   MEEIRQKYRSKRQPILDAIEAKKRRQQNF"
FT   assembly_gap    12782303..12782322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12811142..12811161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12821420..12821546
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            complement(12849897..12857314)
FT                   /gene="Kcns1"
FT                   /locus_tag="mCG_5436"
FT                   /note="gene_id=mCG5436.2"
FT   mRNA            complement(join(12849897..12851239,12854036..12855081,
FT                   12855302..12855483,12857251..12857314))
FT                   /gene="Kcns1"
FT                   /locus_tag="mCG_5436"
FT                   /product="K+ voltage-gated channel, subfamily S, 1"
FT                   /note="gene_id=mCG5436.2 transcript_id=mCT4184.1 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(12850772..12851239,12854036..12855061))
FT                   /codon_start=1
FT                   /gene="Kcns1"
FT                   /locus_tag="mCG_5436"
FT                   /product="K+ voltage-gated channel, subfamily S, 1"
FT                   /note="gene_id=mCG5436.2 transcript_id=mCT4184.1
FT                   protein_id=mCP5944.1"
FT                   /db_xref="GOA:O35173"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR003968"
FT                   /db_xref="InterPro:IPR003971"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="MGI:MGI:1197019"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35173"
FT                   /protein_id="EDL06364.1"
FT                   /translation="MVSEFPGPGSRVPWRPRDEALRVNVGGVRRLLSARALARFPGTRL
FT                   GRLQAAASEEQARRLCDDYDAAAHEFYFDRHPGFFLGLLHFYRTGHLHVLDELCVFAFG
FT                   QEADYWGLGENALATCCRARYLERRVARPRAWDEDSDAPSSVDPCPDEISDVQRELARY
FT                   GAARCGRLRRRLWLTMENPGYSLPSKLFSCVSIGVVLASIAAMCIHSLPEYQAREAAAA
FT                   VAAVAAGRSAEEVRDDPVLRRLEYFCIAWFSFEVSSRLLLAPSTRNFFCHPLNLIDIVS
FT                   VLPFYLTLLAGAALGDQRGASGEELGDLGKVVQVFRLMRIFRVLKLARHSTGLRSLGAT
FT                   LKHSYREVGILLLYLAVGVSVFSGVAYTAEEENEGFHTIPACWWWGTVSMTTVGYGDVV
FT                   PETVGGKLAASGCILGGILVVALPITIIFNKFSHFYRRQKALEAAVRSSGQREFEDLLS
FT                   SVDGVSDVSLETSRDTSQEGRSTDLETQAPREPAKSHSY"
FT   gene            complement(12863688..12868964)
FT                   /gene="Wfdc5"
FT                   /locus_tag="mCG_5454"
FT                   /note="gene_id=mCG5454.2"
FT   mRNA            complement(join(12863688..12864387,12864699..12864863,
FT                   12864958..12865101,12868791..12868964))
FT                   /gene="Wfdc5"
FT                   /locus_tag="mCG_5454"
FT                   /product="WAP four-disulfide core domain 5"
FT                   /note="gene_id=mCG5454.2 transcript_id=mCT4168.2 created on
FT                   02-DEC-2002"
FT   gene            <12863810..12881846
FT                   /locus_tag="mCG_141702"
FT                   /note="gene_id=mCG141702.0"
FT   mRNA            join(<12863810..12863886,12872480..12872546,
FT                   12876384..12876534,12881158..12881846)
FT                   /locus_tag="mCG_141702"
FT                   /product="mCG141702"
FT                   /note="gene_id=mCG141702.0 transcript_id=mCT176404.0
FT                   created on 02-DEC-2002"
FT   CDS             complement(join(12864712..12864863,12864958..12865101,
FT                   12868791..12868875))
FT                   /codon_start=1
FT                   /gene="Wfdc5"
FT                   /locus_tag="mCG_5454"
FT                   /product="WAP four-disulfide core domain 5"
FT                   /note="gene_id=mCG5454.2 transcript_id=mCT4168.2
FT                   protein_id=mCP5941.2"
FT                   /db_xref="GOA:Q4KXB6"
FT                   /db_xref="InterPro:IPR008197"
FT                   /db_xref="InterPro:IPR029714"
FT                   /db_xref="MGI:MGI:2384800"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KXB6"
FT                   /protein_id="EDL06365.1"
FT                   /translation="MRVQSSLLLVVLLALETHLPVALCRKKGDKLGGCPPDDGLCNQNT
FT                   PPDQCLNDKQCPSSWKCCRRACFLQCMPRVFVKSGKCPVDQLRCLSPTKHMCNKDSDCS
FT                   GKKRCCASACGRDCRDPSKSTI"
FT   CDS             join(<12872520..12872546,12876384..12876534,
FT                   12881158..12881219)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141702"
FT                   /product="mCG141702"
FT                   /note="gene_id=mCG141702.0 transcript_id=mCT176404.0
FT                   protein_id=mCP99326.0"
FT                   /protein_id="EDL06366.1"
FT                   /translation="PQCLRSQKKHAFEATLPEAAYLLISTVIVTVTLGIILPDAADVVG
FT                   RANSFLFIWWKKAQAPPPPSLLELSARLSSVLRA"
FT   gene            complement(12875468..>12876826)
FT                   /gene="Wfdc12"
FT                   /locus_tag="mCG_5443"
FT                   /note="gene_id=mCG5443.1"
FT   mRNA            complement(join(12875468..12875905,12876358..12876508,
FT                   12876660..>12876826))
FT                   /gene="Wfdc12"
FT                   /locus_tag="mCG_5443"
FT                   /product="WAP four-disulfide core domain 12"
FT                   /note="gene_id=mCG5443.1 transcript_id=mCT4178.1 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(12875881..12875905,12876358..12876508,
FT                   12876660..>12876825))
FT                   /codon_start=1
FT                   /gene="Wfdc12"
FT                   /locus_tag="mCG_5443"
FT                   /product="WAP four-disulfide core domain 12"
FT                   /note="gene_id=mCG5443.1 transcript_id=mCT4178.1
FT                   protein_id=mCP5893.1"
FT                   /protein_id="EDL06367.1"
FT                   /translation="HQHQPRHQHQHQPRHQHQHQPQSQPHSNMWPNSILVLMTLLISST
FT                   LVTGGGVKGEEKRVCPPDYVRCIRQDDPQCYSDNDCGDQEICCFWQCGFKCVLPVKDNS
FT                   EEQIPQSKV"
FT   gene            complement(12885086..>12886353)
FT                   /gene="1700049M11Rik"
FT                   /locus_tag="mCG_1028035"
FT                   /note="gene_id=mCG1028035.1"
FT   mRNA            complement(join(12885086..12885235,12885881..12886039,
FT                   12886175..>12886353))
FT                   /gene="1700049M11Rik"
FT                   /locus_tag="mCG_1028035"
FT                   /product="RIKEN cDNA 1700049M11"
FT                   /note="gene_id=mCG1028035.1 transcript_id=mCT145739.1
FT                   created on 02-DEC-2002"
FT   CDS             complement(join(12885882..12886039,12886175..>12886352))
FT                   /codon_start=1
FT                   /gene="1700049M11Rik"
FT                   /locus_tag="mCG_1028035"
FT                   /product="RIKEN cDNA 1700049M11"
FT                   /note="gene_id=mCG1028035.1 transcript_id=mCT145739.1
FT                   protein_id=mCP73062.0"
FT                   /protein_id="EDL06368.1"
FT                   /translation="LSFPAGYPRPSAAADSNVLPPCSQGSQSSREMKPSSLLLFTTTIL
FT                   LCLSMAQPRATRKGVTPKQGYCPEFLLDCPFVLLPVCSRDKGCKGTKKCCFYYCQMRCV
FT                   EPWTTLT"
FT   gene            complement(12900676..>12907882)
FT                   /gene="Wfdc15"
FT                   /locus_tag="mCG_5453"
FT                   /note="gene_id=mCG5453.1"
FT   mRNA            complement(join(12900676..12900816,12901336..12901493,
FT                   12901607..12901804,12907809..>12907882))
FT                   /gene="Wfdc15"
FT                   /locus_tag="mCG_5453"
FT                   /product="WAP four-disulfide core domain 15, transcript
FT                   variant mCT4167"
FT                   /note="gene_id=mCG5453.1 transcript_id=mCT4167.1 created on
FT                   02-DEC-2002"
FT   mRNA            complement(join(12900677..12900816,12901336..12901493,
FT                   12901607..12901772,12907809..>12907853))
FT                   /gene="Wfdc15"
FT                   /locus_tag="mCG_5453"
FT                   /product="WAP four-disulfide core domain 15, transcript
FT                   variant mCT176403"
FT                   /note="gene_id=mCG5453.1 transcript_id=mCT176403.0 created
FT                   on 02-DEC-2002"
FT   CDS             complement(join(12901336..12901493,12901607..>12901739))
FT                   /codon_start=1
FT                   /gene="Wfdc15"
FT                   /locus_tag="mCG_5453"
FT                   /product="WAP four-disulfide core domain 15, isoform CRA_a"
FT                   /note="gene_id=mCG5453.1 transcript_id=mCT176403.0
FT                   protein_id=mCP99325.0 isoform=CRA_a"
FT                   /protein_id="EDL06369.1"
FT                   /translation="HNHTWPPRSPAQFSWEMKLLGLSLLAVTILLCCNMARPEIKKKNV
FT                   FSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWESPE"
FT   CDS             complement(join(12901336..12901493,12901607..>12901739))
FT                   /codon_start=1
FT                   /gene="Wfdc15"
FT                   /locus_tag="mCG_5453"
FT                   /product="WAP four-disulfide core domain 15, isoform CRA_a"
FT                   /note="gene_id=mCG5453.1 transcript_id=mCT4167.1
FT                   protein_id=mCP5866.0 isoform=CRA_a"
FT                   /protein_id="EDL06370.1"
FT                   /translation="HNHTWPPRSPAQFSWEMKLLGLSLLAVTILLCCNMARPEIKKKNV
FT                   FSKPGYCPEYRVPCPFVLIPKCRRDKGCKDALKCCFFYCQMRCVDPWESPE"
FT   assembly_gap    12912269..12912711
FT                   /estimated_length=443
FT                   /gap_type="unknown"
FT   gene            complement(12922646..12924847)
FT                   /gene="Svs2"
FT                   /locus_tag="mCG_5433"
FT                   /note="gene_id=mCG5433.1"
FT   mRNA            complement(join(12922646..12922812,12923398..12924492,
FT                   12924751..12924847))
FT                   /gene="Svs2"
FT                   /locus_tag="mCG_5433"
FT                   /product="seminal vesicle protein, secretion 2"
FT                   /note="gene_id=mCG5433.1 transcript_id=mCT4192.1 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(12923438..12924492,12924751..12924823))
FT                   /codon_start=1
FT                   /gene="Svs2"
FT                   /locus_tag="mCG_5433"
FT                   /product="seminal vesicle protein, secretion 2"
FT                   /note="gene_id=mCG5433.1 transcript_id=mCT4192.1
FT                   protein_id=mCP5938.0"
FT                   /db_xref="GOA:Q8BS30"
FT                   /db_xref="InterPro:IPR002080"
FT                   /db_xref="InterPro:IPR018942"
FT                   /db_xref="MGI:MGI:1858275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BS30"
FT                   /protein_id="EDL06371.1"
FT                   /translation="MKSSVFVLSLLLILERQSAVVGQYGATKGHFQSSSSEGFMLGQKG
FT                   RLSFGIKGGSDEAAEESLFMQSQRRVYGQGGGDMTQTRVSQEHTSVKGAALCRNGQVSQ
FT                   LKSQESQIKSYGQVKSSGQLKSGGSAFGQVKSSVSQIKSYGQLKSGGQLKSGGPAFGQV
FT                   KSQESQIKSYGQLKSSGQLKSGGSAFGQVKSSVSQIKSYGQLKSGGSQVKSYGQTKSYG
FT                   EEGQLNSFSQLKSQGAQLKSYGQQKSQQQSSFSQVKSQSSQLKSYGQQKSLKGFSQQTQ
FT                   HKGFAMDEGMSQVRKQFSDDDLSVQQKSTQQMKTEEDLSQFGQQRQYGQERSQSYKGYL
FT                   EQYRKKVQEQQRKNFNPGNYFTKGGADLYQAQLKG"
FT   gene            complement(12940934..12943213)
FT                   /locus_tag="mCG_5438"
FT                   /note="gene_id=mCG5438.2"
FT   mRNA            complement(join(12940934..12941325,12942133..12942897,
FT                   12943120..12943213))
FT                   /locus_tag="mCG_5438"
FT                   /product="mCG5438"
FT                   /note="gene_id=mCG5438.2 transcript_id=mCT4186.2 created on
FT                   02-DEC-2002"
FT   CDS             complement(join(12942173..12942897,12943120..12943192))
FT                   /codon_start=1
FT                   /locus_tag="mCG_5438"
FT                   /product="mCG5438"
FT                   /note="gene_id=mCG5438.2 transcript_id=mCT4186.2
FT                   protein_id=mCP5911.1"
FT                   /db_xref="GOA:Q8VI13"
FT                   /db_xref="InterPro:IPR008836"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VI13"
FT                   /protein_id="EDL06372.1"
FT                   /translation="MKSIFFSLSLLLLLEKKAAGIELYAGGTKGHFLVKTSPLMFIGKN
FT                   QFLYGHKEEQEEAPEESIFVQTKHHAYGQDADADMGGALSSQELTSLKEDIVCEEEDEL
FT                   AQQKSQLPSQSQIKSQTQVKSYAAQLKSQPGQLKTIGQVKSQTMLKSHGAPLKSFKARL
FT                   NLREDIPQQVKGRGYGLAEDLAQVRQQPAKVHRLKGKHRQSRKTAAFYPQFRRRSRPYP
FT                   RYFVQFQEQLQGSVHHTKSFYPGPGMCYCPRGGVILYQDAFTD"
FT   gene            complement(12962501..>12964854)
FT                   /gene="Svp2"
FT                   /locus_tag="mCG_54524"
FT                   /note="gene_id=mCG54524.2"
FT   mRNA            complement(join(12962501..12962673,12963580..12963884,
FT                   12964756..>12964854))
FT                   /gene="Svp2"
FT                   /locus_tag="mCG_54524"
FT                   /product="seminal vesicle protein 2"
FT                   /note="gene_id=mCG54524.2 transcript_id=mCT54707.1 created
FT                   on 04-DEC-2002"
FT   CDS             complement(join(12963619..12963884,12964756..>12964852))
FT                   /codon_start=1
FT                   /gene="Svp2"
FT                   /locus_tag="mCG_54524"
FT                   /product="seminal vesicle protein 2"
FT                   /note="gene_id=mCG54524.2 transcript_id=mCT54707.1
FT                   protein_id=mCP28474.1"
FT                   /protein_id="EDL06373.1"
FT                   /translation="VKIFSGKMNSTSLFLFSLLLLLVTGAIGKKTKEKFLQSEETVRES
FT                   FSTGSRGHMSRSSEPEVFVRPQDSIGDEASEEMSSSSSSRRRSKIISSSSDGSNMEGES
FT                   SYSKRKKSRFSQDALE"
FT   gene            12975803..12978036
FT                   /locus_tag="mCG_117370"
FT                   /note="gene_id=mCG117370.2"
FT   mRNA            join(12975803..12975897,12976120..12976884,
FT                   12977696..12978025)
FT                   /locus_tag="mCG_117370"
FT                   /product="mCG117370, transcript variant mCT118507"
FT                   /note="gene_id=mCG117370.2 transcript_id=mCT118507.1
FT                   created on 04-DEC-2002"
FT   mRNA            join(<12975804..12975897,12976123..12976884,
FT                   12977696..12978036)
FT                   /locus_tag="mCG_117370"
FT                   /product="mCG117370, transcript variant mCT189887"
FT                   /note="gene_id=mCG117370.2 transcript_id=mCT189887.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<12975804..12975897,12976123..12976844)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117370"
FT                   /product="mCG117370, isoform CRA_a"
FT                   /note="gene_id=mCG117370.2 transcript_id=mCT189887.0
FT                   protein_id=mCP110901.0 isoform=CRA_a"
FT                   /protein_id="EDL06374.1"
FT                   /translation="VEALPGKMKSIFFSLSLLLLLEKKAAGIELYGGTKGHFLVKTSPL
FT                   MFIGKNQFLYGHKEEQEEAPEESIFVQTKHHAYGQDADADMGGALSSQELTSLKEDIVC
FT                   EEEDELAQQKSQLPSQSQIKSQTQVKSYAAQLKSQPGQLKTIGQVKSQTMLKSHGAPLK
FT                   SFKARLNLREDIPQQVKGRGYGLAEDLAQVRQQPAKVHRLKGKHRQSRKTAAFYPQFRR
FT                   RSRPYPRYFVQFQEQLQGSVHHTKSFYPGPGMCYCPRGGVILYQDAFTD"
FT   CDS             join(12975825..12975897,12976120..12976844)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117370"
FT                   /product="mCG117370, isoform CRA_b"
FT                   /note="gene_id=mCG117370.2 transcript_id=mCT118507.1
FT                   protein_id=mCP72698.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q8VI13"
FT                   /db_xref="InterPro:IPR008836"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VI13"
FT                   /protein_id="EDL06375.1"
FT                   /translation="MKSIFFSLSLLLLLEKKAAGIELYAGGTKGHFLVKTSPLMFIGKN
FT                   QFLYGHKEEQEEAPEESIFVQTKHHAYGQDADADMGGALSSQELTSLKEDIVCEEEDEL
FT                   AQQKSQLPSQSQIKSQTQVKSYAAQLKSQPGQLKTIGQVKSQTMLKSHGAPLKSFKARL
FT                   NLREDIPQQVKGRGYGLAEDLAQVRQQPAKVHRLKGKHRQSRKTAAFYPQFRRRSRPYP
FT                   RYFVQFQEQLQGSVHHTKSFYPGPGMCYCPRGGVILYQDAFTD"
FT   assembly_gap    12998777..12998796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13003365..13005070
FT                   /gene="Svs6"
FT                   /locus_tag="mCG_5432"
FT                   /note="gene_id=mCG5432.1"
FT   mRNA            join(13003365..13003462,13003925..13003971,
FT                   13004061..13004277,13004895..13005070)
FT                   /gene="Svs6"
FT                   /locus_tag="mCG_5432"
FT                   /product="seminal vesicle secretion 6"
FT                   /note="gene_id=mCG5432.1 transcript_id=mCT4191.1 created on
FT                   04-DEC-2002"
FT   CDS             join(13003387..13003462,13003925..13003971,
FT                   13004061..13004237)
FT                   /codon_start=1
FT                   /gene="Svs6"
FT                   /locus_tag="mCG_5432"
FT                   /product="seminal vesicle secretion 6"
FT                   /note="gene_id=mCG5432.1 transcript_id=mCT4191.1
FT                   protein_id=mCP5871.1"
FT                   /db_xref="InterPro:IPR020187"
FT                   /db_xref="MGI:MGI:106178"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D268"
FT                   /protein_id="EDL06376.1"
FT                   /translation="MSPTSFFLLTMLLVLVTETAAKRPRERFSQAIEEFSSESSEANSP
FT                   KSIVHEEVYEEKKFKRNMVNGEDGEDSKRASAGEIERSYLRKKEKQQFAQEMDK"
FT   assembly_gap    13015637..13015656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13020855..13022488
FT                   /gene="Svs5"
FT                   /locus_tag="mCG_5427"
FT                   /note="gene_id=mCG5427.2"
FT   mRNA            join(13020855..13020946,13021394..13021732,
FT                   13022318..13022488)
FT                   /gene="Svs5"
FT                   /locus_tag="mCG_5427"
FT                   /product="seminal vesicle secretion 5"
FT                   /note="gene_id=mCG5427.2 transcript_id=mCT4197.1 created on
FT                   04-DEC-2002"
FT   CDS             join(13020877..13020946,13021394..13021692)
FT                   /codon_start=1
FT                   /gene="Svs5"
FT                   /locus_tag="mCG_5427"
FT                   /product="seminal vesicle secretion 5"
FT                   /note="gene_id=mCG5427.2 transcript_id=mCT4197.1
FT                   protein_id=mCP5856.1"
FT                   /db_xref="MGI:MGI:98453"
FT                   /db_xref="UniProtKB/TrEMBL:Q545K7"
FT                   /protein_id="EDL06377.1"
FT                   /translation="MSPTSFFLLTLLLVLVTEARGARERFSQSAEDPSSSHMGIKIRAG
FT                   GSGSGSAMEEYSVSENSWSNFKSKHPSSISSESFHEESSSSSEMSSSGGHFGLKMRGSQ
FT                   AGGGMSSFKTRVKSRILK"
FT   gene            complement(13042157..13077248)
FT                   /gene="Slpi"
FT                   /locus_tag="mCG_5445"
FT                   /note="gene_id=mCG5445.2"
FT   mRNA            complement(join(13042157..13042400,13042963..13043112,
FT                   13043538..13043699,13044275..13044577,13076969..13077248))
FT                   /gene="Slpi"
FT                   /locus_tag="mCG_5445"
FT                   /product="secretory leukocyte peptidase inhibitor,
FT                   transcript variant mCT176402"
FT                   /note="gene_id=mCG5445.2 transcript_id=mCT176402.0 created
FT                   on 04-DEC-2002"
FT   mRNA            complement(join(13042158..13042400,13042963..13043112,
FT                   13043538..13043699,13044275..13044577,13047352..13047499,
FT                   13060777..13060859))
FT                   /gene="Slpi"
FT                   /locus_tag="mCG_5445"
FT                   /product="secretory leukocyte peptidase inhibitor,
FT                   transcript variant mCT4180"
FT                   /note="gene_id=mCG5445.2 transcript_id=mCT4180.2 created on
FT                   04-DEC-2002"
FT   CDS             complement(join(13042964..13043112,13043538..13043699,
FT                   13044275..13044359))
FT                   /codon_start=1
FT                   /gene="Slpi"
FT                   /locus_tag="mCG_5445"
FT                   /product="secretory leukocyte peptidase inhibitor, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5445.2 transcript_id=mCT176402.0
FT                   protein_id=mCP99324.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q548X8"
FT                   /db_xref="InterPro:IPR008197"
FT                   /db_xref="InterPro:IPR029712"
FT                   /db_xref="MGI:MGI:109297"
FT                   /db_xref="UniProtKB/TrEMBL:Q548X8"
FT                   /protein_id="EDL06378.1"
FT                   /translation="MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCL
FT                   KLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPN
FT                   VCQRDGQCDGKYKCCEGICGKVCLPPM"
FT   CDS             complement(join(13042964..13043112,13043538..13043699,
FT                   13044275..13044359))
FT                   /codon_start=1
FT                   /gene="Slpi"
FT                   /locus_tag="mCG_5445"
FT                   /product="secretory leukocyte peptidase inhibitor, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG5445.2 transcript_id=mCT4180.2
FT                   protein_id=mCP5997.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q548X8"
FT                   /db_xref="InterPro:IPR008197"
FT                   /db_xref="InterPro:IPR029712"
FT                   /db_xref="MGI:MGI:109297"
FT                   /db_xref="UniProtKB/TrEMBL:Q548X8"
FT                   /protein_id="EDL06379.1"
FT                   /translation="MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCL
FT                   KLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPN
FT                   VCQRDGQCDGKYKCCEGICGKVCLPPM"
FT   gene            complement(13077548..13095983)
FT                   /gene="Matn4"
FT                   /locus_tag="mCG_5439"
FT                   /note="gene_id=mCG5439.2"
FT   mRNA            complement(join(13077548..13077867,13077946..13078053,
FT                   13081005..13081157,13081259..13081672,13084887..13085009,
FT                   13085104..13085226,13085326..13085448,13090555..13090677,
FT                   13091351..13091920,13092665..13092785,13095314..13095437))
FT                   /gene="Matn4"
FT                   /locus_tag="mCG_5439"
FT                   /product="matrilin 4, transcript variant mCT4181"
FT                   /note="gene_id=mCG5439.2 transcript_id=mCT4181.2 created on
FT                   04-DEC-2002"
FT   mRNA            complement(join(13077552..13077867,13077946..13078053,
FT                   13081005..13081157,13081259..13081672,13084887..13085009,
FT                   13085104..13085226,13085326..13085448,13090555..13090677,
FT                   13091351..13091920,13092665..13092785,13095921..13095983))
FT                   /gene="Matn4"
FT                   /locus_tag="mCG_5439"
FT                   /product="matrilin 4, transcript variant mCT176401"
FT                   /note="gene_id=mCG5439.2 transcript_id=mCT176401.0 created
FT                   on 04-DEC-2002"
FT   CDS             complement(join(13077809..13077867,13077946..13078053,
FT                   13081005..13081157,13081259..13081672,13084887..13085009,
FT                   13085104..13085226,13085326..13085448,13090555..13090677,
FT                   13091351..13091920,13092665..13092743))
FT                   /codon_start=1
FT                   /gene="Matn4"
FT                   /locus_tag="mCG_5439"
FT                   /product="matrilin 4, isoform CRA_a"
FT                   /note="gene_id=mCG5439.2 transcript_id=mCT176401.0
FT                   protein_id=mCP99323.0 isoform=CRA_a"
FT                   /protein_id="EDL06380.1"
FT                   /translation="MRGPCCWPLSLLLLFLQSWETQLQSAGPRCYNGPLDLVFMIDSSR
FT                   SVRPFEFETMRQFLVGLLRSLDVGLNATRVGVIQYSSQVQSVFPLGAFSRREDMERAIR
FT                   AVVPLAQGTMTGLAIQYAMNVAFSEAEGARPSEERVPRVLVIVTDGRPQDRVAEVAAQA
FT                   RARGIEIYAVGVQRADVGSLRTMASPPLDQHVFLVESFDLIQEFGLQFQGRLCGKDLCA
FT                   ELVHGCQHLCVNAPGTFYCACNSGYKLAPDNKNCLALDLCAEGTHGCEHLCVNSVDSYF
FT                   CRCRAGFALQQDQRSCRAIDYCSFGNHSCQHECVSTLAGPQCRCREGHDLLPDGRSCRV
FT                   RDFCNGVDHGCEFQCVSEGLSFHCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSKSV
FT                   RPQNFELVKRFVNQIVDFLDVSPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAV
FT                   EYMERGTMTGLALRHMVEHSFSEAQGARPRDLNVPRVGLVFTDGRSQDDISVWAARAKE
FT                   EGIVMYAVGVGKAVEEELREIASEPSELHVSYSPDFSTMTHLLENLKGSICPEEGIGAG
FT                   TELRSPCECESLVEFQGRTLGALESLTQNLARLTERLEELENQLASRK"
FT   CDS             complement(join(13077809..13077867,13077946..13078053,
FT                   13081005..13081157,13081259..13081672,13084887..13085009,
FT                   13085104..13085226,13085326..13085448,13090555..13090677,
FT                   13091351..13091920,13092665..13092743))
FT                   /codon_start=1
FT                   /gene="Matn4"
FT                   /locus_tag="mCG_5439"
FT                   /product="matrilin 4, isoform CRA_a"
FT                   /note="gene_id=mCG5439.2 transcript_id=mCT4181.2
FT                   protein_id=mCP5961.2 isoform=CRA_a"
FT                   /protein_id="EDL06381.1"
FT                   /translation="MRGPCCWPLSLLLLFLQSWETQLQSAGPRCYNGPLDLVFMIDSSR
FT                   SVRPFEFETMRQFLVGLLRSLDVGLNATRVGVIQYSSQVQSVFPLGAFSRREDMERAIR
FT                   AVVPLAQGTMTGLAIQYAMNVAFSEAEGARPSEERVPRVLVIVTDGRPQDRVAEVAAQA
FT                   RARGIEIYAVGVQRADVGSLRTMASPPLDQHVFLVESFDLIQEFGLQFQGRLCGKDLCA
FT                   ELVHGCQHLCVNAPGTFYCACNSGYKLAPDNKNCLALDLCAEGTHGCEHLCVNSVDSYF
FT                   CRCRAGFALQQDQRSCRAIDYCSFGNHSCQHECVSTLAGPQCRCREGHDLLPDGRSCRV
FT                   RDFCNGVDHGCEFQCVSEGLSFHCLCPEGRRLQADGKSCDRCREGHVDLVLLVDGSKSV
FT                   RPQNFELVKRFVNQIVDFLDVSPEGTRVGLVQFSSRVRTEFPLGRYGTAAEVKQAVLAV
FT                   EYMERGTMTGLALRHMVEHSFSEAQGARPRDLNVPRVGLVFTDGRSQDDISVWAARAKE
FT                   EGIVMYAVGVGKAVEEELREIASEPSELHVSYSPDFSTMTHLLENLKGSICPEEGIGAG
FT                   TELRSPCECESLVEFQGRTLGALESLTQNLARLTERLEELENQLASRK"
FT   assembly_gap    13086709..13087902
FT                   /estimated_length=1194
FT                   /gap_type="unknown"
FT   assembly_gap    13089426..13089445
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13093963..13107244
FT                   /gene="Rbpsuhl"
FT                   /locus_tag="mCG_5430"
FT                   /note="gene_id=mCG5430.3"
FT   mRNA            join(<13093963..13094141,13095282..13095838,
FT                   13095959..13096702,13098555..13098625,13098808..13101224,
FT                   13101607..13101716,13101846..13101998,13105664..13105819,
FT                   13105972..13106075,13106166..13106587)
FT                   /gene="Rbpsuhl"
FT                   /locus_tag="mCG_5430"
FT                   /product="recombining binding protein suppressor of
FT                   hairless-like (Drosophila), transcript variant mCT189894"
FT                   /note="gene_id=mCG5430.3 transcript_id=mCT189894.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(13093966..13094141,13095282..13095384,
FT                   13096577..13096702,13098555..13098625,13098808..13098923,
FT                   13099191..13099365,13101087..13101224,13101607..13101716,
FT                   13101846..13101998,13105664..13105819,13105972..13106075,
FT                   13106166..13107244)
FT                   /gene="Rbpsuhl"
FT                   /locus_tag="mCG_5430"
FT                   /product="recombining binding protein suppressor of
FT                   hairless-like (Drosophila), transcript variant mCT4189"
FT                   /note="gene_id=mCG5430.3 transcript_id=mCT4189.2 created on
FT                   06-DEC-2002"
FT   CDS             join(13094120..13094141,13095282..13095384,
FT                   13096577..13096702,13098555..13098625,13098808..13098923,
FT                   13099191..13099365,13101087..13101224,13101607..13101716,
FT                   13101846..13101998,13105664..13105819,13105972..13106075,
FT                   13106166..13106439)
FT                   /codon_start=1
FT                   /gene="Rbpsuhl"
FT                   /locus_tag="mCG_5430"
FT                   /product="recombining binding protein suppressor of
FT                   hairless-like (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG5430.3 transcript_id=mCT4189.2
FT                   protein_id=mCP5934.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3V2I2"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015350"
FT                   /db_xref="InterPro:IPR015351"
FT                   /db_xref="MGI:MGI:1196616"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V2I2"
FT                   /protein_id="EDL06383.1"
FT                   /translation="MDPRETTDPSLPPGPLTHLSLPDSSEVRLQSDGPSLLGSWTRSPP
FT                   EHAIILREGVRTCLQQRCEQTVWILHAKVAQKSYGNEKRFFCPPPCVYLAGPGWRVKPM
FT                   QDQALQSAETGPTVCGYMGLDGASGSAPETQKLNFEEQPDSREFGCAKTLYISDADKRK
FT                   HFRLVLRLVLRGGQELGTFHSRLIKVISKPSQKKQSLKNTDLCISSGSKVSLFNRLRSQ
FT                   TVSTRYLSVEDGAFVASARQWAAFTLHLADGHCSQGDFPPQEGYIRYGSLVQLVCTVTG
FT                   ITLPPMIIRKVAKQCALLDVDEPISQLHKCAFQFPSDTPGGAGTYLCLATEKVVRFQAS
FT                   LCPKEANRALLNDSSCWTIIGTESVEFTFSTSLACTREPVTPVPLISTLELSGGGDVAT
FT                   LELHGENFHAGLKVWFGDVEAETMYRSPRSLVCVVPDVAAFGSDWRWLRTPITVPVSLL
FT                   RADALFYPSPFSFTYTPEYSALPRLPNAQEPAPDADTLLESIHHEFTRTNFHLFCPT"
FT   CDS             join(<13101068..13101224,13101607..13101716,
FT                   13101846..13101998,13105664..13105819,13105972..13106075,
FT                   13106166..13106439)
FT                   /codon_start=1
FT                   /gene="Rbpsuhl"
FT                   /locus_tag="mCG_5430"
FT                   /product="recombining binding protein suppressor of
FT                   hairless-like (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG5430.3 transcript_id=mCT189894.0
FT                   protein_id=mCP110895.0 isoform=CRA_a"
FT                   /protein_id="EDL06382.1"
FT                   /translation="FHVPLAVCISSGSKVSLFNRLRSQTVSTRYLSVEDGAFVASARQW
FT                   AAFTLHLADGHCSQGDFPPQEGYIRYGSLVQLVCTVTGITLPPMIIRKVAKQCALLDVD
FT                   EPISQLHKCAFQFPSDTPGGAGTYLCLATEKVVRFQASLCPKEANRALLNDSSCWTIIG
FT                   TESVEFTFSTSLACTREPVTPVPLISTLELSGGGDVATLELHGENFHAGLKVWFGDVEA
FT                   ETMYRSPRSLVCVVPDVAAFGSDWRWLRTPITVPVSLLRADALFYPSPFSFTYTPEYSA
FT                   LPRLPNAQEPAPDADTLLESIHHEFTRTNFHLFCPT"
FT   assembly_gap    13104229..13104248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13116035..13135675)
FT                   /gene="Sdc4"
FT                   /locus_tag="mCG_5428"
FT                   /note="gene_id=mCG5428.2"
FT   mRNA            complement(join(13116035..13118022,13120678..13120873,
FT                   13121465..13121511,13122972..13123098,13134878..13134976))
FT                   /gene="Sdc4"
FT                   /locus_tag="mCG_5428"
FT                   /product="syndecan 4, transcript variant mCT4193"
FT                   /note="gene_id=mCG5428.2 transcript_id=mCT4193.1 created on
FT                   06-DEC-2002"
FT   mRNA            complement(join(13117498..13118022,13120678..13120873,
FT                   13121465..13121511,13122972..13123098,13135587..13135675))
FT                   /gene="Sdc4"
FT                   /locus_tag="mCG_5428"
FT                   /product="syndecan 4, transcript variant mCT176400"
FT                   /note="gene_id=mCG5428.2 transcript_id=mCT176400.0 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(13117871..13118022,13120678..13120873,
FT                   13121465..13121511,13122972..13123098,13134878..13134952))
FT                   /codon_start=1
FT                   /gene="Sdc4"
FT                   /locus_tag="mCG_5428"
FT                   /product="syndecan 4, isoform CRA_b"
FT                   /note="gene_id=mCG5428.2 transcript_id=mCT4193.1
FT                   protein_id=mCP5910.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U5S6"
FT                   /db_xref="InterPro:IPR001050"
FT                   /db_xref="InterPro:IPR003585"
FT                   /db_xref="InterPro:IPR027789"
FT                   /db_xref="InterPro:IPR030479"
FT                   /db_xref="MGI:MGI:1349164"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U5S6"
FT                   /protein_id="EDL06385.1"
FT                   /translation="MAPACLLAPLLLLLLGGFPLVPGESIRETEVIDPQDLLEGRYFSG
FT                   ALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEP
FT                   KELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVF
FT                   LILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA"
FT   CDS             complement(join(13117871..13118022,13120678..13120750))
FT                   /codon_start=1
FT                   /gene="Sdc4"
FT                   /locus_tag="mCG_5428"
FT                   /product="syndecan 4, isoform CRA_a"
FT                   /note="gene_id=mCG5428.2 transcript_id=mCT176400.0
FT                   protein_id=mCP99322.0 isoform=CRA_a"
FT                   /protein_id="EDL06384.1"
FT                   /translation="MSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVFLILLLV
FT                   YRMKKKDEGSYDLGKKPIYKKAPTNEFYA"
FT   gene            13148757..13171316
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /note="gene_id=mCG5426.2"
FT   mRNA            join(13148757..13148810,13149649..13149777,
FT                   13152442..13152799,13152972..13153208,13154980..13155047,
FT                   13163816..13164000,13171232..13171316)
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /product="RIKEN cDNA 2610042O14, transcript variant
FT                   mCT176399"
FT                   /note="gene_id=mCG5426.2 transcript_id=mCT176399.0 created
FT                   on 14-JUN-2003"
FT   mRNA            join(13148757..13148810,13149649..13149777,
FT                   13152442..13152799,13152972..13153208,13154980..13155047,
FT                   13156037..13159005,13163816..13164000,13165319..13166139)
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /product="RIKEN cDNA 2610042O14, transcript variant
FT                   mCT4196"
FT                   /note="gene_id=mCG5426.2 transcript_id=mCT4196.2 created on
FT                   14-JUN-2003"
FT   mRNA            join(13148757..13148810,13149649..13149777,
FT                   13152442..13152799,13152972..13153208,13154980..13155047,
FT                   13156037..13156428,13158828..13159005,13163816..13164000,
FT                   13165319..13165820)
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /product="RIKEN cDNA 2610042O14, transcript variant
FT                   mCT176397"
FT                   /note="gene_id=mCG5426.2 transcript_id=mCT176397.1 created
FT                   on 14-JUN-2003"
FT   mRNA            join(13148866..13148903,13149649..13149777,
FT                   13152442..13152799,13152972..13153208,13154980..13155047,
FT                   13158826..13159005,13163816..13164000,13165319..13166142)
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /product="RIKEN cDNA 2610042O14, transcript variant
FT                   mCT176398"
FT                   /note="gene_id=mCG5426.2 transcript_id=mCT176398.1 created
FT                   on 14-JUN-2003"
FT   assembly_gap    13149170..13149319
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   CDS             join(13152444..13152799,13152972..13153011)
FT                   /codon_start=1
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /product="RIKEN cDNA 2610042O14, isoform CRA_b"
FT                   /note="gene_id=mCG5426.2 transcript_id=mCT176398.1
FT                   protein_id=mCP99319.1 isoform=CRA_b"
FT                   /protein_id="EDL06387.1"
FT                   /translation="MDLLDFKNLPLEGAQDPRFCASLPFAFILHLTHVQSLFPGCSQGP
FT                   LWMACRVHPLRLRNAPRLPSPEALPSQEAVGRSYSASLGRRVLRSMVLSVSAVSGGQCR
FT                   GPVALRRFDPRAGRGYPGGRGTMAWWH"
FT   CDS             join(13152444..13152799,13152972..13153011)
FT                   /codon_start=1
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /product="RIKEN cDNA 2610042O14, isoform CRA_b"
FT                   /note="gene_id=mCG5426.2 transcript_id=mCT176399.0
FT                   protein_id=mCP99320.1 isoform=CRA_b"
FT                   /protein_id="EDL06388.1"
FT                   /translation="MDLLDFKNLPLEGAQDPRFCASLPFAFILHLTHVQSLFPGCSQGP
FT                   LWMACRVHPLRLRNAPRLPSPEALPSQEAVGRSYSASLGRRVLRSMVLSVSAVSGGQCR
FT                   GPVALRRFDPRAGRGYPGGRGTMAWWH"
FT   CDS             join(13153047..13153208,13154980..13155047,
FT                   13156037..13156277)
FT                   /codon_start=1
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /product="RIKEN cDNA 2610042O14, isoform CRA_a"
FT                   /note="gene_id=mCG5426.2 transcript_id=mCT176397.1
FT                   protein_id=mCP99321.1 isoform=CRA_a"
FT                   /protein_id="EDL06386.1"
FT                   /translation="MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDALVRSSP
FT                   SLDQMFDAEILGFSTPPGRLSMMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLL
FT                   GCWLYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLSSAPKSNV"
FT   CDS             join(13153047..13153208,13154980..13155047,
FT                   13156037..13156277)
FT                   /codon_start=1
FT                   /gene="2610042O14Rik"
FT                   /locus_tag="mCG_5426"
FT                   /product="RIKEN cDNA 2610042O14, isoform CRA_a"
FT                   /note="gene_id=mCG5426.2 transcript_id=mCT4196.2
FT                   protein_id=mCP5888.1 isoform=CRA_a"
FT                   /protein_id="EDL06389.1"
FT                   /translation="MAGQFRSYVWDPLLILSQIVLMQTVYYGSLGLWLALVDALVRSSP
FT                   SLDQMFDAEILGFSTPPGRLSMMSFVLNALTCALGLLYFIRRGKQCLDFTVTVHFFHLL
FT                   GCWLYSSRFPSALTWWLVQAVCIALMAVIGEYLCMRTELKEIPLSSAPKSNV"
FT   gene            complement(13161979..13166151)
FT                   /locus_tag="mCG_17524"
FT                   /note="gene_id=mCG17524.2"
FT   mRNA            complement(join(13161979..13162096,13162690..13163177,
FT                   13164606..13164736,13164927..13165001,13165281..13166151))
FT                   /locus_tag="mCG_17524"
FT                   /product="mCG17524"
FT                   /note="gene_id=mCG17524.2 transcript_id=mCT12537.2 created
FT                   on 06-DEC-2002"
FT   CDS             complement(join(13162715..13163177,13164606..13164736,
FT                   13164927..13165001,13165281..13165520))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17524"
FT                   /product="mCG17524"
FT                   /note="gene_id=mCG17524.2 transcript_id=mCT12537.2
FT                   protein_id=mCP5877.2"
FT                   /protein_id="EDL06390.1"
FT                   /translation="MGVAFCPFTLYPWRHSPDAVAHFSDVTAPLPGSSSTILCYSAERC
FT                   SARSRVQAALVQSCSYSPSMSPSTKKRPRDKVPSKMQDEKLQDKITQHVSKVIERNRLK
FT                   MVLKNLSLLKLFKSSNSRIQELHKLARRCWNSMLRVPKILQISSRDKDKVKQNNIKFQE
FT                   IRVLEMRPNSKKAESVKEPKQKTSKKWKPKQGSKGSPAAVTWRKKQETFKISKVIKSGG
FT                   LQARAQKRKTYVKKPRVVFLKTYHHSTTMGKMKALDITDQLVWFEGLPTRIHIPGRRIM
FT                   CRSSTYRCLKRSCTRFCCASL"
FT   assembly_gap    13177191..13177210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13177815..13182970
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /note="gene_id=mCG17501.2"
FT   mRNA            join(<13177815..13177938,13179937..13180083,
FT                   13180263..13180400,13181831..13182462)
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, transcript variant mCT176387"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176387.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(<13177875..13177938,13179937..13180083,
FT                   13180263..13180400,13181831..13182030)
FT                   /codon_start=1
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, isoform CRA_e"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176387.0
FT                   protein_id=mCP99305.0 isoform=CRA_e"
FT                   /protein_id="EDL06395.1"
FT                   /translation="PCFPISHFLEKCARNRGQGDRGADMDPNPRAALERQQLRLRERQK
FT                   FFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVEFIDLADQDGADVFL
FT                   PCEESSPAPQMSGVDDHPEELSLLVPTSDRTTSRTSSLSSDSSNLRSPNPSDGGGDTPL
FT                   AQSDEEDGDDGGAEPGPCS"
FT   mRNA            join(<13178006..13178382,13179937..13180083,
FT                   13180263..13180400,13181831..13182239,13182339..13182969)
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, transcript variant mCT14064"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT14064.2 created
FT                   on 06-DEC-2002"
FT   CDS             join(<13178175..13178382,13179937..13180083,
FT                   13180263..13180400,13181831..13182030)
FT                   /codon_start=1
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, isoform CRA_a"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT14064.2
FT                   protein_id=mCP5863.1 isoform=CRA_a"
FT                   /protein_id="EDL06391.1"
FT                   /translation="RSCPPPPAPSARPAPTSASRLFLVPGSQGRRSPGNPAGLAPPGRR
FT                   CSLPRPRRRLSGAHPGSQRGAGAAGADMDPNPRAALERQQLRLRERQKFFEDILQPETE
FT                   FVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVEFIDLADQDGADVFLPCEESSPAPQM
FT                   SGVDDHPEELSLLVPTSDRTTSRTSSLSSDSSNLRSPNPSDGGGDTPLAQSDEEDGDDG
FT                   GAEPGPCS"
FT   mRNA            join(<13178248..13178382,13179937..13180083,
FT                   13180263..13180400,13181831..13182970)
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, transcript variant mCT176385"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176385.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(<13178250..13178382,13179937..13180083,
FT                   13180263..13180400,13181831..13182030)
FT                   /codon_start=1
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, isoform CRA_f"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176385.0
FT                   protein_id=mCP99309.0 isoform=CRA_f"
FT                   /protein_id="EDL06396.1"
FT                   /translation="GSQGRRSPGNPAGLAPPGRRCSLPRPRRRLSGAHPGSQRGAGAAG
FT                   ADMDPNPRAALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEV
FT                   NVDTLEQVEFIDLADQDGADVFLPCEESSPAPQMSGVDDHPEELSLLVPTSDRTTSRTS
FT                   SLSSDSSNLRSPNPSDGGGDTPLAQSDEEDGDDGGAEPGPCS"
FT   mRNA            join(<13178273..13178382,13179937..13180083,
FT                   13180263..13180400,13181771..13182152)
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, transcript variant mCT176384"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176384.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(<13178274..13178382,13179937..13180083,
FT                   13180263..13180400,13181771..13182030)
FT                   /codon_start=1
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, isoform CRA_c"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176384.0
FT                   protein_id=mCP99306.0 isoform=CRA_c"
FT                   /protein_id="EDL06393.1"
FT                   /translation="GNPAGLAPPGRRCSLPRPRRRLSGAHPGSQRGAGAAGADMDPNPR
FT                   AALERQQLRLRERQKFFEDILQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQV
FT                   EFIDLADQDGADVFLPCEESSPAPQMSDTYLSSLALCVAMTCSSVWAGVDDHPEELSLL
FT                   VPTSDRTTSRTSSLSSDSSNLRSPNPSDGGGDTPLAQSDEEDGDDGGAEPGPCS"
FT   mRNA            join(<13178314..13178382,13179984..13180083,
FT                   13180263..13180400,13181831..13182461)
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, transcript variant mCT176383"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176383.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(<13178314..13178382,13179984..13180083,
FT                   13180263..13180400,13181831..13182030)
FT                   /codon_start=1
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, isoform CRA_b"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176383.0
FT                   protein_id=mCP99308.0 isoform=CRA_b"
FT                   /protein_id="EDL06392.1"
FT                   /translation="RSHAPAAACRERTQGASGARALQLRLRERQKFFEDILQPETEFVF
FT                   PLSHLHLESQRPPIGSISSMEVNVDTLEQVEFIDLADQDGADVFLPCEESSPAPQMSGV
FT                   DDHPEELSLLVPTSDRTTSRTSSLSSDSSNLRSPNPSDGGGDTPLAQSDEEDGDDGGAE
FT                   PGPCS"
FT   mRNA            join(<13178571..13178699,13179937..13180083,
FT                   13180263..13180400,13181831..13182461)
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, transcript variant mCT176386"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176386.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(<13178651..13178699,13179937..13180083,
FT                   13180263..13180400,13181831..13182030)
FT                   /codon_start=1
FT                   /gene="Dbndd2"
FT                   /locus_tag="mCG_17501"
FT                   /product="dysbindin (dystrobrevin binding protein 1) domain
FT                   containing 2, isoform CRA_d"
FT                   /note="gene_id=mCG17501.2 transcript_id=mCT176386.0
FT                   protein_id=mCP99307.0 isoform=CRA_d"
FT                   /protein_id="EDL06394.1"
FT                   /translation="LWELAPQPPCGQSLQPGADMDPNPRAALERQQLRLRERQKFFEDI
FT                   LQPETEFVFPLSHLHLESQRPPIGSISSMEVNVDTLEQVEFIDLADQDGADVFLPCEES
FT                   SPAPQMSGVDDHPEELSLLVPTSDRTTSRTSSLSSDSSNLRSPNPSDGGGDTPLAQSDE
FT                   EDGDDGGAEPGPCS"
FT   gene            13189241..13199813
FT                   /gene="Pigt"
FT                   /locus_tag="mCG_17527"
FT                   /note="gene_id=mCG17527.1"
FT   mRNA            join(13189241..13189464,13189573..13189750,
FT                   13191502..13191629,13191898..13191998,13192139..13192225,
FT                   13192778..13192865,13192971..13193068,13193160..13193325,
FT                   13194188..13194388,13198093..13198258,13198360..13198443,
FT                   13198985..13199813)
FT                   /gene="Pigt"
FT                   /locus_tag="mCG_17527"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class T, transcript variant mCT12540"
FT                   /note="gene_id=mCG17527.1 transcript_id=mCT12540.2 created
FT                   on 06-DEC-2002"
FT   mRNA            join(13189245..13189464,13189573..13189750,
FT                   13191502..13191629,13191898..13191998,13192139..13192225,
FT                   13192778..13192865,13192971..13193068,13193160..13193325,
FT                   13194188..13194825)
FT                   /gene="Pigt"
FT                   /locus_tag="mCG_17527"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class T, transcript variant mCT176395"
FT                   /note="gene_id=mCG17527.1 transcript_id=mCT176395.0 created
FT                   on 06-DEC-2002"
FT   CDS             join(13189266..13189464,13189573..13189750,
FT                   13191502..13191629,13191898..13191998,13192139..13192225,
FT                   13192778..13192865,13192971..13193068,13193160..13193325,
FT                   13194188..13194486)
FT                   /codon_start=1
FT                   /gene="Pigt"
FT                   /locus_tag="mCG_17527"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class T, isoform CRA_a"
FT                   /note="gene_id=mCG17527.1 transcript_id=mCT176395.0
FT                   protein_id=mCP99317.0 isoform=CRA_a"
FT                   /protein_id="EDL06397.1"
FT                   /translation="MAAAMPLGLPLRLLVLLLVGRGCCGCAEGPRDSLREELVITPLPS
FT                   GDVAATFQFRTRWDSDLQREGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWG
FT                   PPFLQAPSGAELWVWFQDTVTDVDKSWRELSNVLSGIFCASLNFIDATNTVTPTASFKP
FT                   LGLANDTDDYFLRYAVLPREVVCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQ
FT                   AVHIRPICRNAHCTSISWELRQTLSVVFDAFITGQGKKDWSLFRMFSRTLTEACPLASQ
FT                   SLVYVDITGYSQDNETLEVSPPPTSTYQDVILGTRKTYAVYDLFDTAMINNSRNLNIQL
FT                   KWKRPPDNEALPVPFLHAQRYVSGYGLQKGELSTLLYNSHPYRAFPVLLLDVVPWYLRL
FT                   YVHTLTITSKGKENKPSEERPPPPHHPPTPPIHLSFRSSRLTSQQFPK"
FT   mRNA            join(<13189268..13189464,13189573..13189750,
FT                   13190197..13190286,13191502..13191629,13191898..13191998,
FT                   13192139..13192225,13192778..13192865,13192971..13193068,
FT                   13193160..13193325,13194188..13194388,13198093..13198258,
FT                   13198360..13198443,13198985..13199813)
FT                   /gene="Pigt"
FT                   /locus_tag="mCG_17527"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class T, transcript variant mCT189892"
FT                   /note="gene_id=mCG17527.1 transcript_id=mCT189892.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(13189278..13189464,13189573..13189750,
FT                   13191502..13191629,13191898..13191998,13192139..13192225,
FT                   13192778..13192865,13192971..13193068,13193160..13193325,
FT                   13194188..13194388,13198093..13198258,13198360..13198443,
FT                   13198985..13199237)
FT                   /codon_start=1
FT                   /gene="Pigt"
FT                   /locus_tag="mCG_17527"
FT                   /product="phosphatidylinositol glycan anchor biosynthesis,
FT                   class T, isoform CRA_c"
FT                   /note="gene_id=mCG17527.1 transcript_id=mCT12540.2
FT                   protein_id=mCP5883.2 isoform=CRA_c"
FT                   /protein_id="EDL06399.1"
FT                   /translation="MPLGLPLRLLVLLLVGRGCCGCAEGPRDSLREELVITPLPSGDVA
FT                   ATFQFRTRWDSDLQREGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFL
FT                   QAPSGAELWVWFQDTVTDVDKSWRELSNVLSGIFCASLNFIDATNTVTPTASFKPLGLA
FT                   NDTDDYFLRYAVLPREVVCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHI
FT                   RPICRNAHCTSISWELRQTLSVVFDAFITGQGKKDWSLFRMFSRTLTEACPLASQSLVY
FT                   VDITGYSQDNETLEVSPPPTSTYQDVILGTRKTYAVYDLFDTA