Dbfetch

ID   CH466551; SV 1; linear; genomic DNA; CON; MUS; 23686256 BP.
XX
AC   CH466551;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009748833 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-23686256
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-23686256
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; de5818382f7e1e9abf10421917071bff.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000210.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001403; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000007659; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016024; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016252; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016255; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016256; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016921; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016933; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017000; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017002; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017004; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017299; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017307; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017667; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017697; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017733; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017740; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017754; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017760; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017929; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017969; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000017999; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018326; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018459; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000019188; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027460; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027463; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027469; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027472; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027478; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027479; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027481; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027489; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027490; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027496; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027510; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027519; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027524; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027540; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027546; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027547; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027551; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027593; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027596; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027597; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027610; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027611; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027613; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027618; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027620; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027624; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027628; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027643; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027646; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027650; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027655; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027656; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027661; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027678; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032680; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032869; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035268; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035877; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037754; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038180; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038259; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038324; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038369; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038537; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038567; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039463; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039501; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039536; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039725; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039849; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040132; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040154; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040164; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042821; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043583; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046229; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048087; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050556; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052056; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054455; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056824; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062175; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067578; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067786; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074575; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074582; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074656; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074681; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074698; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000076434; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078935; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000101523; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016135; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026645; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026647; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026649; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026653; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026660; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026661; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026674; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026678; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026679; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026684; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026696; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026697; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026700; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026716; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026719; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026725; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026726; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026727; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026728; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026734; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026737; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026739; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026740; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026742; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026745; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026749; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026758; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026760; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026762; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026764; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026765; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026768; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026782; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026784; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026787; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026801; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026803; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026806; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026808; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026825; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026829; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026833; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026837; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026838; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026842; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026846; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026847; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026848; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026851; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026860; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026869; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026870; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026871; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026879; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026880; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026884; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026887; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026891; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026892; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026894; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026895; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026896; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026899; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026903; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026905; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026906; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026907; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026909; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026910; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026911; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026912; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026915; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026921; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026926; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026928; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026929; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026930; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026933; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026935; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026937; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026939; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026940; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026942; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026948; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026952; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026959; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026961; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026967; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026968; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026969; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0026972; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016118; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026611; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026613; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026615; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026619; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026626; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026627; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026640; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026644; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026645; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026650; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026662; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026663; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026666; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026682; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026685; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026691; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026692; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026693; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026700; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026703; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026705; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026706; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026708; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026715; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026724; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026726; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026728; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026731; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026734; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026748; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026750; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026753; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026767; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026769; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026772; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026774; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026791; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026795; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026799; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026803; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026804; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026808; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026812; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026813; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026814; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026817; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026827; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026836; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026837; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026838; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026846; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026847; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026851; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026854; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026858; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026859; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026861; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026862; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026865; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026870; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026872; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026873; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026874; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026876; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026877; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026878; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026879; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026882; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026888; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026893; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026895; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026896; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026897; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026900; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026902; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026904; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026906; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026907; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026909; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026915; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026919; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026926; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026928; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026934; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026935; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026936; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0026939; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016075; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026581; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026583; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026585; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026589; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026596; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026597; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026610; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026614; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026615; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026620; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026633; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026634; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026637; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026653; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026656; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026662; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026663; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026664; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026671; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026674; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026676; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026677; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026679; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026682; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026686; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026695; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026697; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026699; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026701; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026702; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026705; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026719; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026721; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026724; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026738; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026740; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026743; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026745; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026762; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026766; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026770; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026774; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026775; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026779; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026783; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026784; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026785; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026788; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026796; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026807; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026808; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026809; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026817; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026818; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026822; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026825; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026829; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026830; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026832; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026833; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026835; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026838; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026841; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026843; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026844; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026845; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026847; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026848; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026849; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026850; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026853; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026859; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026864; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026866; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026867; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026868; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026871; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026873; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026875; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026877; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026878; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026880; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026890; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026897; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026899; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026905; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026906; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026907; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0026910; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016073; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026620; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026622; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026624; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026628; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026635; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026636; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026649; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026653; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026654; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026659; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026672; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026673; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026676; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026691; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026694; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026700; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026701; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026702; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026709; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026712; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026714; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026715; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026717; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026720; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026724; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026733; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026735; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026737; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026740; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026757; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026759; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026762; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026776; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026778; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026781; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026783; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026800; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026804; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026808; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026812; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026813; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026817; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026821; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026822; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026823; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026826; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026835; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026845; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026846; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026847; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026855; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026856; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026860; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026863; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026867; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026868; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026870; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026871; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026874; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026879; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026881; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026882; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026883; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026885; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026886; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026887; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026888; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026891; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026897; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026902; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026904; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026905; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026906; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026909; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026911; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026913; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026915; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026916; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026918; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026924; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026928; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026935; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026937; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026943; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026944; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026945; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0026948; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015904; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026363; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026365; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026367; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026371; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026378; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026379; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026392; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026396; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026397; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026402; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026414; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026415; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026418; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026434; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026437; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026443; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026444; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026445; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026452; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026455; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026457; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026458; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026460; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026463; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026467; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026478; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026480; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026482; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026483; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026486; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026499; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026501; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026504; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026518; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026520; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026523; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026525; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026542; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026546; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026550; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026554; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026555; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026559; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026563; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026564; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026565; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026568; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026576; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026587; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026588; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026589; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026597; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026598; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026602; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026605; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026609; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026610; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026612; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026613; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026615; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026618; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026621; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026623; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026624; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026625; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026627; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026628; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026629; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026630; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026633; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026639; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026644; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026646; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026647; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026648; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026651; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026653; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026655; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026657; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026658; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026660; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026670; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026677; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026679; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026685; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026686; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026687; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026690; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016526; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027069; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027071; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027073; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027077; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027084; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027085; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027098; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027102; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027108; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027122; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027125; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027140; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027143; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027149; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027150; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027151; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027158; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027161; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027163; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027164; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027166; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027169; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027173; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027182; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027184; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027186; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027188; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027189; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027206; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027208; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027211; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027225; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027227; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027230; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027232; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027248; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027252; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027256; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027260; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027261; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027265; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027269; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027270; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027271; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027274; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027282; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027293; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027294; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027302; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027303; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027307; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027310; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027314; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027315; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027317; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027318; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027319; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027322; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027326; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027328; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027329; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027330; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027332; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027333; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027334; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027335; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027338; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027344; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027349; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027351; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027352; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027353; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027356; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027358; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027360; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027362; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027363; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027365; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027371; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027375; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027382; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027384; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027390; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027391; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027392; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027395; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015488; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025824; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025826; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025828; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025832; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025839; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025840; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025853; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025857; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025858; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025863; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025875; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025876; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025879; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025895; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025904; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025905; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025906; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025907; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025913; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025916; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025918; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025919; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025921; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025924; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025928; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025937; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025939; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025941; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025943; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025944; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025947; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025961; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025963; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025966; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025980; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025982; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025985; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0025987; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026003; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026007; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026011; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026015; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026016; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026020; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026023; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026024; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026025; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026028; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026036; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026046; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026047; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026055; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026056; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026060; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026063; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026067; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026068; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026070; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026071; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026073; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026076; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026079; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026081; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026082; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026083; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026085; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026086; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026087; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026088; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026091; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026097; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026104; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026105; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026106; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026109; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026111; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026113; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026115; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026116; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026118; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026124; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026128; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026136; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026138; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026144; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026145; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026146; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026149; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015877; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026341; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026343; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026345; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026349; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026356; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026357; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026370; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026374; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026375; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026380; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026393; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026394; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026397; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026411; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026414; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026420; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026421; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026422; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026429; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026432; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026434; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026435; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026437; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026440; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026444; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026453; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026455; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026457; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026459; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026460; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026463; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026476; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026478; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026481; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026495; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026497; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026500; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026502; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026519; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026523; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026527; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026531; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026532; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026536; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026540; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026541; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026542; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026545; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026554; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026564; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026565; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026566; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026574; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026575; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026579; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026582; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026586; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026587; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026589; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026590; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026592; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026595; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026598; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026600; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026601; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026602; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026604; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026605; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026606; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026607; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026610; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026616; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026621; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026623; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026624; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026625; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026628; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026630; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026632; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026634; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026635; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026637; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026647; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026654; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026656; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026662; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026663; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026664; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026667; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015978; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026477; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026479; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026481; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026485; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026492; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026493; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026506; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026510; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026511; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026516; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026528; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026529; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026532; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026548; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026551; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026557; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026558; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026559; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026560; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026566; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026569; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026571; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026572; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026574; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026577; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026581; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026590; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026592; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026594; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026596; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026597; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026600; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026614; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026616; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026619; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026633; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026635; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026638; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026640; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026657; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026661; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026665; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026669; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026670; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026674; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026678; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026679; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026680; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026683; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026692; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026702; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026703; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026704; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026712; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026713; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026717; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026720; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026724; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026725; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026727; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026728; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026731; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026736; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026738; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026739; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026740; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026742; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026743; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026744; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026745; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026748; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026754; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026759; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026761; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026762; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026763; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026766; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026768; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026770; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026772; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026773; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026775; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026781; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026785; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026792; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026794; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026800; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026801; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026802; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0026805; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015981; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026442; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026444; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026446; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026450; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026458; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026459; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026472; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026476; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026477; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026482; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026494; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026495; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026498; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026515; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026518; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026524; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026525; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026526; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026527; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026533; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026536; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026538; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026539; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026541; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026544; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026548; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026557; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026559; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026561; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026563; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026564; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026567; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026581; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026583; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026586; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026600; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026602; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026605; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026607; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026623; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026627; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026631; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026635; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026636; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026640; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026644; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026645; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026646; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026649; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026658; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026669; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026670; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026678; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026679; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026683; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026686; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026690; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026691; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026693; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026694; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026696; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026699; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026702; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026704; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026705; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026706; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026708; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026709; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026710; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026711; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026714; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026720; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026725; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026727; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026728; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026729; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026732; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026734; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026736; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026738; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026739; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026741; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026747; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026751; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026758; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026760; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026766; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026767; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0026771; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016050; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026581; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026583; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026585; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026589; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026596; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026597; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026610; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026614; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026615; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026620; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026633; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026634; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026637; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026653; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026656; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026662; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026663; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026664; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026665; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026671; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026674; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026676; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026677; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026679; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026682; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026686; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026695; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026697; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026699; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026701; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026702; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026705; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026717; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026719; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026722; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026736; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026738; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026741; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026743; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026760; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026764; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026768; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026772; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026773; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026777; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026781; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026782; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026783; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026786; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026794; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026804; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026805; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026806; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026814; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026815; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026819; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026822; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026826; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026827; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026829; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026830; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026833; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026837; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026839; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026840; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026841; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026843; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026844; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026845; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026846; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026849; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026855; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026860; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026862; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026863; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026864; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026867; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026869; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026871; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026873; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026874; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026876; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026882; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026886; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026893; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026895; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026901; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026902; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026903; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0026906; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016001; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026464; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026466; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026468; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026472; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026479; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026480; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026493; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026497; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026498; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026503; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026516; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026517; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026520; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026536; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026539; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026545; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026546; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026547; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026548; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026554; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026557; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026559; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026560; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026562; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026565; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026569; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026578; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026580; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026582; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026584; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026585; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026588; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026602; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026604; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026607; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026621; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026623; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026626; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026628; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026645; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026649; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026653; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026657; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026658; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026662; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026664; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026665; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026666; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026669; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026678; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026688; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026689; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026697; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026698; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026702; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026705; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026709; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026710; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026712; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026713; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026715; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026718; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026721; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026723; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026724; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026725; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026727; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026728; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026729; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026730; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026733; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026739; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026744; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026746; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026747; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026748; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026751; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026753; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026755; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026757; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026758; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026760; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026766; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026770; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026777; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026779; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026785; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026786; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026787; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0026790; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016573; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027124; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027126; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027128; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027132; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027140; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027141; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027154; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027158; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027159; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027164; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027176; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027177; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027180; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027196; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027199; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027205; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027206; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027207; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027208; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027214; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027217; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027219; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027220; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027222; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027225; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027229; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027238; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027240; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027242; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027244; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027245; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027248; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027262; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027264; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027267; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027281; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027283; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027286; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027288; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027304; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027308; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027312; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027316; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027317; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027321; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027325; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027326; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027327; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027330; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027340; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027349; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027350; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027351; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027359; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027360; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027364; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027367; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027371; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027372; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027374; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027375; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027378; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027381; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027383; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027385; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027386; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027387; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027389; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027390; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027391; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027392; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027395; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027401; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027406; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027408; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027409; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027410; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027413; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027415; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027417; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027419; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027420; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027422; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027428; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027432; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027439; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027441; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027447; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027448; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027449; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027452; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015275; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025558; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025560; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025562; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025566; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025573; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025574; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025587; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025591; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025592; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025597; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025609; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025610; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025613; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025629; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025632; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025638; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025639; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025640; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025641; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025647; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025650; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025652; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025653; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025655; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025658; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025662; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025671; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025673; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025675; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025677; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025678; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025681; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025695; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025697; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025700; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025714; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025716; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025719; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025721; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025737; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025741; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025745; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025749; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025750; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025754; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025758; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025759; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025760; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025763; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025773; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025782; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025783; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025784; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025792; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025793; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025797; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025800; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025804; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025805; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025807; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025808; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025811; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025816; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025818; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025819; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025820; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025822; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025823; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025824; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025825; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025828; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025834; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025839; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025841; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025842; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025843; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025846; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025848; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025850; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025852; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025853; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025855; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025861; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025865; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025872; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025874; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025880; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025881; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025882; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0025885; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015550; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025894; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025896; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025898; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025902; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025909; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025910; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025923; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025927; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025928; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025933; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025945; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025946; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025949; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025965; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025968; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025974; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025975; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025976; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025977; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025983; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025986; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025988; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025989; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025991; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025994; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0025998; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026007; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026009; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026011; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026013; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026014; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026017; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026031; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026033; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026036; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026050; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026052; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026055; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026057; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026073; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026077; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026081; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026085; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026086; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026090; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026094; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026095; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026096; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026099; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026108; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026119; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026120; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026128; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026129; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026133; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026136; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026140; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026141; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026143; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026144; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026147; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026152; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026154; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026155; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026156; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026158; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026159; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026160; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026161; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026164; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026170; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026175; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026177; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026178; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026179; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026182; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026184; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026186; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026188; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026189; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026191; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026197; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026201; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026208; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026210; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026216; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026217; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026218; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026221; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000000895; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000007803; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016396; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016399; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017144; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017153; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017443; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017841; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000017904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018143; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000018470; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028969; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028972; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000028983; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029024; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029030; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029061; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029147; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029158; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029172; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029179; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029186; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029196; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029208; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000030391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038532; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038824; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038860; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039007; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039961; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040833; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040872; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045196; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000045503; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047815; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048988; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000052927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054607; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059524; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059954; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062355; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063710; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064703; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073062; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073228; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073873; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075044; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088041; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088248; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088484; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088976; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089059; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000092576; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099069; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099078; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099126; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000099224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103074; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103084; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103085; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103092; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103093; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103096; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103135; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103136; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103137; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000103145; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109139; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109140; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109155; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109175; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109191; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109221; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109235; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109298; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109299; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109300; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109304; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109456; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109460; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109522; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109529; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109536; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109570; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109577; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109670; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109697; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109701; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109772; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109820; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109825; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109858; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109859; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109861; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109869; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000125366; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126182; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130411; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000132608; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146297; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150571; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151826; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164120; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164399; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166171; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173393; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176066; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190422; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000207917; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020442; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058259; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058266; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058271; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058280; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058305; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058308; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058324; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058335; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058344; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058363; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058413; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058422; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058431; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058493; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058506; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058515; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058517; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058525; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058553; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058574; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058588; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058598; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058603; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058610; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058638; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058712; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058720; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058757; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058763; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058777; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058799; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058865; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058876; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058893; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058952; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058964; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058972; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0058990; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059059; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059082; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059089; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059103; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059104; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059111; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059116; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059117; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059119; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059130; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059159; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059173; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059176; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059180; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059202; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059219; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059237; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059261; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059292; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059296; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059298; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059303; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059304; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059333; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059354; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059368; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059379; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059385; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059396; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059397; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059400; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059404; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059425; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059444; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059461; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059472; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059483; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059490; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059501; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059517; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059519; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059520; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059522; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059538; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059555; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059576; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059580; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059619; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059620; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059621; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0059629; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0020419; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058290; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058297; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058302; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058308; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058333; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058336; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058352; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058363; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058372; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058394; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058445; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058454; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058463; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058513; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058524; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058537; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058547; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058553; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058584; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058605; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058618; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058628; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058633; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058668; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058742; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058750; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058785; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058798; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058820; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058886; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058898; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058915; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058976; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058988; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0058996; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059014; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059083; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059106; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059113; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059128; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059129; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059136; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059141; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059142; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059144; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059155; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059185; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059199; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059202; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059206; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059228; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059245; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059263; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059287; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059318; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059322; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059324; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059329; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059359; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059382; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059396; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059407; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059413; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059424; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059425; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059428; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059432; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059454; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059474; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059491; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059502; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059513; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059520; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059531; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059543; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059551; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059553; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059554; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059556; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059571; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059588; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059609; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059613; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059652; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059653; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059654; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0059662; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0020377; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058227; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058234; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058239; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058245; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058270; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058273; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058289; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058309; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058331; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058381; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058393; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058402; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058452; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058463; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058476; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058485; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058487; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058524; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058545; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058558; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058568; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058573; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058580; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058608; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058683; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058691; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058727; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058733; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058743; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058766; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058831; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058843; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058860; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058921; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058933; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058941; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0058959; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059028; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059051; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059058; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059073; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059074; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059081; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059086; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059087; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059089; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059100; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059128; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059145; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059148; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059152; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059174; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059191; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059209; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059233; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059264; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059268; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059270; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059275; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059278; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059307; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059328; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059342; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059353; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059359; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059370; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059371; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059375; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059379; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059401; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059421; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059438; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059449; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059460; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059467; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059478; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059491; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059494; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059496; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059497; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059499; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059529; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059550; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059554; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059592; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059593; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059594; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0059602; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020367; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058224; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058231; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058236; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058242; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058267; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058270; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058286; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058297; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058306; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058328; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058378; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058390; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058399; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058448; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058459; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058472; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058481; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058483; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058520; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058541; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058555; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058565; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058570; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058577; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058605; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058677; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058685; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058721; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058734; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058822; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058834; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058851; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058913; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058925; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058933; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0058951; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059020; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059039; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059046; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059061; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059062; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059069; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059074; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059075; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059077; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059088; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059117; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059132; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059135; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059139; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059161; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059178; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059196; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059220; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059251; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059255; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059257; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059262; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059291; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059314; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059328; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059339; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059345; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059356; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059357; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059360; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059364; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059386; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059406; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059423; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059435; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059446; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059464; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059477; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059480; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059482; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059483; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059485; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059501; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059519; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059540; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059544; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059582; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059583; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059584; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0059592; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020191; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057918; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057925; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057930; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057936; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057964; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057980; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0057991; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058000; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058022; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058071; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058083; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058092; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058142; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058153; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058166; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058175; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058177; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058214; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058235; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058249; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058259; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058264; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058271; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058299; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058382; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058418; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058424; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058437; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058460; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058524; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058536; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058553; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058614; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058626; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058634; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058652; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058716; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058739; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058746; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058761; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058762; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058769; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058774; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058777; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058788; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058816; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058832; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058835; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058839; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058861; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058877; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058895; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058919; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058950; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058954; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058956; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058961; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058964; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0058993; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059013; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059027; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059038; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059044; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059055; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059056; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059059; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059063; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059085; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059104; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059121; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059132; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059143; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059150; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059161; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059174; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059177; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059179; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059180; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059182; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059210; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059231; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059235; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059273; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059274; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059275; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0059283; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020875; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058708; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058715; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058720; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058726; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058751; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058754; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058770; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058781; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058809; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058862; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058871; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058918; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058929; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058942; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058951; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058953; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0058991; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059011; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059024; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059034; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059039; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059046; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059074; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059149; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059157; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059193; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059199; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059213; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059297; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059309; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059326; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059387; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059399; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059407; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059425; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059493; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059516; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059523; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059536; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059537; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059544; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059551; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059553; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059564; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059592; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059609; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059613; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059635; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059650; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059668; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059692; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059723; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059727; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059729; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059734; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059736; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059765; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059786; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059800; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059811; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059817; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059828; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059829; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059832; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059836; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059858; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059877; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059894; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059905; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059917; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059924; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059935; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059948; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059951; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059953; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059954; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059956; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059971; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0059989; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060009; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060013; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060051; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060052; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060053; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0060061; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019704; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058183; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058190; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058195; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058201; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058226; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058230; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058246; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058257; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058266; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058288; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058338; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058351; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058360; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058410; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058432; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058442; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058445; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058449; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058476; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058498; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058512; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058522; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058527; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058534; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058562; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058639; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058647; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058683; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058689; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058703; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058725; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058787; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058798; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058817; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058879; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058891; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058900; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058919; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0058988; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059011; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059018; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059034; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059035; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059042; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059046; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059047; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059049; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059060; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059088; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059104; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059108; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059130; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059147; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059167; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059193; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059224; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059228; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059230; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059235; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059238; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059266; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059290; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059304; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059315; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059322; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059333; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059334; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059337; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059341; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059362; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059383; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059410; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059421; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059428; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059441; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059454; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059457; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059459; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059461; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059463; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059479; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059494; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059517; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059521; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059559; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059560; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059561; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0059570; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0020152; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057888; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057895; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057900; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057906; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057931; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057934; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057950; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057961; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057970; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0057989; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058040; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058052; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058061; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058107; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058118; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058131; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058140; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058142; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058180; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058201; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058215; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058225; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058230; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058237; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058265; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058340; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058348; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058383; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058389; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058402; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058425; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058488; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058500; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058517; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058578; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058590; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058598; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058616; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058686; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058709; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058716; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058731; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058732; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058739; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058744; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058745; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058747; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058758; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058787; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058802; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058805; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058809; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058831; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058848; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058866; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058890; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058921; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058925; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058927; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058932; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058935; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058964; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058984; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0058998; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059009; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059015; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059026; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059027; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059030; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059034; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059056; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059076; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059093; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059105; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059116; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059123; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059134; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059147; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059150; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059152; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059153; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059155; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059205; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059209; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059247; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059248; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059249; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0059257; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0020264; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0057989; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0057996; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058001; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058007; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058032; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058035; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058051; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058062; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058071; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058093; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058143; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058155; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058164; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058214; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058225; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058238; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058247; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058249; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058259; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058286; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058307; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058320; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058330; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058335; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058342; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058370; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058445; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058453; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058489; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058495; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058505; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058528; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058593; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058605; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058622; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058683; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058695; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058703; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058721; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058790; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058813; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058820; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058835; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058836; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058843; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058848; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058849; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058851; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058862; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058892; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058907; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058910; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058914; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058936; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058952; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058970; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0058992; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059023; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059029; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059034; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059063; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059087; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059101; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059112; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059118; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059129; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059130; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059133; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059137; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059159; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059179; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059196; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059207; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059218; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059225; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059236; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059249; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059252; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059254; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059255; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059257; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059273; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059291; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059313; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059317; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059355; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059356; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059357; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0059365; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0020276; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0057969; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0057976; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0057981; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0057987; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058013; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058016; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058032; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058043; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058052; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058074; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058123; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058136; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058145; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058196; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058207; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058220; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058230; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058235; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058239; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058266; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058286; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058300; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058310; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058315; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058322; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058350; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058425; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058433; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058469; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058475; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058489; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058511; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058578; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058590; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058607; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058668; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058680; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058688; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058706; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058772; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058795; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058802; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058817; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058818; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058825; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058830; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058831; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058833; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058844; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058874; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058891; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058895; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058917; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058933; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058951; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0058973; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059006; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059010; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059012; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059017; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059020; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059049; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059069; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059083; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059094; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059100; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059111; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059112; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059115; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059119; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059140; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059159; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059176; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059187; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059196; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059203; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059214; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059227; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059230; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059232; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059233; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059235; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059251; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059269; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059290; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059294; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059332; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059333; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0059342; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0020346; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058113; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058120; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058125; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058134; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058160; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058163; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058179; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058190; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058199; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058221; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058272; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058285; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058294; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058344; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058355; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058367; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058376; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058378; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058385; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058412; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058433; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058447; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058457; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058462; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058469; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058497; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058571; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058579; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058616; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058622; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058636; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058658; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058706; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058718; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058735; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058796; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058808; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058816; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058834; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058903; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058926; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058933; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058948; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058949; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058956; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058961; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058962; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058964; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0058975; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059002; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059017; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059020; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059024; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059046; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059063; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059081; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059105; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059136; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059140; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059142; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059147; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059176; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059197; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059211; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059222; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059228; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059239; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059240; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059244; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059248; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059269; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059288; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059305; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059316; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059327; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059334; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059345; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059358; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059361; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059363; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059364; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059366; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059383; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059398; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059419; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059423; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059462; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059463; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059464; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0059472; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020241; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057939; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057946; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057951; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057960; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057985; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0057988; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058004; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058015; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058024; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058046; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058098; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058107; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058116; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058166; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058177; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058191; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058200; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058202; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058212; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058240; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058261; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058275; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058285; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058290; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058297; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058325; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058408; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058444; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058450; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058464; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058486; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058554; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058565; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058582; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058643; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058655; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058662; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058680; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058750; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058774; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058781; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058796; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058797; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058804; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058807; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058808; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058810; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058821; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058852; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058868; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058872; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058894; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058911; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058929; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058953; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058984; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058988; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058990; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058995; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0058998; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059027; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059047; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059072; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059078; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059089; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059090; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059093; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059097; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059119; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059139; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059156; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059167; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059178; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059185; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059196; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059209; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059217; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059219; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059220; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059222; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059238; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059256; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059277; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059281; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059319; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059320; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059321; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0059329; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020926; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058869; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058876; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058881; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058887; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058913; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058916; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058932; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058943; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058952; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0058974; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059023; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059036; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059045; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059095; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059106; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059119; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059128; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059130; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059165; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059185; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059199; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059209; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059214; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059221; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059249; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059324; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059332; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059368; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059374; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059388; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059410; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059478; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059489; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059506; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059567; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059579; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059587; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059605; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059673; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059696; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059703; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059718; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059719; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059726; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059731; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059732; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059734; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059745; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059776; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059790; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059793; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059797; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059819; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059836; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059853; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059875; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059906; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059910; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059912; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059917; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059946; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059965; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059970; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059984; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0059995; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060001; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060012; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060014; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060017; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060021; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060043; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060063; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060080; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060091; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060102; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060109; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060120; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060133; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060136; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060138; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060139; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060141; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060157; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060172; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060193; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060197; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060235; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060236; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060237; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0060245; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019458; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057757; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057764; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057769; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057778; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057804; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057808; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057824; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057835; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057844; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057866; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057917; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057922; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057931; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057979; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0057990; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058002; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058012; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058015; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058019; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058046; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058067; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058080; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058090; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058095; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058102; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058130; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058205; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058213; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058248; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058254; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058268; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058290; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058356; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058367; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058386; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058449; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058459; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058468; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058487; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058553; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058576; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058583; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058599; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058600; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058607; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058612; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058613; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058615; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058626; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058656; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058670; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058673; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058677; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058699; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058715; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058735; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058760; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058791; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058795; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058797; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058802; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058831; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058857; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058871; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058882; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058889; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058900; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058901; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058904; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058908; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058929; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058951; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058968; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058979; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058990; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0058997; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059009; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059024; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059032; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059034; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059036; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059038; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059054; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059069; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059090; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059094; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059130; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059131; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059132; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0059140; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019782; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057205; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057212; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057217; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057223; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057248; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057251; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057267; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057278; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057287; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057309; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057358; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057365; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057374; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057424; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057435; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057448; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057457; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057459; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057466; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057493; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057514; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057528; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057538; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057543; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057550; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057578; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057652; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057660; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057696; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057702; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057716; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057738; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057803; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057815; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057832; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057892; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057904; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057912; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057930; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0057994; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058017; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058024; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058038; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058039; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058046; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058051; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058052; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058054; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058065; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058094; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058111; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058115; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058137; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058155; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058174; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058196; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058227; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058231; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058233; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058238; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058267; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058291; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058305; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058316; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058322; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058333; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058334; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058337; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058341; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058363; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058383; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058400; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058411; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058422; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058429; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058440; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058452; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058455; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058457; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058458; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058460; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058475; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058489; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058510; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058514; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058549; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058550; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058551; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0058559; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..23686256
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            complement(364..>6981)
FT                   /locus_tag="mCG_140679"
FT                   /note="gene_id=mCG140679.0"
FT   mRNA            complement(join(364..519,6897..>6981))
FT                   /locus_tag="mCG_140679"
FT                   /product="mCG140679"
FT                   /note="gene_id=mCG140679.0 transcript_id=mCT170651.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(494..519,6897..>6981))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140679"
FT                   /product="mCG140679"
FT                   /note="gene_id=mCG140679.0 transcript_id=mCT170651.0
FT                   protein_id=mCP93569.0"
FT                   /protein_id="EDL05907.1"
FT                   /translation="VGSAAACSWRTPLDPGAVSSSGLLFQMKSNIECDRI"
FT   assembly_gap    13001..13020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25521..25540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            31204..32563
FT                   /pseudo
FT                   /locus_tag="mCG_118794"
FT                   /note="gene_id=mCG118794.0"
FT   mRNA            31204..32563
FT                   /pseudo
FT                   /locus_tag="mCG_118794"
FT                   /note="gene_id=mCG118794.0 transcript_id=mCT119955.0
FT                   created on 16-JUL-2002"
FT   assembly_gap    35044..40203
FT                   /estimated_length=5160
FT                   /gap_type="unknown"
FT   assembly_gap    41838..42789
FT                   /estimated_length=952
FT                   /gap_type="unknown"
FT   gene            complement(42850..>66583)
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /note="gene_id=mCG118798.0"
FT   mRNA            complement(join(42850..43072,44812..46106,66124..>66583))
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /product="RIKEN cDNA 4921509C19, transcript variant
FT                   mCT119959"
FT                   /note="gene_id=mCG118798.0 transcript_id=mCT119959.0
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(42992..43072,44812..46106,48295..48457))
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /product="RIKEN cDNA 4921509C19, transcript variant
FT                   mCT170652"
FT                   /note="gene_id=mCG118798.0 transcript_id=mCT170652.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(42995..43072,44812..46106,66124..66583))
FT                   /codon_start=1
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /product="RIKEN cDNA 4921509C19, isoform CRA_a"
FT                   /note="gene_id=mCG118798.0 transcript_id=mCT119959.0
FT                   protein_id=mCP73239.0 isoform=CRA_a"
FT                   /protein_id="EDL05908.1"
FT                   /translation="MRPGPGRAQPRRDDCALRPRRDRRADAALRIPQPVRSGPPRGATC
FT                   RSQPADSRKKRALSSSVPVTATNSLNASCRSSAIFAPCTSQTAPADTATARTPGLRSAR
FT                   RSTASSRWAPARRLRPMRCHRKSPPCGKPSRLAPSGGPYVSLTLMAEVEGVVAIDHKPT
FT                   DLSVKMKRWQACQDLRSNTFEDAALTEHYEILTTLGQGTFGEVKLASHLVTQTKVAIKI
FT                   LPKSRKNSLVQPEIEIMKSLDHPHIIKLLHIIDTTRNIFIVLEHAVGGELMSRIEEFGY
FT                   LAEVECHRLFKQLVYALQYCHEKGIVHRDLKPENILLDHRGNVKLTDFGLGTKIIMGQK
FT                   LVTFCGTLPYCAPELFEDRGYDGRATDVWSLGVVLYFMATGCLPFNGYSYEAIKQKIIA
FT                   GKYPRSFSLSPELWEVIAKLLTVNPGERPTVHDIARFKWLKPDNEASPASLGENIESHP
FT                   DPSIMVLMGVMGYNPGEIRESLREKKFDQVMATYLMLKQQSAWENKTTKKPDPRLCDRM
FT                   LRSTEPTIKNQTAVRRASSVPTHSTFSLPNESESLEKGKRTTMSHSMPPTRNCFNEETT
FT                   PLHSICPQLPETEQGECRECPSCAHKQDRVGMNS"
FT   CDS             complement(join(42995..43072,44812..46062))
FT                   /codon_start=1
FT                   /gene="4921509C19Rik"
FT                   /locus_tag="mCG_118798"
FT                   /product="RIKEN cDNA 4921509C19, isoform CRA_b"
FT                   /note="gene_id=mCG118798.0 transcript_id=mCT170652.0
FT                   protein_id=mCP93570.0 isoform=CRA_b"
FT                   /protein_id="EDL05909.1"
FT                   /translation="MKRWQACQDLRSNTFEDAALTEHYEILTTLGQGTFGEVKLASHLV
FT                   TQTKVAIKILPKSRKNSLVQPEIEIMKSLDHPHIIKLLHIIDTTRNIFIVLEHAVGGEL
FT                   MSRIEEFGYLAEVECHRLFKQLVYALQYCHEKGIVHRDLKPENILLDHRGNVKLTDFGL
FT                   GTKIIMGQKLVTFCGTLPYCAPELFEDRGYDGRATDVWSLGVVLYFMATGCLPFNGYSY
FT                   EAIKQKIIAGKYPRSFSLSPELWEVIAKLLTVNPGERPTVHDIARFKWLKPDNEASPAS
FT                   LGENIESHPDPSIMVLMGVMGYNPGEIRESLREKKFDQVMATYLMLKQQSAWENKTTKK
FT                   PDPRLCDRMLRSTEPTIKNQTAVRRASSVPTHSTFSLPNESESLEKGKRTTMSHSMPPT
FT                   RNCFNEETTPLHSICPQLPETEQGECRECPSCAHKQDRVGMNS"
FT   assembly_gap    64620..65097
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   gene            <66226..83345
FT                   /locus_tag="mCG_13192"
FT                   /note="gene_id=mCG13192.2"
FT   mRNA            join(<66226..66452,68624..68721,72755..72829,75054..75219,
FT                   76151..76243,77393..77502,78287..78424,81549..81713,
FT                   82947..83344)
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, transcript variant mCT14102"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT14102.1 created
FT                   on 16-JUL-2002"
FT   CDS             join(<66228..66452,68624..68721,72755..72829,75054..75219,
FT                   76151..76243,77393..77502,78287..78424,81549..81713,
FT                   82947..83109)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, isoform CRA_a"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT14102.1
FT                   protein_id=mCP9958.1 isoform=CRA_a"
FT                   /protein_id="EDL05910.1"
FT                   /translation="RSLRAGAQRLDAVERRAERRPGVRAVAVSAGAVWEVHGAKMAEER
FT                   QDALREFVAVTGTEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRG
FT                   TAPSDNRVTSFRDLIHDQDEEEEEEEGQRFYAGGSERSGQQIVGPPRKKSPNELVDDLF
FT                   KGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAAPEEESAYVAGERRRHSGQDVHV
FT                   VLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVPAELRRLAHGGQVNLDMEDHRDE
FT                   DFVKPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAENEAKASSSILINEAEPTTNIQI
FT                   RLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSFVLMTTFPNKELADENQTLKEAN
FT                   LLNAVIVQRLT"
FT   mRNA            join(<66351..66452,68624..68721,72755..72829,75054..75463)
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, transcript variant mCT170671"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT170671.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(<66351..66452,68624..68721,72755..72829,75054..75360)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, isoform CRA_c"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT170671.0
FT                   protein_id=mCP93588.0 isoform=CRA_c"
FT                   /protein_id="EDL05912.1"
FT                   /translation="AEERQDALREFVAVTGTEEDRARFFLESAGWDLQIALASFYEDGG
FT                   DEDIVTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDEEEEEEEGQRFYAGGSERSGQQ
FT                   IVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRVSIRVVVAKRIEFHSG
FT                   EGSLLLSSRDWLLCFFTWLFVLLCRRLMCL"
FT   mRNA            join(<74364..74500,75054..75219,76151..76243,77393..77502,
FT                   78287..78424,81549..81713,82947..83345)
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, transcript variant mCT170670"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT170670.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(<74391..74500,75054..75219,76151..76243,77393..77502,
FT                   78287..78424,81549..81713,82947..83109)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13192"
FT                   /product="mCG13192, isoform CRA_b"
FT                   /note="gene_id=mCG13192.2 transcript_id=mCT170670.0
FT                   protein_id=mCP93589.0 isoform=CRA_b"
FT                   /protein_id="EDL05911.1"
FT                   /translation="VLGELWCGVSQPHTYIALLALLHTSADLNLDSDLRSRFYAGGSER
FT                   SGQQIVGPPRKKSPNELVDDLFKGAKEHGAVAVERVTKSPGETSKPRPFAGGGYRLGAA
FT                   PEEESAYVAGERRRHSGQDVHVVLKLWKTGFSLDNGDLRSYQDPSNAQFLESIRRGEVP
FT                   AELRRLAHGGQVNLDMEDHRDEDFVKPKGAFKAFTGEGQKLGSTAPQVLNTSSPAQQAE
FT                   NEAKASSSILINEAEPTTNIQIRLADGGRLVQKFNHSHRISDIRLFIVDARPAMAATSF
FT                   VLMTTFPNKELADENQTLKEANLLNAVIVQRLT"
FT   assembly_gap    104455..104504
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    108291..108409
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   gene            114635..133744
FT                   /locus_tag="mCG_13187"
FT                   /note="gene_id=mCG13187.2"
FT   mRNA            join(114635..114816,114890..114937,129499..129611,
FT                   131511..131673,132675..133744)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT14097"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT14097.2 created
FT                   on 16-JUL-2002"
FT   mRNA            join(114670..114816,114890..114937,129499..129611,
FT                   131511..131669,132675..132987)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT170666"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170666.0 created
FT                   on 16-JUL-2002"
FT   mRNA            join(114727..114816,114890..114937,129499..129611,
FT                   131511..131845)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT170663"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170663.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(114780..114816,114890..114937,129499..129611,
FT                   131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_a"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT14097.2
FT                   protein_id=mCP9969.1 isoform=CRA_a"
FT                   /protein_id="EDL05913.1"
FT                   /translation="MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNK
FT                   PFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVEL
FT                   LKLE"
FT   CDS             join(114780..114816,114890..114937,129499..129611,
FT                   131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_a"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170663.0
FT                   protein_id=mCP93583.0 isoform=CRA_a"
FT                   /protein_id="EDL05914.1"
FT                   /translation="MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNK
FT                   PFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVEL
FT                   LKLE"
FT   CDS             join(114780..114816,114890..114937,129499..129611,
FT                   131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_a"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170666.0
FT                   protein_id=mCP93584.0 isoform=CRA_a"
FT                   /protein_id="EDL05917.1"
FT                   /translation="MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNK
FT                   PFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISSDYAYGATGHPGIIPPHATLVFDVEL
FT                   LKLE"
FT   assembly_gap    115784..115883
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   mRNA            join(116225..116253,129499..129611,131511..131673,
FT                   132675..132881)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT170665"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170665.0 created
FT                   on 16-JUL-2002"
FT   mRNA            join(117561..117628,129499..129611,131511..131673,
FT                   132675..133235)
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, transcript variant mCT170664"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170664.0 created
FT                   on 16-JUL-2002"
FT   CDS             join(129501..129611,131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_b"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170665.0
FT                   protein_id=mCP93582.0 isoform=CRA_b"
FT                   /protein_id="EDL05915.1"
FT                   /translation="MLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAK
FT                   LIISSDYAYGATGHPGIIPPHATLVFDVELLKLE"
FT   CDS             join(129501..129611,131511..131639)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13187"
FT                   /product="mCG13187, isoform CRA_b"
FT                   /note="gene_id=mCG13187.2 transcript_id=mCT170664.0
FT                   protein_id=mCP93581.0 isoform=CRA_b"
FT                   /protein_id="EDL05916.1"
FT                   /translation="MLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAK
FT                   LIISSDYAYGATGHPGIIPPHATLVFDVELLKLE"
FT   assembly_gap    131424..131443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    143270..143537
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   gene            <144632..161880
FT                   /gene="Sdcbp2"
FT                   /locus_tag="mCG_140682"
FT                   /note="gene_id=mCG140682.0"
FT   mRNA            join(<144632..144680,154607..154679,155848..155917,
FT                   156723..156823,158207..158365,158947..159122,
FT                   159202..159373,161085..161176,161413..161880)
FT                   /gene="Sdcbp2"
FT                   /locus_tag="mCG_140682"
FT                   /product="syndecan binding protein (syntenin) 2"
FT                   /note="gene_id=mCG140682.0 transcript_id=mCT170667.0
FT                   created on 16-JUL-2002"
FT   CDS             join(<144634..144680,154607..154679,155848..155917,
FT                   156723..156823,158207..158365,158947..159122,
FT                   159202..159373,161085..161176,161413..161467)
FT                   /codon_start=1
FT                   /gene="Sdcbp2"
FT                   /locus_tag="mCG_140682"
FT                   /product="syndecan binding protein (syntenin) 2"
FT                   /note="gene_id=mCG140682.0 transcript_id=mCT170667.0
FT                   protein_id=mCP93585.0"
FT                   /protein_id="EDL05918.1"
FT                   /translation="RRLQWLEKRTACGASSVFPEAAMSVLYPSLEDLKVGQVIQAQGRA
FT                   SPTMPTLPAPMASAPPLSELYPNLAELESYMGLSLSSQEVQKNLTQIPDSDNMVVTSPG
FT                   PGQVVAPVSGNNLGILRAEIKPGVREIHLCKDERGKTGLRLQAVDKGLFVQLVQANTPA
FT                   SLVGLRFGDQILQIDGCDCAGWNTHKAHKVLKKASAEKIVMVIRDRPFQRTVTMHKDSS
FT                   GQVGFSIKKGKIVSVVKGSSAARNGLLTNHYVCEVNGQNVIGLKDKKVTEILTTAGDVI
FT                   TLTIIPTVIYEHMIKRLSPLLLHHTMDHSIPDT"
FT   assembly_gap    151011..151179
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    157991..158010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(162437..>204357)
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /note="gene_id=mCG13188.3"
FT   mRNA            complement(join(162437..166479,168989..169138,
FT                   172858..172954,203931..204037,204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT170669"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT170669.1 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(162437..166479,168989..169138,
FT                   172137..172244,172858..172954,203931..204037,
FT                   204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT14098"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT14098.3 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(162437..166479,168989..169138,
FT                   172137..172343,172858..172954,203931..204037,
FT                   204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT178301"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT178301.1 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(162442..166479,168989..169138,
FT                   172137..172244,172858..172954,173478..173511,
FT                   174261..174288,203931..204037,204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT170668"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT170668.1 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(165300..166479,168989..169138,
FT                   172858..172954,203931..204037,204239..>204357))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_d"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT170669.1
FT                   protein_id=mCP93587.1 isoform=CRA_d"
FT                   /protein_id="EDL05922.1"
FT                   /translation="PLPPRSPSPSKHPLATFSWGSGEQSGCPPGGSPNHGSLRRLLITA
FT                   RRLLQRLQRRCAKRRGSRASRPDCGGRVDPAPGTPPIPPLTRTRSLMAMSLQGSRRASA
FT                   GSRRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEID
FT                   DLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIRQLKQVIDTVKNNLIDKDKGLQKYF
FT                   VDINIQNKKLETLLHSMEVAQNGVAKEEGTGESAGGSPARSLTRSSTYTKLSDPAVCGD
FT                   RQPGDPSNTSAEDGADSGYVAADDTLSRTDALEASSLLSSGVDCGLEEASLHSSFNLGP
FT                   RFPASNTYEKLLCGMEAGVQVSCMQERAIQTDFVQYQPDLNTILEKVGQAQVCGSVLKD
FT                   RHSELDPHPSGPRDPDSAVVVTVGDELEAPEPITCGPATHRPAVNSNPGLPVSVVCPVE
FT                   EEEEEAAAATTTEKEPKSYWSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSL
FT                   LRGCCTVALHSIRRISCRSLGQPSSSTAGGSQL"
FT   CDS             complement(join(165300..166479,168989..169138,
FT                   172137..172244,172858..172954,203931..204037,
FT                   204239..>204357))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_e"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT14098.3
FT                   protein_id=mCP9955.2 isoform=CRA_e"
FT                   /protein_id="EDL05923.1"
FT                   /translation="PLPPRSPSPSKHPLATFSWGSGEQSGCPPGGSPNHGSLRRLLITA
FT                   RRLLQRLQRRCAKRRGSRASRPDCGGRVDPAPGTPPIPPLTRTRSLMAMSLQGSRRASA
FT                   GSRRRTSPPVSVRDAYGTSSLSSSSNSGSCKGSDSSPTPRRSMKYTLCSDNHGIKPPTP
FT                   EQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEA
FT                   QLALKEARKEIRQLKQVIDTVKNNLIDKDKGLQKYFVDINIQNKKLETLLHSMEVAQNG
FT                   VAKEEGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQPGDPSNTSAEDGADSGYVAAD
FT                   DTLSRTDALEASSLLSSGVDCGLEEASLHSSFNLGPRFPASNTYEKLLCGMEAGVQVSC
FT                   MQERAIQTDFVQYQPDLNTILEKVGQAQVCGSVLKDRHSELDPHPSGPRDPDSAVVVTV
FT                   GDELEAPEPITCGPATHRPAVNSNPGLPVSVVCPVEEEEEEAAAATTTEKEPKSYWSRH
FT                   YIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRGCCTVALHSIRRISCRSLGQP
FT                   SSSTAGGSQL"
FT   CDS             complement(join(165300..166479,168989..169138,
FT                   172137..172343,172858..172954,203931..204037,
FT                   204239..>204357))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_b"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT178301.1
FT                   protein_id=mCP101223.1 isoform=CRA_b"
FT                   /protein_id="EDL05920.1"
FT                   /translation="PLPPRSPSPSKHPLATFSWGSGEQSGCPPGGSPNHGSLRRLLITA
FT                   RRLLQRLQRRCAKRRGSRASRPDCGGRVDPAPGTPPIPPLTRTRSLMAMSLQGSRRASA
FT                   GSRSGGTLGRSGLAVFAQCPQVPASQNEQRPLLPASRRTSPPVSVRDAYGTSSLSSSSN
FT                   SGSCKGSDSSPTPRRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQD
FT                   RLQDRDTEIDDLKTQLSRMQEDWIEEECHRVEAQLALKEARKEIRQLKQVIDTVKNNLI
FT                   DKDKGLQKYFVDINIQNKKLETLLHSMEVAQNGVAKEEGTGESAGGSPARSLTRSSTYT
FT                   KLSDPAVCGDRQPGDPSNTSAEDGADSGYVAADDTLSRTDALEASSLLSSGVDCGLEEA
FT                   SLHSSFNLGPRFPASNTYEKLLCGMEAGVQVSCMQERAIQTDFVQYQPDLNTILEKVGQ
FT                   AQVCGSVLKDRHSELDPHPSGPRDPDSAVVVTVGDELEAPEPITCGPATHRPAVNSNPG
FT                   LPVSVVCPVEEEEEEAAAATTTEKEPKSYWSRHYIVDLLAVVVPAVPTVAWLCRSQRRQ
FT                   GQPIYNISSLLRGCCTVALHSIRRISCRSLGQPSSSTAGGSQL"
FT   CDS             complement(join(165300..166479,168989..169138,
FT                   172137..172244,172858..172954,173478..173511,
FT                   174261..174288,203931..204037,204239..>204355))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_a"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT170668.1
FT                   protein_id=mCP93586.1 isoform=CRA_a"
FT                   /protein_id="EDL05919.1"
FT                   /translation="SPSPQPQPQQAPASHLQLGLGRAIRLPSWGQPKPWKPSQVADHRQ
FT                   AAAAATAEALRQAARESCEPAGLRRASGPRAVGRNQWRDPGSPEPRANWEAPGTPPIPP
FT                   LTRTRSLMAMSLQGSRRASAGSRRRTSPPVSVRDAYGTSSLSSSSNSGSCKGSDSSPTP
FT                   RRSMKYTLCSDNHGIKPPTPEQYLTPLQQKEVCIRHLKARLKDTQDRLQDRDTEIDDLK
FT                   TQLSRMQEDWIEEECHRVEAQLALKEARKEIRQLKQVIDTVKNNLIDKDKGLQKYFVDI
FT                   NIQNKKLETLLHSMEVAQNGVAKEEGTGESAGGSPARSLTRSSTYTKLSDPAVCGDRQP
FT                   GDPSNTSAEDGADSGYVAADDTLSRTDALEASSLLSSGVDCGLEEASLHSSFNLGPRFP
FT                   ASNTYEKLLCGMEAGVQVSCMQERAIQTDFVQYQPDLNTILEKVGQAQVCGSVLKDRHS
FT                   ELDPHPSGPRDPDSAVVVTVGDELEAPEPITCGPATHRPAVNSNPGLPVSVVCPVEEEE
FT                   EEAAAATTTEKEPKSYWSRHYIVDLLAVVVPAVPTVAWLCRSQRRQGQPIYNISSLLRG
FT                   CCTVALHSIRRISCRSLGQPSSSTAGGSQL"
FT   assembly_gap    190372..190391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(193045..194792,203931..204037,
FT                   204239..>204357))
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, transcript variant mCT185861"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT185861.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(join(194725..194792,203931..204037,
FT                   204239..>204357))
FT                   /codon_start=1
FT                   /gene="Snph"
FT                   /locus_tag="mCG_13188"
FT                   /product="syntaphilin, isoform CRA_c"
FT                   /note="gene_id=mCG13188.3 transcript_id=mCT185861.0
FT                   protein_id=mCP107119.0 isoform=CRA_c"
FT                   /protein_id="EDL05921.1"
FT                   /translation="PLPPRSPSPSKHPLATFSWGSGEQSGCPPGGSPNHGSLRRLLITA
FT                   RRLLQRLQRRCAKRRGSRASRPDCGGRVDPEETCAHPFFTPQLSPGLIKGSS"
FT   assembly_gap    212363..212634
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   gene            complement(<217186..>240352)
FT                   /locus_tag="mCG_13186"
FT                   /note="gene_id=mCG13186.2"
FT   mRNA            complement(join(<217186..217374,225250..225374,
FT                   226393..226489,226903..227129,239723..239854,
FT                   240209..>240352))
FT                   /locus_tag="mCG_13186"
FT                   /product="mCG13186"
FT                   /note="gene_id=mCG13186.2 transcript_id=mCT14096.2 created
FT                   on 16-JUL-2002"
FT   CDS             complement(join(217186..217374,225250..225374,
FT                   226393..226489,226903..227129,239723..>239747))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13186"
FT                   /product="mCG13186"
FT                   /note="gene_id=mCG13186.2 transcript_id=mCT14096.2
FT                   protein_id=mCP9952.2"
FT                   /protein_id="EDL05924.1"
FT                   /translation="DEDDISPRYIADRRRRKKRRLLVDPVKEISSKAMHRQLASFMDTL
FT                   MVLDLAPPTQRLMMWKKRGGVDMLLSTATQDLINDELKMLFTKCFLSSDYKLAKLTLKE
FT                   SVRKEVGNQQIAEPSVMGEPNSHSELDQPQDWKDVTDESVGSFQENVNMNVNSEEFNKM
FT                   GMQSFSLKKLCRNSDRKQAAAKFYTLLILKKHRAIELSQSVPYADIIATVGPMFYKM"
FT   assembly_gap    231703..231722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(252394..>257938)
FT                   /locus_tag="mCG_140681"
FT                   /note="gene_id=mCG140681.0"
FT   mRNA            complement(join(252394..252893,257783..>257938))
FT                   /locus_tag="mCG_140681"
FT                   /product="mCG140681"
FT                   /note="gene_id=mCG140681.0 transcript_id=mCT170662.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(252663..252893,257783..>257917))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140681"
FT                   /product="mCG140681"
FT                   /note="gene_id=mCG140681.0 transcript_id=mCT170662.0
FT                   protein_id=mCP93580.0"
FT                   /protein_id="EDL05925.1"
FT                   /translation="LYKSKVPRACNQVIAKDSIKDTEMEMPGEPAASLGQTLEWLREEL
FT                   AEMQIQDQKLLLTLRHLHSLLEELRAESTHWQDTRPSRNTSPFRARLGSEGRACQPVPR
FT                   QLTELLRGEKSRRSSLP"
FT   assembly_gap    268934..269477
FT                   /estimated_length=544
FT                   /gap_type="unknown"
FT   assembly_gap    270664..270683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <273556..283704
FT                   /locus_tag="mCG_50094"
FT                   /note="gene_id=mCG50094.2"
FT   mRNA            join(<273556..273994,277871..278861)
FT                   /locus_tag="mCG_50094"
FT                   /product="mCG50094, transcript variant mCT50277"
FT                   /note="gene_id=mCG50094.2 transcript_id=mCT50277.2 created
FT                   on 16-JUL-2002"
FT   CDS             join(<273856..273994,277871..278610)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50094"
FT                   /product="mCG50094, isoform CRA_b"
FT                   /note="gene_id=mCG50094.2 transcript_id=mCT50277.2
FT                   protein_id=mCP32039.2 isoform=CRA_b"
FT                   /protein_id="EDL05927.1"
FT                   /translation="LSRRPRPPRAELDRRRSRILRSRPALSLPSRSPPAADAVQPGAAR
FT                   AAAKGPRDELGSFFPMASPPGLELKTLSNGPQVPRRAASQGPVAPPRMGVENACFFSEE
FT                   QETHFQNPGDARLGNAPSPPGGVPSLSRSQRDDLSLHSEEGPGLEPVSRPVDYGFVSAL
FT                   VFLVSGILLVVTAYAIPREARVNPDTVTAREMERLEMYYARLGSHLDKCIIAGLGLLTV
FT                   GGMLLSVLLMVSLCKGELYRRQTFVPGRGSRKTYGSINLRMRQLTGDGGQVLVENEVVQ
FT                   VSETSYTTQGS"
FT   mRNA            join(<278512..278610,283179..283704)
FT                   /locus_tag="mCG_50094"
FT                   /product="mCG50094, transcript variant mCT170672"
FT                   /note="gene_id=mCG50094.2 transcript_id=mCT170672.0 created
FT                   on 16-JUL-2002"
FT   assembly_gap    281497..281724
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   CDS             <283361..283567
FT                   /codon_start=1
FT                   /locus_tag="mCG_50094"
FT                   /product="mCG50094, isoform CRA_a"
FT                   /note="gene_id=mCG50094.2 transcript_id=mCT170672.0
FT                   protein_id=mCP93590.0 isoform=CRA_a"
FT                   /protein_id="EDL05926.1"
FT                   /translation="SPGLKGKQKMKRDSPILLAQRNRDGKRRQLPCQPLPGRCGIWVSP
FT                   DARASDIQQTLSPLLSFLLTSFT"
FT   gene            complement(287359..>315657)
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /note="gene_id=mCG13177.1"
FT   mRNA            complement(join(287359..290230,291030..291188,
FT                   292368..292421,301036..301221,305767..305849,
FT                   307023..307175,312560..312703,315552..>315657))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT11752"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT11752.2 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(289546..290230,291030..291188,
FT                   292368..292896,295347..>295436))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT170658"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170658.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(289685..>290161)
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170658.0
FT                   protein_id=mCP93574.0 isoform=CRA_c"
FT                   /protein_id="EDL05930.1"
FT                   /translation="QLSLPFTLQELPPLAPSASVFLWAWGRGFCPCVCRPAGVASPALV
FT                   RAEVPAAAPHQAAYRSHGEISVSQSPAPPHLQGRLRQHQPSTRCSRGHSAIRTERILDV
FT                   IIKNQMSIQNTCCQSSTLLFVNAQTLKSVILHRTTGFLQGILLKHPRVTSYSCS"
FT   mRNA            complement(join(289802..290230,291030..291188,
FT                   292368..292421,301036..301221,305767..305849,
FT                   307023..307175,312560..312806))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT173573"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT173573.0 created
FT                   on 25-SEP-2002"
FT   mRNA            complement(join(290129..290230,291030..291188,
FT                   292368..292421,301036..>301437))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT170656"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170656.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(290179..290230,291030..291188,
FT                   292368..292421,301036..301221,305767..305849,
FT                   307023..307175,312560..312703,315552..>315650))
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT11752.2
FT                   protein_id=mCP9963.2 isoform=CRA_a"
FT                   /protein_id="EDL05928.1"
FT                   /translation="SGAPGRPGKPLPPAPCLSFSQNSQGQLGPLLMKKPQTSMAGLEVL
FT                   FASAAPSMSCPQDALVCFLHWEVVTNGYYALGTGDQPGPSDKKSELLPAKWNSNKELYA
FT                   LRYESKDGARKLLLKAVSVENGMIINVLELGTQQVADLTLNLDDYIDAEDLSDFHRTYK
FT                   NSEELRSQIRSGIITPIHEQWEKARANSPPREFPPATAREVDPLQISSHRPHTSRQPAW
FT                   RDPLSPFAVGGDDLDPFGCQRGGMIVDPLRSGFPRVLIDPSSGLPNRLPPGAVPPGARF
FT                   DPFGPIGTSPSGPNPDHLPPPGYDDMYL"
FT   CDS             complement(join(290179..290230,291030..291188,
FT                   292368..292421,301036..301221,305767..305849,
FT                   307023..307175,312560..312688))
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_e"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT173573.0
FT                   protein_id=mCP96492.0 isoform=CRA_e"
FT                   /db_xref="GOA:A2AU35"
FT                   /db_xref="InterPro:IPR013886"
FT                   /db_xref="InterPro:IPR021625"
FT                   /db_xref="MGI:MGI:1346072"
FT                   /db_xref="UniProtKB/TrEMBL:A2AU35"
FT                   /protein_id="EDL05932.1"
FT                   /translation="MAGLEVLFASAAPSMSCPQDALVCFLHWEVVTNGYYALGTGDQPG
FT                   PSDKKSELLPAKWNSNKELYALRYESKDGARKLLLKAVSVENGMIINVLELGTQQVADL
FT                   TLNLDDYIDAEDLSDFHRTYKNSEELRSQIRSGIITPIHEQWEKARANSPPREFPPATA
FT                   REVDPLQISSHRPHTSRQPAWRDPLSPFAVGGDDLDPFGCQRGGMIVDPLRSGFPRVLI
FT                   DPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL"
FT   CDS             complement(join(290179..290230,291030..291188,
FT                   292368..292421,301036..>301436))
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170656.0
FT                   protein_id=mCP93576.0 isoform=CRA_d"
FT                   /protein_id="EDL05931.1"
FT                   /translation="PKKLRPKSRRQHQAVAPLTQVRRTARSHHSKQAKRKTKAAQGRRR
FT                   RRPSHQNTVHETPSQLQEANFLSQSCRTYKNSEELRSQIRSGIITPIHEQWEKARANSP
FT                   PREFPPATAREVDPLQISSHRPHTSRQPAWRDPLSPFAVGGDDLDPFGCQRGGMIVDPL
FT                   RSGFPRVLIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPSGPNPDHLPPPGYDDMYL"
FT   mRNA            complement(join(291027..291188,292368..292421,
FT                   301036..301221,312560..>312845))
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, transcript variant mCT170657"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170657.0 created
FT                   on 25-SEP-2002"
FT   CDS             complement(join(292408..292421,301036..301221,
FT                   312560..>312845))
FT                   /codon_start=1
FT                   /gene="Psmf1"
FT                   /locus_tag="mCG_13177"
FT                   /product="proteasome (prosome, macropain) inhibitor subunit
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG13177.1 transcript_id=mCT170657.0
FT                   protein_id=mCP93575.0 isoform=CRA_b"
FT                   /protein_id="EDL05929.1"
FT                   /translation="RVSTFPRRCGQSRKRRRHQKASLPLAVPLLLGGAAFCIVPSFSSF
FT                   PTEAANIHGGSRGSLRVGRSIHELPAGRTRLLPALGSGDKRLLCLGHGRPGPIRTVRSF
FT                   GLRSDLELSHLSMSSGRRLVQTVLRGSSHLPLPERWTHSRFPHTVLILAGSLLGVIP"
FT   assembly_gap    317896..318958
FT                   /estimated_length=1063
FT                   /gap_type="unknown"
FT   gene            complement(319383..>323269)
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /note="gene_id=mCG140674.0"
FT   mRNA            complement(join(319383..320629,321541..321779,
FT                   323081..>323238))
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, transcript variant
FT                   mCT170644"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170644.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(319890..>320204)
FT                   /codon_start=1
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, isoform CRA_a"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170644.0
FT                   protein_id=mCP93562.0 isoform=CRA_a"
FT                   /protein_id="EDL05933.1"
FT                   /translation="GGVLHACTYFSVPVLGSSLFLALPEVPPTDAFKIAHSIWIFPALT
FT                   SEFRGGFPQTRTNAVRGMDLECLLVIHTIRCLPRDINRAGSHLRKEGLFCLCFLGKEWR
FT                   "
FT   mRNA            complement(join(<319938..320629,321541..321779,
FT                   323167..>323269))
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, transcript variant
FT                   mCT170646"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170646.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(<319938..>320204)
FT                   /codon_start=1
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, isoform CRA_b"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170646.0
FT                   protein_id=mCP93563.0 isoform=CRA_b"
FT                   /protein_id="EDL05934.1"
FT                   /translation="GGVLHACTYFSVPVLGSSLFLALPEVPPTDAFKIAHSIWIFPALT
FT                   SEFRGGFPQTRTNAVRGMDLECLLVIHTIRCLPRDINRAGSHLR"
FT   mRNA            complement(join(320088..320629,321541..321779,
FT                   323103..>323231))
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, transcript variant
FT                   mCT170645"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170645.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(321674..321779,323103..>323230))
FT                   /codon_start=1
FT                   /gene="4930556L07Rik"
FT                   /locus_tag="mCG_140674"
FT                   /product="RIKEN cDNA 4930556L07, isoform CRA_c"
FT                   /note="gene_id=mCG140674.0 transcript_id=mCT170645.0
FT                   protein_id=mCP93564.0 isoform=CRA_c"
FT                   /protein_id="EDL05935.1"
FT                   /translation="TKILRGEKLRRRFRQEEPSERGSKPTEPPRKDILQAVELPPAVVQ
FT                   PGWPCLPPCKQDGNYGGAGWSGVHVLTSRSHP"
FT   assembly_gap    334388..334469
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    339636..340210
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   assembly_gap    347913..348281
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    387750..387978
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    397722..398000
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   gene            <401355..404372
FT                   /locus_tag="mCG_140675"
FT                   /note="gene_id=mCG140675.0"
FT   mRNA            join(<401355..401517,403973..404372)
FT                   /locus_tag="mCG_140675"
FT                   /product="mCG140675"
FT                   /note="gene_id=mCG140675.0 transcript_id=mCT170647.0
FT                   created on 17-JUL-2002"
FT   CDS             join(<401425..401517,403973..404047)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140675"
FT                   /product="mCG140675"
FT                   /note="gene_id=mCG140675.0 transcript_id=mCT170647.0
FT                   protein_id=mCP93565.0"
FT                   /protein_id="EDL05936.1"
FT                   /translation="WSLESGTADHMKMVAVLLGGTGSIIMSTDQLPRSSWTPSLTSASL
FT                   CDSECWVVSE"
FT   gene            <415211..446027
FT                   /gene="Rspo4"
FT                   /locus_tag="mCG_13178"
FT                   /note="gene_id=mCG13178.1"
FT   mRNA            join(<415211..415438,440308..440496,441123..441263,
FT                   442321..442506,445591..446027)
FT                   /gene="Rspo4"
FT                   /locus_tag="mCG_13178"
FT                   /product="R-spondin family, member 4"
FT                   /note="gene_id=mCG13178.1 transcript_id=mCT11755.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(<415213..415438,440308..440496,441123..441263,
FT                   442321..442506,445591..445682)
FT                   /codon_start=1
FT                   /gene="Rspo4"
FT                   /locus_tag="mCG_13178"
FT                   /product="R-spondin family, member 4"
FT                   /note="gene_id=mCG13178.1 transcript_id=mCT11755.2
FT                   protein_id=mCP9959.2"
FT                   /protein_id="EDL05937.1"
FT                   /translation="TRPTAPWAHRRVPGGRSDQRPADAQRAPQAVPRTEAAGPSGSQEH
FT                   QAAQMRAPLCLLLLLAHAVDMLALYRRKKQAGTGLGGNCTGCVICSEENGCSTCQQRLF
FT                   LFIRREGIRQYGKCVHDCPLGFFGIRGQEANRCKKCGATCESCFSQDFCIRCKRRFHLY
FT                   KGKCLPSCPPGTLTHQSTRECQEECEPSPWGSWSPCIHNGKTCGSGWGLETRVREAGPA
FT                   KQEETASCRVLSESRKCPIKRLCPGERNPRQKNRKDRRQRKDRKLERRPHQRGSQ"
FT   assembly_gap    420316..420607
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   gene            complement(437629..>439269)
FT                   /locus_tag="mCG_140680"
FT                   /note="gene_id=mCG140680.1"
FT   mRNA            complement(join(437629..438714,439080..>439269))
FT                   /locus_tag="mCG_140680"
FT                   /product="mCG140680"
FT                   /note="gene_id=mCG140680.1 transcript_id=mCT170659.1
FT                   created on 11-JUN-2003"
FT   CDS             complement(join(438502..438714,439080..>439259))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140680"
FT                   /product="mCG140680"
FT                   /note="gene_id=mCG140680.1 transcript_id=mCT170659.1
FT                   protein_id=mCP93577.1"
FT                   /protein_id="EDL05938.1"
FT                   /translation="DKTTEVAQNCSMFTSHQAGILNELVAHPGPPEPMAPHRRTFLDLQ
FT                   LLSFPMCIFPTEVPLENDMQWDRREKTWCLRKCEAMRAAPRLERASHITTARQSPLSHS
FT                   PSKTCSVQITPRTDRNERKAFLLLGV"
FT   assembly_gap    440178..440254
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    454375..459476
FT                   /estimated_length=5102
FT                   /gap_type="unknown"
FT   gene            complement(461559..>467272)
FT                   /locus_tag="mCG_140676"
FT                   /note="gene_id=mCG140676.0"
FT   mRNA            complement(join(461559..462214,467209..>467272))
FT                   /locus_tag="mCG_140676"
FT                   /product="mCG140676"
FT                   /note="gene_id=mCG140676.0 transcript_id=mCT170648.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(461994..462214,467209..>467236))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140676"
FT                   /product="mCG140676"
FT                   /note="gene_id=mCG140676.0 transcript_id=mCT170648.0
FT                   protein_id=mCP93566.0 partial"
FT                   /protein_id="EDL05939.1"
FT                   /translation="TIVGNWAADCMGXXXXXXXRKRKLRKEDRLTTTSPHTQEDLEEES
FT                   QDLRRKPKARQFLDLKQEKICRDFWSSQEVLDKTQKL"
FT   assembly_gap    462188..462207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            481329..515345
FT                   /gene="Angpt4"
FT                   /locus_tag="mCG_13185"
FT                   /note="gene_id=mCG13185.2"
FT   mRNA            join(481329..481786,495317..495472,496994..497115,
FT                   499310..499548,504414..504529,506676..506777,
FT                   508914..509080,513313..513443,514503..515345)
FT                   /gene="Angpt4"
FT                   /locus_tag="mCG_13185"
FT                   /product="angiopoietin 4"
FT                   /note="gene_id=mCG13185.2 transcript_id=mCT14095.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(481451..481786,495317..495472,496994..497115,
FT                   499310..499548,504414..504529,506676..506777,
FT                   508914..509080,513313..513443,514503..514663)
FT                   /codon_start=1
FT                   /gene="Angpt4"
FT                   /locus_tag="mCG_13185"
FT                   /product="angiopoietin 4"
FT                   /note="gene_id=mCG13185.2 transcript_id=mCT14095.1
FT                   protein_id=mCP9968.0"
FT                   /db_xref="GOA:Q3V0P7"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="InterPro:IPR020837"
FT                   /db_xref="InterPro:IPR028845"
FT                   /db_xref="MGI:MGI:1336887"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V0P7"
FT                   /protein_id="EDL05940.1"
FT                   /translation="MLCQPAMLLDGLLLLATMAAAQHRGPEAGGHRQIHQVRRGQCSYT
FT                   FVVPEPDICQLAPTAAPEALGGSNSLQRDLPASRLHLTDWRAQRAQRAQRVSQLEKILE
FT                   NNTQWLLKLEQSIKVNLRSHLVQAQQDTIQNQTTTMLALGANLMNQTKAQTHKLTAVEA
FT                   QVLNQTLHMKTQMLENSLSTNKLERQMLMQSRELQRLQGRNRALETRLQALEAQHQAQL
FT                   NSLQEKREQLHSLLGHQTGTLANLKHNLHALSSNSSSLQQQQQQLTEFVQRLVRIVAQD
FT                   QHPVSLKTPKPVFQDCAEIKRSGVNTSGVYTIYETNMTKPLKVFCDMETDGGGWTLIQH
FT                   REDGSVNFQRTWEEYKEGFGNVAREHWLGNEAVHRLTSRTAYLLRVELHDWEGRQTSIQ
FT                   YENFQLGSERQRYSLSVNDSSSSAGRKNSLAPQGTKFSTKDMDNDNCMCKCAQMLSGGW
FT                   WFDACGLSNLNGIYYSVHQHLHKINGIRWHYFRGPSYSLHGTRMMLRPMGA"
FT   assembly_gap    489896..491915
FT                   /estimated_length=2020
FT                   /gap_type="unknown"
FT   assembly_gap    502588..502823
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    515615..515754
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    520680..522258
FT                   /estimated_length=1579
FT                   /gap_type="unknown"
FT   assembly_gap    532217..532849
FT                   /estimated_length=633
FT                   /gap_type="unknown"
FT   gene            complement(539771..>550671)
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /note="gene_id=mCG13175.1"
FT   mRNA            complement(join(539771..541298,550367..>550671))
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, transcript variant
FT                   mCT11751"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT11751.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(539774..541298,544277..>544340))
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, transcript variant
FT                   mCT170655"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170655.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(539774..541298,543984..>544309))
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, transcript variant
FT                   mCT170654"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170654.1 created
FT                   on 20-JUN-2003"
FT   mRNA            complement(join(539774..541298,543673..>543768))
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, transcript variant
FT                   mCT170653"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170653.1 created
FT                   on 20-JUN-2003"
FT   CDS             complement(join(540332..541298,550367..>550671))
FT                   /codon_start=1
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, isoform CRA_c"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT11751.1
FT                   protein_id=mCP9961.1 isoform=CRA_c"
FT                   /protein_id="EDL05943.1"
FT                   /translation="LLHLRLLMLPGNPGGAPFERKRRANQEVRGEPLQQRGRRAHFPFL
FT                   WGPRDVLPEGIVGQPGRPTRKSSPVFTRSSLLRSAGTTSCQPRQPARSGIPLDVGCSGA
FT                   RYPAANFVPVSVFSPLPSGYVTAMPVDTLSPGAPATPALPFRLRTKVPGYLLPRPADGG
FT                   ARKPSAVERLEADKAKYVKSLRVANTRQEPVQPPLVRQPLFSPGPRGPVLTPSRRVLPC
FT                   SGRRPQLDLDILSSLINLCDSPVSPSEASRTPGRPEGSAHKVPPATPPRPPPSTVAVRR
FT                   VDVRPLPASPARPYPSPGTTTTSSPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLD
FT                   PEEARGLGVAHLARASSDIVSLAGPSAGPCSSEGGCSRRSSATVEERSLDRVPYGVSVI
FT                   ERNARVIKWLYGLRQARDPPTTEG"
FT   CDS             complement(join(540332..541298,544277..>544338))
FT                   /codon_start=1
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, isoform CRA_b"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170655.1
FT                   protein_id=mCP93573.0 isoform=CRA_b"
FT                   /protein_id="EDL05942.1"
FT                   /translation="YLSQVGGRRAGCWKEAACTASGARYPAANFVPVSVFSPLPSGYVT
FT                   AMPVDTLSPGAPATPALPFRLRTKVPGYLLPRPADGGARKPSAVERLEADKAKYVKSLR
FT                   VANTRQEPVQPPLVRQPLFSPGPRGPVLTPSRRVLPCSGRRPQLDLDILSSLINLCDSP
FT                   VSPSEASRTPGRPEGSAHKVPPATPPRPPPSTVAVRRVDVRPLPASPARPYPSPGTTTT
FT                   SSPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLARASSDIVSL
FT                   AGPSAGPCSSEGGCSRRSSATVEERSLDRVPYGVSVIERNARVIKWLYGLRQARDPPTT
FT                   EG"
FT   CDS             complement(join(540332..541298,543984..>544252))
FT                   /codon_start=1
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, isoform CRA_d"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170654.1
FT                   protein_id=mCP93571.0 isoform=CRA_d"
FT                   /protein_id="EDL05944.1"
FT                   /translation="GAHQGLSLQSLHSSRGPTPAQRGTADGGGHTAFAQPKPHRLSLQD
FT                   CLQVRTTRNKTRGFPGVLLIYLLLGSLKGGTKSGYGTGIDQKGSSGARYPAANFVPVSV
FT                   FSPLPSGYVTAMPVDTLSPGAPATPALPFRLRTKVPGYLLPRPADGGARKPSAVERLEA
FT                   DKAKYVKSLRVANTRQEPVQPPLVRQPLFSPGPRGPVLTPSRRVLPCSGRRPQLDLDIL
FT                   SSLINLCDSPVSPSEASRTPGRPEGSAHKVPPATPPRPPPSTVAVRRVDVRPLPASPAR
FT                   PYPSPGTTTTSSPGRPPGLQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHL
FT                   ARASSDIVSLAGPSAGPCSSEGGCSRRSSATVEERSLDRVPYGVSVIERNARVIKWLYG
FT                   LRQARDPPTTEG"
FT   CDS             complement(join(540332..541298,543673..>543710))
FT                   /codon_start=1
FT                   /gene="5430432M24Rik"
FT                   /locus_tag="mCG_13175"
FT                   /product="RIKEN cDNA 5430432M24, isoform CRA_a"
FT                   /note="gene_id=mCG13175.1 transcript_id=mCT170653.1
FT                   protein_id=mCP93572.0 isoform=CRA_a"
FT                   /protein_id="EDL05941.1"
FT                   /translation="QCVWFPERCPFSSGARYPAANFVPVSVFSPLPSGYVTAMPVDTLS
FT                   PGAPATPALPFRLRTKVPGYLLPRPADGGARKPSAVERLEADKAKYVKSLRVANTRQEP
FT                   VQPPLVRQPLFSPGPRGPVLTPSRRVLPCSGRRPQLDLDILSSLINLCDSPVSPSEASR
FT                   TPGRPEGSAHKVPPATPPRPPPSTVAVRRVDVRPLPASPARPYPSPGTTTTSSPGRPPG
FT                   LQRSKSDLSERFSRAAADLERFFNFCGLDPEEARGLGVAHLARASSDIVSLAGPSAGPC
FT                   SSEGGCSRRSSATVEERSLDRVPYGVSVIERNARVIKWLYGLRQARDPPTTEG"
FT   assembly_gap    552876..552900
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    560037..561900
FT                   /estimated_length=1864
FT                   /gap_type="unknown"
FT   gene            566989..579704
FT                   /gene="2310046K01Rik"
FT                   /locus_tag="mCG_13176"
FT                   /note="gene_id=mCG13176.1"
FT   mRNA            join(566989..567107,574504..575130,575984..576471,
FT                   577930..578053,578395..579704)
FT                   /gene="2310046K01Rik"
FT                   /locus_tag="mCG_13176"
FT                   /product="RIKEN cDNA 2310046K01"
FT                   /note="gene_id=mCG13176.1 transcript_id=mCT11754.1 created
FT                   on 17-JUL-2002"
FT   assembly_gap    569862..569881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(574573..575130,575984..576471,577930..578053,
FT                   578395..578607)
FT                   /codon_start=1
FT                   /gene="2310046K01Rik"
FT                   /locus_tag="mCG_13176"
FT                   /product="RIKEN cDNA 2310046K01"
FT                   /note="gene_id=mCG13176.1 transcript_id=mCT11754.1
FT                   protein_id=mCP9956.1"
FT                   /db_xref="GOA:Q9D6X5"
FT                   /db_xref="InterPro:IPR009357"
FT                   /db_xref="MGI:MGI:1916948"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D6X5"
FT                   /protein_id="EDL05945.1"
FT                   /translation="MAFLTHLLVCVFGMGSWVAINGLWVELPLLVTELPEAWYLPSYLT
FT                   VVIQLANIGPLLVTLMHRFRPGCLSEVPVIFLILCVGTAACILLAFLWNVTSWIQGGQH
FT                   SVAFIVLTFFLALVDCTSSVTFLPFMSQLPTYYLTTFFIGEGLSGLLPALVALVQGSGI
FT                   TTCVNVTETPGTTLNTMETPITQGNLSPSLPSPSWHQESRYLAPRFSPLLFFLLLSFLT
FT                   GCCLVAFFLLQRQPWGRQGSIEDLLHSQVTLHSIRPRDTEDTSSLGAPVSSPGKGSVEA
FT                   SVASLRPAQLAFIYSVVAFVNALTNGVLPSVQTYSCLPYGPVAYHLSATLSSVASPLAC
FT                   FLPIFLPNRSLLFLGVLTVLGTGFGAYNMAMAAMSPCPVLQGHWGGEVLIVLSWVLFAA
FT                   CLSYVKVMLGVILRDRSRSALLWCGAAVQLGSLIGALLMFPLVNVLKLFSSADYCSLDC
FT                   SV"
FT   gene            complement(579845..582926)
FT                   /locus_tag="mCG_147185"
FT                   /note="gene_id=mCG147185.0"
FT   mRNA            complement(579845..582926)
FT                   /locus_tag="mCG_147185"
FT                   /product="mCG147185"
FT                   /note="gene_id=mCG147185.0 transcript_id=mCT187448.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(580282..580488)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147185"
FT                   /product="mCG147185"
FT                   /note="gene_id=mCG147185.0 transcript_id=mCT187448.0
FT                   protein_id=mCP109246.0"
FT                   /protein_id="EDL05946.1"
FT                   /translation="MPTWLCKGRTFLFTMSRNCFFFLTVLGRNFGMHHAITLPLRSMPS
FT                   LCVHISVVDCDTHGCQICNLFLR"
FT   assembly_gap    582931..584129
FT                   /estimated_length=1199
FT                   /gap_type="unknown"
FT   assembly_gap    607908..608379
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    619131..619180
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    641431..642105
FT                   /estimated_length=675
FT                   /gap_type="unknown"
FT   gene            complement(645967..>647418)
FT                   /locus_tag="mCG_140677"
FT                   /note="gene_id=mCG140677.0"
FT   mRNA            complement(join(645967..646465,647243..>647418))
FT                   /locus_tag="mCG_140677"
FT                   /product="mCG140677"
FT                   /note="gene_id=mCG140677.0 transcript_id=mCT170649.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(646024..>646461)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140677"
FT                   /product="mCG140677"
FT                   /note="gene_id=mCG140677.0 transcript_id=mCT170649.0
FT                   protein_id=mCP93567.0"
FT                   /protein_id="EDL05947.1"
FT                   /translation="RNQGSERCFDSPKETQLRTCLRSDQTAWLQSLHHTSPELLSKRPN
FT                   MPALGEWVDSCKKSPSPPTSAAFIISPSTSCWARVEAQQSVKRKTTLPVTTPLCSPLAK
FT                   ARWYFECLRCFPRVLGDHWIPALAPTPCQVSFLQSWRYFCP"
FT   assembly_gap    651698..651717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    652052..652204
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   gene            662579..666412
FT                   /locus_tag="mCG_13184"
FT                   /note="gene_id=mCG13184.2"
FT   mRNA            662579..666412
FT                   /locus_tag="mCG_13184"
FT                   /product="mCG13184"
FT                   /note="gene_id=mCG13184.2 transcript_id=mCT14094.3 created
FT                   on 19-JUN-2003"
FT   CDS             663857..664474
FT                   /codon_start=1
FT                   /locus_tag="mCG_13184"
FT                   /product="mCG13184"
FT                   /note="gene_id=mCG13184.2 transcript_id=mCT14094.3
FT                   protein_id=mCP9966.3"
FT                   /protein_id="EDL05948.1"
FT                   /translation="MDAFFISDGRSRRRRAGAGGDAAGAGDAGGGGGGGGGGGERAGRS
FT                   GATAGGGHRHACAECGKTYATSSNLSRHKQTHRSLDSQLARKCPTCGKAYVSMPALAMH
FT                   VLTHNLRHKCGVCGKAFSRPWLLQGHMRSHTGEKPFGCAHCGKAFADRSNLRAHMQTHS
FT                   AFKHYRCRQCDKSFALKSYLHKHCEAACVKAAEPPPSAGPAS"
FT   assembly_gap    675006..675173
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            <676392..682025
FT                   /gene="Srxn1"
FT                   /locus_tag="mCG_13189"
FT                   /note="gene_id=mCG13189.1"
FT   mRNA            join(<676392..676611,679653..682025)
FT                   /gene="Srxn1"
FT                   /locus_tag="mCG_13189"
FT                   /product="sulfiredoxin 1 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG13189.1 transcript_id=mCT14099.1 created
FT                   on 17-JUL-2002"
FT   CDS             join(<676393..676611,679653..679856)
FT                   /codon_start=1
FT                   /gene="Srxn1"
FT                   /locus_tag="mCG_13189"
FT                   /product="sulfiredoxin 1 homolog (S. cerevisiae)"
FT                   /note="gene_id=mCG13189.1 transcript_id=mCT14099.1
FT                   protein_id=mCP9953.1"
FT                   /protein_id="EDL05949.1"
FT                   /translation="QGRGMGLRAGGALRRAGAGPGAPEGQGPGGAQGGSIHSGCIATVH
FT                   NVPIAVLIRPLPSVLDPAKVQSLVDTILADPDSVPPIDVLWIKGAQGGDYYYSFGGCHR
FT                   YAAYQQLQRETIPAKLVRSTLSDLRMYLGASTPDLQ"
FT   assembly_gap    687241..687800
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   assembly_gap    689633..689804
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    693083..693143
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            714323..719861
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /note="gene_id=mCG13183.2"
FT   mRNA            join(714323..714905,719463..719861)
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /product="transcription factor 15, transcript variant
FT                   mCT11753"
FT                   /note="gene_id=mCG13183.2 transcript_id=mCT11753.2 created
FT                   on 25-SEP-2002"
FT   CDS             join(714393..714905,719463..719537)
FT                   /codon_start=1
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /product="transcription factor 15, isoform CRA_a"
FT                   /note="gene_id=mCG13183.2 transcript_id=mCT11753.2
FT                   protein_id=mCP9967.1 isoform=CRA_a"
FT                   /protein_id="EDL05950.1"
FT                   /translation="MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGLE
FT                   AARRGPGPGSGRRASNGAGPVVVVRQRQAANARERDRTQSVNTAFTALRTLIPTEPVDR
FT                   KLSKIETLRLASSYIAHLANVLLLGDAADDGQPCFRAAGGGKSAVPAADGRQPRSICTF
FT                   CLSNQRKGGSRRDLGGSCLKVRGVAPLRGPRR"
FT   mRNA            join(<714635..714905,719468..719860)
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /product="transcription factor 15, transcript variant
FT                   mCT173575"
FT                   /note="gene_id=mCG13183.2 transcript_id=mCT173575.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(<714652..714905,719468..719537)
FT                   /codon_start=1
FT                   /gene="Tcf15"
FT                   /locus_tag="mCG_13183"
FT                   /product="transcription factor 15, isoform CRA_b"
FT                   /note="gene_id=mCG13183.2 transcript_id=mCT173575.0
FT                   protein_id=mCP96494.0 isoform=CRA_b"
FT                   /protein_id="EDL05951.1"
FT                   /translation="TRPSPPCARSSPPSPWTESCLRSRRCVWRPATSPTWPTCCCWATR
FT                   PTTGSRVSARRAVARARSPPPTAVSRAPSAPSVSATSARGRRDLGGSCLKVRGVAPLRG
FT                   PRR"
FT   assembly_gap    726584..726603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    741683..741795
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    742612..742850
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    748502..748549
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    755403..755422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(756095..>756428)
FT                   /locus_tag="mCG_140678"
FT                   /note="gene_id=mCG140678.0"
FT   mRNA            complement(756095..>756428)
FT                   /locus_tag="mCG_140678"
FT                   /product="mCG140678"
FT                   /note="gene_id=mCG140678.0 transcript_id=mCT170650.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(756131..>756427)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140678"
FT                   /product="mCG140678"
FT                   /note="gene_id=mCG140678.0 transcript_id=mCT170650.0
FT                   protein_id=mCP93568.0"
FT                   /protein_id="EDL05952.1"
FT                   /translation="VIVRFLTVMMKHGYIGEFEIIDDHRAGKIVVNLTGRLNKCGVISP
FT                   RFDVQLKDLEKWQNNLLPSRQFGFIVLTTSAGIMDHEEARRKHRGGKILGFFF"
FT   assembly_gap    756429..757131
FT                   /estimated_length=703
FT                   /gap_type="unknown"
FT   assembly_gap    762549..762575
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    786772..786791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    792547..792621
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    797747..797816
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            797832..850598
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /note="gene_id=mCG13182.2"
FT   mRNA            join(797832..797948,821359..821568,825167..825278,
FT                   828335..828436,828898..828948,829633..829692,
FT                   831716..831799,834140..834250,841383..841484,
FT                   842847..842947,844152..844300,845701..845787,
FT                   847723..850598)
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /product="casein kinase II, alpha 1 polypeptide, transcript
FT                   variant mCT14093"
FT                   /note="gene_id=mCG13182.2 transcript_id=mCT14093.2 created
FT                   on 25-SEP-2002"
FT   mRNA            join(797890..797948,821359..821568,825167..825278,
FT                   828335..828436,828898..828948,829633..829692,
FT                   831716..831799,834140..834250,841383..841898)
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /product="casein kinase II, alpha 1 polypeptide, transcript
FT                   variant mCT173574"
FT                   /note="gene_id=mCG13182.2 transcript_id=mCT173574.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(821468..821568,825167..825278,828335..828436,
FT                   828898..828948,829633..829692,831716..831799,
FT                   834140..834250,841383..841484,842847..842947,
FT                   844152..844300,845701..845787,847723..847838)
FT                   /codon_start=1
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /product="casein kinase II, alpha 1 polypeptide, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13182.2 transcript_id=mCT14093.2
FT                   protein_id=mCP9965.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q60737"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:88543"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q60737"
FT                   /protein_id="EDL05953.1"
FT                   /translation="MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKL
FT                   GRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDP
FT                   VSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVM
FT                   IDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCML
FT                   ASMIFRKEPFFHGHDNYDQLVRIAKVLGTEDLYDYIDKYNIELDPRFNDILGRHSRKRW
FT                   ERFVHSENQHLVSPEALDFLDKLLRYDHQSRLTAREAMEHPYFYTVVKDQARMSSTSMA
FT                   GGSTPVSSANMMSGISSVPTPSPLGPLAGSPVIAAANSLGIPVPAAAGAQQ"
FT   CDS             join(821468..821568,825167..825278,828335..828436,
FT                   828898..828948,829633..829692,831716..831799,
FT                   834140..834250,841383..841508)
FT                   /codon_start=1
FT                   /gene="Csnk2a1"
FT                   /locus_tag="mCG_13182"
FT                   /product="casein kinase II, alpha 1 polypeptide, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13182.2 transcript_id=mCT173574.0
FT                   protein_id=mCP96493.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D0E8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D0E8"
FT                   /protein_id="EDL05954.1"
FT                   /translation="MSGPVPSRARVYTDVNTHRPREYWDYESHVVEWGNQDDYQLVRKL
FT                   GRGKYSEVFEAINITNNEKVVVKILKPVKKKKIKREIKILENLRGGPNIITLADIVKDP
FT                   VSRTPALVFEHVNNTDFKQLYQTLTDYDIRFYMYEILKALDYCHSMGIMHRDVKPHNVM
FT                   IDHEHRKLRLIDWGLAEFYHPGQEYNVRVASRYFKGPELLVDYQMYDYSLDMWSLGCML
FT                   ASMIFRKEPFFHGHDNYDQVMTCFSH"
FT   assembly_gap    837643..838662
FT                   /estimated_length=1020
FT                   /gap_type="unknown"
FT   assembly_gap    860563..860582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <862651..882810
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /note="gene_id=mCG13191.1"
FT   mRNA            join(<862651..862822,870970..871155,873764..873844,
FT                   876807..876993,877148..877249,879199..879340,
FT                   880130..880317,880523..882810)
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, transcript variant
FT                   mCT14101"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT14101.2 created
FT                   on 17-JUL-2002"
FT   CDS             join(<862651..862822,870970..871155,873764..873844,
FT                   876807..876993,877148..877249,879199..879340,
FT                   880130..880317,880523..880778)
FT                   /codon_start=1
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, isoform CRA_c"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT14101.2
FT                   protein_id=mCP9954.2 isoform=CRA_c"
FT                   /protein_id="EDL05957.1"
FT                   /translation="GVYPAPAELGLGPWWEPLLRLRRQPGLGLGPGPPEMALRPSKGDG
FT                   SAGRWDRGAGKADFNAKRKKKVAEIHQALNSDPIDLAALRRMAISEGGLLTDEIRCQVW
FT                   PKLLNVNTSEPPPVSRKDLRDMSKDYQQVLLDVRRSLRRFPPGMPDEQREGLQEELIDI
FT                   ILLVLDRNPQLHYYQGYHDIVVTFLLVVGERLATSLVEKLSTHHLRDFMDPTMDNTKHI
FT                   LNYLMPIIDQVSPELHDFMQSAEVGTIFALSWLITWFGHVLMDFRHVVRLYDFFLACHP
FT                   LMPIYFAAVIVLYREQEVLDCDCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPPSE
FT                   LAREAAAQQEAERTAASTFKDFELASTQQRPDMVLRQRFRGLLRPEARTKDVLTKPRTN
FT                   RFVKLAVMGLTVALGAAALAVVKSALEWAPKFQLQLFP"
FT   mRNA            join(<862657..862822,870970..871155,873764..873844,
FT                   876807..877249,879199..879340,880130..880317,
FT                   880523..882804)
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, transcript variant
FT                   mCT189903"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT189903.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<862745..862822,870970..871155,873764..873844,
FT                   876807..876993,877148..877249,879199..879344,
FT                   880130..880317,880523..882809)
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, transcript variant
FT                   mCT189902"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT189902.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<862747..862822,870970..871155,873764..873844,
FT                   876807..876993,877148..877249,879199..879344,
FT                   880130..880167)
FT                   /codon_start=1
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, isoform CRA_a"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT189902.0
FT                   protein_id=mCP110855.0 isoform=CRA_a"
FT                   /protein_id="EDL05955.1"
FT                   /translation="PPEMALRPSKGDGSAGRWDRGAGKADFNAKRKKKVAEIHQALNSD
FT                   PIDLAALRRMAISEGGLLTDEIRCQVWPKLLNVNTSEPPPVSRKDLRDMSKDYQQVLLD
FT                   VRRSLRRFPPGMPDEQREGLQEELIDIILLVLDRNPQLHYYQGYHDIVVTFLLVVGERL
FT                   ATSLVEKLSTHHLRDFMDPTMDNTKHILNYLMPIIDQVSPELHDFMQSAEVGTIFALSW
FT                   LITWFGHVLMDFRHVVRLYDFFLACHPLMPIYFAAVVDRAVPGAGSPGL"
FT   assembly_gap    868040..868059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<877116..877249,879199..879340,880130..880317,
FT                   880523..880778)
FT                   /codon_start=1
FT                   /gene="Tbc1d20"
FT                   /locus_tag="mCG_13191"
FT                   /product="TBC1 domain family, member 20, isoform CRA_b"
FT                   /note="gene_id=mCG13191.1 transcript_id=mCT189903.0
FT                   protein_id=mCP110856.0 isoform=CRA_b"
FT                   /protein_id="EDL05956.1"
FT                   /translation="PLALTELSSCRDFMDPTMDNTKHILNYLMPIIDQVSPELHDFMQS
FT                   AEVGTIFALSWLITWFGHVLMDFRHVVRLYDFFLACHPLMPIYFAAVIVLYREQEVLDC
FT                   DCDMASVHHLLSQIPQDLPYETLISRAGDLFVQFPPSELAREAAAQQEAERTAASTFKD
FT                   FELASTQQRPDMVLRQRFRGLLRPEARTKDVLTKPRTNRFVKLAVMGLTVALGAAALAV
FT                   VKSALEWAPKFQLQLFP"
FT   gene            complement(885141..901461)
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /note="gene_id=mCG13181.2"
FT   mRNA            complement(join(885141..885727,887125..887268,
FT                   887526..887624,887937..888116,890973..891084,
FT                   891985..892145,893080..893253,893338..893453,
FT                   895029..895227,896060..896153,899773..899917,
FT                   900847..900935,901309..901461))
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /product="RanBP-type and C3HC4-type zinc finger containing
FT                   1, transcript variant mCT14092"
FT                   /note="gene_id=mCG13181.2 transcript_id=mCT14092.2 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(885151..885727,887125..887268,
FT                   887526..887624,887937..888116,890973..891084,
FT                   891985..892145,893080..893253,893338..893453,
FT                   895029..895227,896060..896153,899773..899917,
FT                   900847..>901226))
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /product="RanBP-type and C3HC4-type zinc finger containing
FT                   1, transcript variant mCT189871"
FT                   /note="gene_id=mCG13181.2 transcript_id=mCT189871.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(885647..885727,887125..887268,
FT                   887526..887624,887937..888116,890973..891084,
FT                   891985..892145,893080..893253,893338..893453,
FT                   895029..895227,896060..896153,899773..899917,
FT                   900847..>900970))
FT                   /codon_start=1
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /product="RanBP-type and C3HC4-type zinc finger containing
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG13181.2 transcript_id=mCT189871.0
FT                   protein_id=mCP110854.0 isoform=CRA_a"
FT                   /protein_id="EDL05958.1"
FT                   /translation="GRVASTFPLSPRLPQSSVFRKQQPFLRGWAQPGQMDEKTKKAEEM
FT                   ALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEVSPTQDIRLCVSVEDAYMHTVT
FT                   IWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIRRNGDGAYLY
FT                   LLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRGPLEPVLPKPRTNQEPGQPDAAP
FT                   ESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDEEERARLAGEEEALRQ
FT                   YQQRKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGEAVVLRECLHTFCREC
FT                   LQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAENRSTL
FT                   SYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNCREYQDDLALRAQNDV
FT                   AARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWGPGG
FT                   PGDTSGGCRCRVNGIPCHPSCQNCH"
FT   CDS             complement(join(885647..885727,887125..887268,
FT                   887526..887624,887937..888116,890973..891084,
FT                   891985..892145,893080..893253,893338..893453,
FT                   895029..895227,896060..896153,899773..899909))
FT                   /codon_start=1
FT                   /gene="Rbck1"
FT                   /locus_tag="mCG_13181"
FT                   /product="RanBP-type and C3HC4-type zinc finger containing
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG13181.2 transcript_id=mCT14092.2
FT                   protein_id=mCP9960.2 isoform=CRA_b"
FT                   /protein_id="EDL05959.1"
FT                   /translation="MALSLARAVAGGDEQAAIKYATWLAEQRVPLRVQVKPEVSPTQDI
FT                   RLCVSVEDAYMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETL
FT                   HSHGIRRNGDGAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQSRGPLEPVLP
FT                   KPRTNQEPGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPETYQIPASYQPDE
FT                   EERARLAGEEEALRQYQQRKQQQQEGNYLQHVQLEQRSLVLNTEPTECPVCYSVLAPGE
FT                   AVVLRECLHTFCRECLQGTIRNSQEAEVACPFIDSTYSCPGKLLEREIRALLSPEDYQR
FT                   FLDLGVSIAENRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHEHMNC
FT                   REYQDDLALRAQNDVAARQTTEMLKVMLQQGEAMHCPQCRIVVQKKDGCDWIRCTVCHT
FT                   EICWVTKGPRWGPGGPGDTSGGCRCRVNGIPCHPSCQNCH"
FT   gene            complement(906215..>912989)
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /note="gene_id=mCG13180.2"
FT   mRNA            complement(join(906215..907483,908511..908803,
FT                   911819..912109,912639..912809))
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), transcript
FT                   variant mCT14091"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT14091.1 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(906216..907483,908511..908803,
FT                   911819..911972,912972..>912989))
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), transcript
FT                   variant mCT170661"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT170661.0 created
FT                   on 17-JUL-2002"
FT   mRNA            complement(join(906216..907483,908511..908803,
FT                   911819..912065,912639..>912803))
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), transcript
FT                   variant mCT170660"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT170660.0 created
FT                   on 17-JUL-2002"
FT   CDS             complement(join(907003..907483,908511..908803,
FT                   911819..911972,912972..>912988))
FT                   /codon_start=1
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT170661.0
FT                   protein_id=mCP93579.0 isoform=CRA_b"
FT                   /protein_id="EDL05961.1"
FT                   /translation="RVGGSDLLPPSPPPASDLSPAVAPATRLGPYILLEREQGSCSYRA
FT                   LHCPTGTEYTCKVYPASEAQAVLAPYARLPTHQHVARPTEVLLGSRLLYIFFTKTHGDL
FT                   HSLVRSRRGIPESEAAGLFRQMASAVAHCHKHGLVLRDLKLRRFVFSNCERTKLVLENL
FT                   EDACVMTGSDDSLWDKHACPAYVGPEILSSRPSYSGKAADVWSLGVALFTMLAGRYPFH
FT                   DSEPVLLFGKIRRGTFALPEGLSAPARCLIRCLLRKEPSERLVALGILLHPWLREDHGR
FT                   VSPPQSDRREMDQVVPDGPQLEEAEEGEVGLYG"
FT   CDS             complement(join(907003..907483,908511..908803,
FT                   911819..912065,912639..>912652))
FT                   /codon_start=1
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT170660.0
FT                   protein_id=mCP93578.0 isoform=CRA_c"
FT                   /protein_id="EDL05962.1"
FT                   /translation="GSRTRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLPSLLPPSPPPA
FT                   SDLSPAVAPATRLGPYILLEREQGSCSYRALHCPTGTEYTCKVYPASEAQAVLAPYARL
FT                   PTHQHVARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESEAAGLFRQMASAVAHC
FT                   HKHGLVLRDLKLRRFVFSNCERTKLVLENLEDACVMTGSDDSLWDKHACPAYVGPEILS
FT                   SRPSYSGKAADVWSLGVALFTMLAGRYPFHDSEPVLLFGKIRRGTFALPEGLSAPARCL
FT                   IRCLLRKEPSERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGPQLEEAEEGEV
FT                   GLYG"
FT   CDS             complement(join(907003..907483,908511..908803,
FT                   911819..912109))
FT                   /codon_start=1
FT                   /gene="Trib3"
FT                   /locus_tag="mCG_13180"
FT                   /product="tribbles homolog 3 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG13180.2 transcript_id=mCT14091.1
FT                   protein_id=mCP9962.2 isoform=CRA_a"
FT                   /protein_id="EDL05960.1"
FT                   /translation="MRATPLAASADVSCRKKPLEFDDNIDAKCPVLKRVRDEPEPGPLP
FT                   SLLPPSPPPASDLSPAVAPATRLGPYILLEREQGSCSYRALHCPTGTEYTCKVYPASEA
FT                   QAVLAPYARLPTHQHVARPTEVLLGSRLLYIFFTKTHGDLHSLVRSRRGIPESEAAGLF
FT                   RQMASAVAHCHKHGLVLRDLKLRRFVFSNCERTKLVLENLEDACVMTGSDDSLWDKHAC
FT                   PAYVGPEILSSRPSYSGKAADVWSLGVALFTMLAGRYPFHDSEPVLLFGKIRRGTFALP
FT                   EGLSAPARCLIRCLLRKEPSERLVALGILLHPWLREDHGRVSPPQSDRREMDQVVPDGP
FT                   QLEEAEEGEVGLYG"
FT   assembly_gap    910395..910511
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   gene            914451..944069
FT                   /locus_tag="mCG_1050958"
FT                   /note="gene_id=mCG1050958.0"
FT   mRNA            join(914451..914508,930477..930622,937438..937540,
FT                   939544..939710,942544..944069)
FT                   /locus_tag="mCG_1050958"
FT                   /product="mCG1050958"
FT                   /note="gene_id=mCG1050958.0 transcript_id=mCT194747.0
FT                   created on 27-JAN-2005"
FT   assembly_gap    919138..919157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            922286..923377
FT                   /pseudo
FT                   /locus_tag="mCG_118797"
FT                   /note="gene_id=mCG118797.0"
FT   mRNA            922286..923377
FT                   /pseudo
FT                   /locus_tag="mCG_118797"
FT                   /note="gene_id=mCG118797.0 transcript_id=mCT119958.0
FT                   created on 17-JUL-2002"
FT   assembly_gap    927090..927185
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    934797..934895
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   gene            complement(937495..>945359)
FT                   /gene="Nrsn2"
FT                   /locus_tag="mCG_3729"
FT                   /note="gene_id=mCG3729.1"
FT   mRNA            complement(join(937495..938663,942840..943034,
FT                   945293..>945359))
FT                   /gene="Nrsn2"
FT                   /locus_tag="mCG_3729"
FT                   /product="neurensin 2"
FT                   /note="gene_id=mCG3729.1 transcript_id=mCT2818.1 created on
FT                   22-JUL-2002"
FT   CDS             complement(join(938241..938663,942840..943034,
FT                   945293..>945358))
FT                   /codon_start=1
FT                   /gene="Nrsn2"
FT                   /locus_tag="mCG_3729"
FT                   /product="neurensin 2"
FT                   /note="gene_id=mCG3729.1 transcript_id=mCT2818.1
FT                   protein_id=mCP7981.1"
FT                   /protein_id="EDL05964.1"
FT                   /translation="SALLCSAPAPTASVGSGDAGPEGSVMSCSRPCVCSHGTSVEESTW
FT                   YGFDFYPNLFYNDWLGTTTLPYNPERIPIRYINRPWPSLCWKVTVAVASLFLLLGVAAL
FT                   TTGYAVPPKLELVNESKFSSMEDPVADYNQALMTCRVVGATLCGVAGIMLAVCLFLIAS
FT                   GWMFQDIKAEPLVTETDSPVEVFRDEPEKLSPAFHETSSQSPFLTPPSPFGQQSVQTSQ
FT                   PQRDL"
FT   CDS             943493..943894
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050958"
FT                   /product="mCG1050958"
FT                   /note="gene_id=mCG1050958.0 transcript_id=mCT194747.0
FT                   protein_id=mCP115776.0"
FT                   /protein_id="EDL05963.1"
FT                   /translation="MCGQTRVEVKGSVSESPLPFDQVNPPAISLAAACVLTPMSHLDNS
FT                   NYYSLFLFLFPSSTFGAPMFTVRDPYVPPQNFCPFRTISRGNFHRRYSCSWVGVFTLYS
FT                   PKSLRQISPIHKSQGIVSSGLRALGPFDY"
FT   assembly_gap    950335..950354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    954991..955341
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    960233..960252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(964739..>965535)
FT                   /locus_tag="mCG_1027917"
FT                   /note="gene_id=mCG1027917.1"
FT   mRNA            complement(964739..>965535)
FT                   /locus_tag="mCG_1027917"
FT                   /product="mCG1027917"
FT                   /note="gene_id=mCG1027917.1 transcript_id=mCT145621.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(965134..>965535)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027917"
FT                   /product="mCG1027917"
FT                   /note="gene_id=mCG1027917.1 transcript_id=mCT145621.1
FT                   protein_id=mCP72832.1"
FT                   /protein_id="EDL05965.1"
FT                   /translation="PGRELWSMVPAGRAARGPAERAQGPSGEGAAASAASPTLSEDEEP
FT                   EEEEEEAATAEEGEEETVVSGEEPLGFLSRMPPGPAGLDCSALDRDPDLLPPSGTSHFE
FT                   FPDYCTPEVTEMIAGDWRPSSIADLVFTY"
FT   assembly_gap    965537..966698
FT                   /estimated_length=1162
FT                   /gap_type="unknown"
FT   assembly_gap    970823..970872
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(979542..>982569)
FT                   /gene="Zcchc3"
FT                   /locus_tag="mCG_3721"
FT                   /note="gene_id=mCG3721.2"
FT   mRNA            complement(979542..>982569)
FT                   /gene="Zcchc3"
FT                   /locus_tag="mCG_3721"
FT                   /product="zinc finger, CCHC domain containing 3"
FT                   /note="gene_id=mCG3721.2 transcript_id=mCT2821.2 created on
FT                   22-JUL-2002"
FT   CDS             complement(981156..>982568)
FT                   /codon_start=1
FT                   /gene="Zcchc3"
FT                   /locus_tag="mCG_3721"
FT                   /product="zinc finger, CCHC domain containing 3"
FT                   /note="gene_id=mCG3721.2 transcript_id=mCT2821.2
FT                   protein_id=mCP7973.2"
FT                   /protein_id="EDL05966.1"
FT                   /translation="EPGSRRAVSGRHEFPHARLPRGRKPEASGFRAGAGSRPRSPRPSS
FT                   LIPSGSAPWAPRTAGTSGGCWERGNMATGGGAEEESQRGRPQLPLPARPVARVEEPEGV
FT                   REKMGWAQVVKNLAEKKGDFREPRRRDEAGSGASGGLGSPGGLATPNPGDFPPAARGDP
FT                   KGRRRDPTGEASDAYRKKSASGAGDPSRRKKAEVTAAMATPARPSTTEDATERPLQDEP
FT                   PAAGPGKGRFLVRICFQGDESACPTRDFVVGALILRSIGMDPDDIYAVIQIPGSREFDV
FT                   SFRSAEKLALFLRVYEEKRELEDCWENFVVLGRSRSSLKTLFILFRNETVDVEDIVTWL
FT                   KRHCDVLAVPVKVTDRFGIWTGEYKCEIELRQGEGGVRHLPGAFFLGAERGYSWYKGQP
FT                   KTCFKCGSRTHMSGTCTQDRCFRCGEEGHLSPYCRKVIVCNLCGKRGHAFAQCPKAVHN
FT                   SVTAQLTSVAGH"
FT   gene            983168..1013557
FT                   /gene="6820408C15Rik"
FT                   /locus_tag="mCG_141039"
FT                   /note="gene_id=mCG141039.1"
FT   mRNA            join(983168..983303,994980..995276,995452..995506,
FT                   996033..996132,1003248..1003360,1006697..1006855,
FT                   1008840..1008939,1009995..1010152,1010230..1010331,
FT                   1010446..1010532,1011604..1011722,1013303..1013557)
FT                   /gene="6820408C15Rik"
FT                   /locus_tag="mCG_141039"
FT                   /product="RIKEN cDNA 6820408C15"
FT                   /note="gene_id=mCG141039.1 transcript_id=mCT172812.1
FT                   created on 11-JUN-2003"
FT   assembly_gap    984089..984138
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    991773..991792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(995266..995276,995452..995506,996033..996132,
FT                   1003248..1003360,1006697..1006855,1008840..1008939,
FT                   1009995..1010152,1010230..1010331,1010446..1010532,
FT                   1011604..1011722,1013303..1013363)
FT                   /codon_start=1
FT                   /gene="6820408C15Rik"
FT                   /locus_tag="mCG_141039"
FT                   /product="RIKEN cDNA 6820408C15"
FT                   /note="gene_id=mCG141039.1 transcript_id=mCT172812.1
FT                   protein_id=mCP95731.0"
FT                   /db_xref="GOA:Q8BJX2"
FT                   /db_xref="InterPro:IPR029236"
FT                   /db_xref="MGI:MGI:3045333"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BJX2"
FT                   /protein_id="EDL05967.1"
FT                   /translation="MAQKQTSRPQFSGNKFQVPVRLGPEKNLKPSTLPPLRQVKGRNKS
FT                   KTKNLNKIQPVQSQVSVEMANSTKTSGGLRRRDQTHHGKVQAKVRLMRSMLRNQRTSLQ
FT                   ELYSHEGYLSKLNKELIKAILDTEDSVALSVREMLQQQSILGSIIDILEYSNKKRVQQL
FT                   RSELQEWKEKEESKTNSLQREVDQLNSEIQKASEEVNFLDTYMDHEYPVKLVQIASHIR
FT                   QVQQAKDNQQDELDNLSEMRETILALFSNVIQEKKKKILKSLVVNTQKPHENILLLKTL
FT                   DRRRLQRCMVLFRELIEQMKEEIPILLSEVEQMCAELWNPREAVYKDVLLQRPKCTPDM
FT                   AVELNIPVQEPFPF"
FT   assembly_gap    996556..996575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    998247..998266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1015573..1015592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1018632..1018848
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   gene            <1028237..1050090
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /note="gene_id=mCG119782.1"
FT   mRNA            join(<1028237..1028619,1040400..1040478,1049510..1050089)
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /product="RIKEN cDNA 9230107O10, transcript variant
FT                   mCT120959"
FT                   /note="gene_id=mCG119782.1 transcript_id=mCT120959.1
FT                   created on 22-JUL-2002"
FT   CDS             <1028237..1028548
FT                   /codon_start=1
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /product="RIKEN cDNA 9230107O10, isoform CRA_a"
FT                   /note="gene_id=mCG119782.1 transcript_id=mCT120959.1
FT                   protein_id=mCP72862.1 isoform=CRA_a"
FT                   /protein_id="EDL05968.1"
FT                   /translation="LILMPVEAERSLMPQEKDLLPTNMLSPLPWEPWACLRWSRSGPRG
FT                   SIGRILALFDVHLGGSSSAHAASPGPGGDRLHGEGVWAHSRVGIGQKVLGSSALEECH"
FT   gene            complement(<1028342..1034779)
FT                   /locus_tag="mCG_51783"
FT                   /note="gene_id=mCG51783.2"
FT   mRNA            complement(join(<1028342..1028784,1034717..1034779))
FT                   /locus_tag="mCG_51783"
FT                   /product="mCG51783"
FT                   /note="gene_id=mCG51783.2 transcript_id=mCT51966.1 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(1028342..1028784,1034717..1034774))
FT                   /codon_start=1
FT                   /locus_tag="mCG_51783"
FT                   /product="mCG51783"
FT                   /note="gene_id=mCG51783.2 transcript_id=mCT51966.1
FT                   protein_id=mCP30354.0"
FT                   /db_xref="GOA:Q30KP0"
FT                   /db_xref="InterPro:IPR020520"
FT                   /db_xref="InterPro:IPR025933"
FT                   /db_xref="MGI:MGI:3644405"
FT                   /db_xref="UniProtKB/TrEMBL:Q30KP0"
FT                   /protein_id="EDL05970.1"
FT                   /translation="MKLLFPLFASLMLQSQVKSEFATVKRCLVGFGKCKDSCLADETQM
FT                   QHCKAKKCCIGPKVSELIKSYLRQEIPHIPDEDIVEMMRTKKNSTEEMQGKQALMALFQ
FT                   SRAAKNLLSNTNSAMGPNAFPVKSVTTRTRRRRMGATASTKMHIKQSKDSANAAPRPRP
FT                   GPP"
FT   assembly_gap    1029701..1030151
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    1031032..1032800
FT                   /estimated_length=1769
FT                   /gap_type="unknown"
FT   assembly_gap    1033558..1034263
FT                   /estimated_length=706
FT                   /gap_type="unknown"
FT   assembly_gap    1035437..1035520
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            1037564..1038046
FT                   /pseudo
FT                   /locus_tag="mCG_140713"
FT                   /note="gene_id=mCG140713.0"
FT   mRNA            1037564..1038046
FT                   /pseudo
FT                   /locus_tag="mCG_140713"
FT                   /note="gene_id=mCG140713.0 transcript_id=mCT170925.0
FT                   created on 22-JUL-2002"
FT   mRNA            join(<1047233..1047341,1049510..1050090)
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /product="RIKEN cDNA 9230107O10, transcript variant
FT                   mCT170924"
FT                   /note="gene_id=mCG119782.1 transcript_id=mCT170924.0
FT                   created on 22-JUL-2002"
FT   CDS             join(<1047233..1047341,1049510..1049751)
FT                   /codon_start=1
FT                   /gene="9230107O10Rik"
FT                   /locus_tag="mCG_119782"
FT                   /product="RIKEN cDNA 9230107O10, isoform CRA_b"
FT                   /note="gene_id=mCG119782.1 transcript_id=mCT170924.0
FT                   protein_id=mCP93842.0 isoform=CRA_b"
FT                   /protein_id="EDL05969.1"
FT                   /translation="VLGSEWHTTGSPAVSGGSEDMKLLQVLLVLLFVALADGAQPKRCF
FT                   SNVEGYCRKKCRLVEISEMGCLHGKYCCVNELENKKHKKHSVVEETVKLQDKSKVQDYM
FT                   ILPTVTYYTISI"
FT   gene            complement(1055799..>1060255)
FT                   /gene="9230002F21Rik"
FT                   /locus_tag="mCG_1027918"
FT                   /note="gene_id=mCG1027918.1"
FT   mRNA            complement(join(1055799..1056338,1060167..>1060255))
FT                   /gene="9230002F21Rik"
FT                   /locus_tag="mCG_1027918"
FT                   /product="RIKEN cDNA 9230002F21"
FT                   /note="gene_id=mCG1027918.1 transcript_id=mCT145622.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(join(1055857..1056338,1060167..>1060254))
FT                   /codon_start=1
FT                   /gene="9230002F21Rik"
FT                   /locus_tag="mCG_1027918"
FT                   /product="RIKEN cDNA 9230002F21"
FT                   /note="gene_id=mCG1027918.1 transcript_id=mCT145622.1
FT                   protein_id=mCP72834.1"
FT                   /protein_id="EDL05971.1"
FT                   /translation="HRTYCLLTGAMKSLLSTLVIIMFLAHLVTGGWYVKKCANTLGNCR
FT                   KMCRDGEKQTEPATSKCPIGKLCCVLDFKISGHCGGGGQNSDNLVTAGGDEGSSAKAST
FT                   AAMVGAAAMAGTPTKTSAPAKTSAPAKTSTTTKASNAAKASTTTKASNAAKASAATMAG
FT                   NTTKVSTAAIASTPAQASTPTKANST"
FT   gene            <1088335..1091528
FT                   /gene="Defb28"
FT                   /locus_tag="mCG_1027970"
FT                   /note="gene_id=mCG1027970.1"
FT   mRNA            join(<1088335..1088441,1090097..1090261,1091403..1091528)
FT                   /gene="Defb28"
FT                   /locus_tag="mCG_1027970"
FT                   /product="defensin beta 28"
FT                   /note="gene_id=mCG1027970.1 transcript_id=mCT145674.1
FT                   created on 22-JUL-2002"
FT   CDS             join(<1088336..1088441,1090097..1090261,1091403..1091413)
FT                   /codon_start=1
FT                   /gene="Defb28"
FT                   /locus_tag="mCG_1027970"
FT                   /product="defensin beta 28"
FT                   /note="gene_id=mCG1027970.1 transcript_id=mCT145674.1
FT                   protein_id=mCP73158.0"
FT                   /protein_id="EDL05972.1"
FT                   /translation="STFSMLQTRSSTLSGHNKLWFLTLAVLVVLAQTSPEGWFRTCFYG
FT                   LGKCRRICRANEKKKERCGERTFCCLRETNSRLSHIPVTKDREKDESC"
FT   assembly_gap    1099380..1099399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1103292..1104559
FT                   /estimated_length=1268
FT                   /gap_type="unknown"
FT   assembly_gap    1105927..1105946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1107286..1107305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1108512..1109379
FT                   /estimated_length=868
FT                   /gap_type="unknown"
FT   gene            <1140363..1142565
FT                   /gene="4930525K10Rik"
FT                   /locus_tag="mCG_119800"
FT                   /note="gene_id=mCG119800.1"
FT   mRNA            join(<1140363..1140445,1141383..1141469,1142307..1142565)
FT                   /gene="4930525K10Rik"
FT                   /locus_tag="mCG_119800"
FT                   /product="RIKEN cDNA 4930525K10"
FT                   /note="gene_id=mCG119800.1 transcript_id=mCT120978.1
FT                   created on 22-JUL-2002"
FT   CDS             join(<1140421..1140445,1141383..1141469,1142307..1142530)
FT                   /codon_start=1
FT                   /gene="4930525K10Rik"
FT                   /locus_tag="mCG_119800"
FT                   /product="RIKEN cDNA 4930525K10"
FT                   /note="gene_id=mCG119800.1 transcript_id=mCT120978.1
FT                   protein_id=mCP73056.0"
FT                   /protein_id="EDL05973.1"
FT                   /translation="VSACVSFLDVWMFYLPRAMRFLLLVLPVLALLPQVTPDYGAKKRC
FT                   LKILGHCRRHCKDGEMDHGSCKYYRVCCVPDLNSYNQNYAITWTTEETSTSEYDLSSDF
FT                   IGVLRAI"
FT   gene            complement(1143712..>1148578)
FT                   /gene="Defb19"
FT                   /locus_tag="mCG_1027919"
FT                   /note="gene_id=mCG1027919.1"
FT   mRNA            complement(join(1143712..1143978,1148459..>1148578))
FT                   /gene="Defb19"
FT                   /locus_tag="mCG_1027919"
FT                   /product="defensin beta 19"
FT                   /note="gene_id=mCG1027919.1 transcript_id=mCT145623.1
FT                   created on 22-JUL-2002"
FT   CDS             complement(join(1143785..1143978,1148459..>1148576))
FT                   /codon_start=1
FT                   /gene="Defb19"
FT                   /locus_tag="mCG_1027919"
FT                   /product="defensin beta 19"
FT                   /note="gene_id=mCG1027919.1 transcript_id=mCT145623.1
FT                   protein_id=mCP72847.0"
FT                   /protein_id="EDL05974.1"
FT                   /translation="RNSAAVPCRPLTTSTLGGATMRLALLLLAILVATELVVSGKNPIL
FT                   QCMGNRGFCRSSCKKSEQAYFYCRTFQMCCLQSYVRISLTGVDDNTNWSYEKHWPRIP"
FT   assembly_gap    1146044..1146063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1161455..>1167839)
FT                   /locus_tag="mCG_58458"
FT                   /note="gene_id=mCG58458.2"
FT   mRNA            complement(join(1161455..1161696,1164605..>1164691))
FT                   /locus_tag="mCG_58458"
FT                   /product="mCG58458, transcript variant mCT58641"
FT                   /note="gene_id=mCG58458.2 transcript_id=mCT58641.1 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(1161510..1161696,1167460..>1167839))
FT                   /locus_tag="mCG_58458"
FT                   /product="mCG58458, transcript variant mCT170942"
FT                   /note="gene_id=mCG58458.2 transcript_id=mCT170942.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(1161551..1161696,1164605..>1164689))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58458"
FT                   /product="mCG58458, isoform CRA_b"
FT                   /note="gene_id=mCG58458.2 transcript_id=mCT58641.1
FT                   protein_id=mCP30355.1 isoform=CRA_b"
FT                   /protein_id="EDL05976.1"
FT                   /translation="TSQHPEFPEVMKTAVLTMALLLLSQVIPGTPERCWKSFGVCREEC
FT                   AKKESFYIFCWNGKLCCVKPKNVPLWSQNLD"
FT   CDS             complement(join(1161592..1161696,1167460..>1167579))
FT                   /codon_start=1
FT                   /locus_tag="mCG_58458"
FT                   /product="mCG58458, isoform CRA_a"
FT                   /note="gene_id=mCG58458.2 transcript_id=mCT170942.0
FT                   protein_id=mCP93860.0 isoform=CRA_a"
FT                   /protein_id="EDL05975.1"
FT                   /translation="EKTTTKSNLGRVSDCSLSLREAKGGIQDRDLEAGTEAETMGPLKD
FT                   AGSLLVSAVKSVPRKKVSTSSAGMANCAV"
FT   assembly_gap    1180485..1180842
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    1182901..1182920
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1184734..1184753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1186966..1189125
FT                   /estimated_length=2160
FT                   /gap_type="unknown"
FT   gene            1197617..1216388
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /note="gene_id=mCG3722.2"
FT   mRNA            join(1197617..1197719,1198573..1199108,1199850..1199929,
FT                   1204083..1204284,1205073..1205822)
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /product="rad and gem related GTP binding protein 1,
FT                   transcript variant mCT2822"
FT                   /note="gene_id=mCG3722.2 transcript_id=mCT2822.1 created on
FT                   25-SEP-2002"
FT   mRNA            join(<1197624..1197719,1198573..1198893,1205246..1205399,
FT                   1216262..1216388)
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /product="rad and gem related GTP binding protein 1,
FT                   transcript variant mCT173582"
FT                   /note="gene_id=mCG3722.2 transcript_id=mCT173582.0 created
FT                   on 25-SEP-2002"
FT   CDS             join(<1198634..1198893,1205246..1205273)
FT                   /codon_start=1
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /product="rad and gem related GTP binding protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3722.2 transcript_id=mCT173582.0
FT                   protein_id=mCP96501.0 isoform=CRA_a"
FT                   /protein_id="EDL05977.1"
FT                   /translation="EGSGGNYFHRLSGPKKGLRATGYRLTVLLLEGRKKPGKLKISSQR
FT                   MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSHAPAASWHV"
FT   CDS             join(1198769..1199108,1199850..1199929,1204083..1204284,
FT                   1205073..1205344)
FT                   /codon_start=1
FT                   /gene="Rem1"
FT                   /locus_tag="mCG_3722"
FT                   /product="rad and gem related GTP binding protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3722.2 transcript_id=mCT2822.1
FT                   protein_id=mCP7974.1 isoform=CRA_b"
FT                   /protein_id="EDL05978.1"
FT                   /translation="MTLNTQQEAKTTLRRRASTPLPLSSRGHQPGRLCTAPSAPSQHPR
FT                   LGQSVSLNPPVRKPSPAQDGWSSESSDSEGSWEALYRVVLLGDPGVGKTSLASLFAEKQ
FT                   DRDPHEQLGGVYERTLSVDGEDTTLVVMDTWEAEKLDESWCQESCLQAGSAYVIVYSIA
FT                   DRSSFESASELRIQLRRTHQANHVPIILVGNKADLARCREVSVEEGRACAVVFDCKFIE
FT                   TSATLQHNVTELFEGVVRQLRLRRQDNAAPETPSPRRRASLGQRARRFLARLTARSARR
FT                   RALKARSKSCHNLAVL"
FT   gene            complement(1223500..>1224944)
FT                   /locus_tag="mCG_140716"
FT                   /note="gene_id=mCG140716.0"
FT   mRNA            complement(join(1223500..1224007,1224700..>1224944))
FT                   /locus_tag="mCG_140716"
FT                   /product="mCG140716"
FT                   /note="gene_id=mCG140716.0 transcript_id=mCT170929.0
FT                   created on 22-JUL-2002"
FT   CDS             complement(1223670..>1223945)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140716"
FT                   /product="mCG140716"
FT                   /note="gene_id=mCG140716.0 transcript_id=mCT170929.0
FT                   protein_id=mCP93847.0"
FT                   /protein_id="EDL05979.1"
FT                   /translation="NDSAQEPKEEARNLDTSPWADARSVASRICPSPCKPDSPRPLPLI
FT                   AGLCKQSFWMDTGHGCASSLNTFHSQTEPQPRLLRKIGRKRHFPCS"
FT   gene            1240083..1279207
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /note="gene_id=mCG3727.2"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1275178..1275200,
FT                   1279005..1279207)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT2816"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT2816.3 created on
FT                   28-APR-2003"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1275178..1277380)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT120968"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT120968.2 created
FT                   on 28-APR-2003"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1274551..1274750,
FT                   1275178..1275592)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT170935"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170935.1 created
FT                   on 28-APR-2003"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1258623)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT170936"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170936.1 created
FT                   on 28-APR-2003"
FT   mRNA            join(1240083..1240377,1248153..1248251,1251593..1255688)
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, transcript variant
FT                   mCT170934"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170934.1 created
FT                   on 28-APR-2003"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1275178..1275200,
FT                   1279005..1279033)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_e"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT2816.3
FT                   protein_id=mCP7979.2 isoform=CRA_e"
FT                   /protein_id="EDL05984.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIINYEFDTKDL
FT                   VCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFW
FT                   VFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDI
FT                   SLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEV
FT                   AEMFSYEESNPKDPVVSKLID"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1275178..1275280)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_a"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT120968.2
FT                   protein_id=mCP72941.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D8V0"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="MGI:MGI:95886"
FT                   /db_xref="PDB:1INQ"
FT                   /db_xref="PDB:1JUF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D8V0"
FT                   /protein_id="EDL05980.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIINYEFDTKDL
FT                   VCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFW
FT                   VFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDI
FT                   SLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEV
FT                   AEMFSYEESNPKDPAAETESKEESTEASASKRLEKKEK"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256728,1259205..1259290,1259379..1259504,
FT                   1260386..1260443,1262340..1262423,1265034..1265070,
FT                   1266039..1266141,1270739..1270824,1274551..1274701)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_b"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170935.1
FT                   protein_id=mCP93853.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9D8V0"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="MGI:MGI:95886"
FT                   /db_xref="PDB:1INQ"
FT                   /db_xref="PDB:1JUF"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D8V0"
FT                   /protein_id="EDL05981.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEEIINYEFDTKDL
FT                   VCLGLSSVVGVWYLLRKHWIANNLFGLAFSLNGVELLHLNNVSTGCILLGGLFIYDIFW
FT                   VFGTNVMVTVAKSFEAPIKLVFPQDLLEKGLEADNFAMLGLGDIVIPGIFIALLLRFDI
FT                   SLKKNTHTYFYTSFAAYIFGLGLTIFIMHIFKHAQPALLYLVPACIGFPVLVALAKGEV
FT                   AEMFSYESSAVILPHTPRLTHFPTVSGSPASLADSMQQKLAGPRRRRPQNPSAM"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251675,
FT                   1256640..1256949)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_d"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170936.1
FT                   protein_id=mCP93854.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q6PGJ8"
FT                   /db_xref="InterPro:IPR007369"
FT                   /db_xref="MGI:MGI:95886"
FT                   /db_xref="UniProtKB/TrEMBL:Q6PGJ8"
FT                   /protein_id="EDL05983.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTISPFMNKFFPANFPNRQYQLLFTQGSGENKEGQCCPCPLGCVF
FT                   PSCLSPVLGFPKKRALKTKPNLYGPGSYPAWSPPSNGNLNDPVVSEHGLFLEVCYPICK
FT                   ME"
FT   CDS             join(1240195..1240377,1248153..1248251,1251593..1251832)
FT                   /codon_start=1
FT                   /gene="H13"
FT                   /locus_tag="mCG_3727"
FT                   /product="histocompatibility 13, isoform CRA_c"
FT                   /note="gene_id=mCG3727.2 transcript_id=mCT170934.1
FT                   protein_id=mCP93852.1 isoform=CRA_c"
FT                   /protein_id="EDL05982.1"
FT                   /translation="MDSAVSDPHNGSAEAGTPANGTTRPPSTPEGIALAYGSLLLMALL
FT                   PIFFGALRSVRCARGKSSSDMPETITSRDAARFPIIASCTLLGLYLFFKIFSQEYINLL
FT                   LSMYFFVLGILALSHTIRSEGISRQPLKLLSQEPVQGLGWEHGLLCHSEPGLNPGCKIQ
FT                   GNLPSRQHYT"
FT   gene            complement(1255050..>1256157)
FT                   /locus_tag="mCG_140718"
FT                   /note="gene_id=mCG140718.0"
FT   mRNA            complement(join(1255050..1255570,1255928..>1256157))
FT                   /locus_tag="mCG_140718"
FT                   /product="mCG140718"
FT                   /note="gene_id=mCG140718.0 transcript_id=mCT170937.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(1255508..1255570,1255928..>1256116))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140718"
FT                   /product="mCG140718"
FT                   /note="gene_id=mCG140718.0 transcript_id=mCT170937.0
FT                   protein_id=mCP93855.0"
FT                   /protein_id="EDL05985.1"
FT                   /translation="KQFYPACSISWPGREQRWSFPDYVRARPANQGLLVVGVRILQSCG
FT                   GYISDSLSGLWVPYLCVRSEHPRKADSARTAKARGSVC"
FT   gene            <1306965..1308121
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /note="gene_id=mCG1027891.1"
FT   mRNA            <1306965..1308117
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /product="inhibitor of DNA binding 1, transcript variant
FT                   mCT145595"
FT                   /note="gene_id=mCG1027891.1 transcript_id=mCT145595.1
FT                   created on 19-JUN-2003"
FT   CDS             <1306965..1307558
FT                   /codon_start=1
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /product="inhibitor of DNA binding 1, isoform CRA_b"
FT                   /note="gene_id=mCG1027891.1 transcript_id=mCT145595.1
FT                   protein_id=mCP72997.1 isoform=CRA_b"
FT                   /protein_id="EDL05987.1"
FT                   /translation="HCTTFLQLLVLFPHSVLSLLRSPPPVLRIMKVASGSAAAAAGPSC
FT                   SLKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNGCYSRLKELVPT
FT                   LPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTTGGRGLPVRAPLSTLNGEISALAA
FT                   EVRSEAEYYIILQWETEATGGGCPPSLLFRRIAI"
FT   mRNA            join(<1306966..1307456,1307683..1308121)
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /product="inhibitor of DNA binding 1, transcript variant
FT                   mCT170919"
FT                   /note="gene_id=mCG1027891.1 transcript_id=mCT170919.0
FT                   created on 19-JUN-2003"
FT   CDS             join(<1306968..1307456,1307683..1307724)
FT                   /codon_start=1
FT                   /gene="Id1"
FT                   /locus_tag="mCG_1027891"
FT                   /product="inhibitor of DNA binding 1, isoform CRA_a"
FT                   /note="gene_id=mCG1027891.1 transcript_id=mCT170919.0
FT                   protein_id=mCP93837.0 isoform=CRA_a"
FT                   /protein_id="EDL05986.1"
FT                   /translation="CTTFLQLLVLFPHSVLSLLRSPPPVLRIMKVASGSAAAAAGPSCS
FT                   LKAGRTAGEVVLGLSEQSVAISRCAGTRLPALLDEQQVNVLLYDMNGCYSRLKELVPTL
FT                   PQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTTGGRGLPVRAPLSTLNGEISALAAE
FT                   AACVPADDRILCR"
FT   gene            1316345..1316975
FT                   /pseudo
FT                   /locus_tag="mCG_1027901"
FT                   /note="gene_id=mCG1027901.1"
FT   mRNA            1316345..1316975
FT                   /pseudo
FT                   /locus_tag="mCG_1027901"
FT                   /note="gene_id=mCG1027901.1 transcript_id=mCT145605.1
FT                   created on 24-JUL-2002"
FT   gene            1324846..1335693
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /note="gene_id=mCG119799.1"
FT   mRNA            join(1324846..1324897,1325828..1325912,1327687..1327851,
FT                   1331315..1331446,1335401..1335693)
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /product="cytochrome c oxidase subunit IV isoform 2,
FT                   transcript variant mCT120977"
FT                   /note="gene_id=mCG119799.1 transcript_id=mCT120977.1
FT                   created on 24-JUL-2002"
FT   mRNA            join(<1325767..1325912,1327687..1327851,1331315..1331446,
FT                   1335401..1335687)
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /product="cytochrome c oxidase subunit IV isoform 2,
FT                   transcript variant mCT189917"
FT                   /note="gene_id=mCG119799.1 transcript_id=mCT189917.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1325774..1325912,1327687..1327851,1331315..1331446,
FT                   1335401..1335537)
FT                   /codon_start=1
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /product="cytochrome c oxidase subunit IV isoform 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG119799.1 transcript_id=mCT189917.0
FT                   protein_id=mCP110904.0 isoform=CRA_b"
FT                   /protein_id="EDL05989.1"
FT                   /translation="GAAREQRGAEQDVSLILQMFSRAARSLVMRTGLRTRGTGTHSPGD
FT                   AAGSQRRMTPYVDCYAQRSYPMPDEPFCTELSEEQRALKEKEKGSWTQLSQAEKVALYR
FT                   LQFHETFAEMNHRSNEWKTVMGCVFFFIGFTALVIWWQRVYVFPKKVVTLTEERKAQQL
FT                   QRLLDMKSNPIQGLAAHWDYEKKEWKK"
FT   CDS             join(1325828..1325912,1327687..1327851,1331315..1331446,
FT                   1335401..1335537)
FT                   /codon_start=1
FT                   /gene="Cox4i2"
FT                   /locus_tag="mCG_119799"
FT                   /product="cytochrome c oxidase subunit IV isoform 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG119799.1 transcript_id=mCT120977.1
FT                   protein_id=mCP73047.1 isoform=CRA_a"
FT                   /protein_id="EDL05988.1"
FT                   /translation="MFSRAARSLVMRTGLRTRGTGTHSPGDAAGSQRRMTPYVDCYAQR
FT                   SYPMPDEPFCTELSEEQRALKEKEKGSWTQLSQAEKVALYRLQFHETFAEMNHRSNEWK
FT                   TVMGCVFFFIGFTALVIWWQRVYVFPKKVVTLTEERKAQQLQRLLDMKSNPIQGLAAHW
FT                   DYEKKEWKK"
FT   gene            complement(1329409..>1402915)
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /note="gene_id=mCG50852.2"
FT   mRNA            complement(join(1329409..1329598,1336313..1336421,
FT                   1337975..1338117,1400109..1400784,1401068..>1401857))
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, transcript variant mCT170940"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170940.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(1336421,1337975..1338117,
FT                   1400109..>1400720))
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170940.0
FT                   protein_id=mCP93858.0 isoform=CRA_b"
FT                   /protein_id="EDL05991.1"
FT                   /translation="AGVLDNGLVEPISIIKMSQSNRELVVDFLSYKLSQKGYSWSQFSD
FT                   VEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ
FT                   ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFG
FT                   GALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWGVSGGTPLRSVFRRLVQV
FT                   PGVAEHVCDPSLWEVETEGSEVQGPPQLL"
FT   mRNA            complement(join(1351322..1351424,1352801..1352927,
FT                   1400109..1400784,1402285..>1402915))
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, transcript variant mCT51035"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT51035.2 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(1351369..1351424,1352801..1352927,
FT                   1400109..>1400720))
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT51035.2
FT                   protein_id=mCP30356.2 isoform=CRA_c"
FT                   /protein_id="EDL05992.1"
FT                   /translation="AGVLDNGLVEPISIIKMSQSNRELVVDFLSYKLSQKGYSWSQFSD
FT                   VEENRTEAPEETEAERETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQ
FT                   ALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFG
FT                   GALCVESVDKEMQVLVSRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKG
FT                   QERFNRWFLTGMTVAGVVLLGSLFRAPVPPLPSPYTCSSSLK"
FT   mRNA            complement(join(1352065..1352927,1400109..1400784,
FT                   1401068..1401257))
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, transcript variant mCT170939"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170939.0 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(1352299..1352927,1399129..>1399189))
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, transcript variant mCT170941"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170941.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(1352627..>1352836)
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, isoform CRA_d"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170941.0
FT                   protein_id=mCP93859.0 isoform=CRA_d"
FT                   /protein_id="EDL05993.1"
FT                   /translation="LWLVWFCWAHSSVGSDQTLTVHSPLTSHPAPTTTLSSATIATRRT
FT                   TTCNSRPLPYHRVGPRRSPLQLAF"
FT   CDS             complement(join(1352790..1352927,1400109..1400672))
FT                   /codon_start=1
FT                   /gene="Bcl2l1"
FT                   /locus_tag="mCG_50852"
FT                   /product="Bcl2-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG50852.2 transcript_id=mCT170939.0
FT                   protein_id=mCP93857.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q5HZH3"
FT                   /db_xref="InterPro:IPR002475"
FT                   /db_xref="InterPro:IPR003093"
FT                   /db_xref="InterPro:IPR004725"
FT                   /db_xref="InterPro:IPR013279"
FT                   /db_xref="InterPro:IPR020717"
FT                   /db_xref="InterPro:IPR020726"
FT                   /db_xref="InterPro:IPR020728"
FT                   /db_xref="InterPro:IPR020731"
FT                   /db_xref="InterPro:IPR026298"
FT                   /db_xref="MGI:MGI:88139"
FT                   /db_xref="UniProtKB/TrEMBL:Q5HZH3"
FT                   /protein_id="EDL05990.1"
FT                   /translation="MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEETEAER
FT                   ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRA
FT                   FSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLV
FT                   SRIASWMATYLNDHLEPWIQENGGWDTFVDLYGNNAAAESRKGQERFNRWFLTGMTVAG
FT                   VVLLGSLFSRK"
FT   assembly_gap    1393850..1393930
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    1408500..1408519
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1414551..1414570
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1418673..1466390
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /note="gene_id=mCG3724.2"
FT   mRNA            join(1418673..1418987,1425513..1425607,1437683..1437853,
FT                   1440143..1440265,1443580..1443706,1446031..1446162,
FT                   1447057..1447182,1450590..1450711,1451502..1451653,
FT                   1452734..1452868,1454339..1454507,1456320..1456458,
FT                   1457157..1457373,1460245..1460337,1461288..1461464,
FT                   1462629..1462775,1463581..1463692,1464251..1464438,
FT                   1465735..1466389)
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), transcript variant mCT2819"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT2819.2 created on
FT                   24-JUL-2002"
FT   mRNA            join(1418674..1418799,1425513..1425596,1437683..1437853,
FT                   1440143..1440265,1443580..1443706,1446031..1446162,
FT                   1447057..1447182,1450590..1450711,1451502..1451653,
FT                   1454339..1454507,1456320..1456458,1457157..1457373,
FT                   1460245..1460337,1461288..1461464,1462629..1462775,
FT                   1463581..1463692,1464251..1464438,1465735..1466390)
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), transcript variant mCT170930"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT170930.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(<1418698..1418799,1425513..1425594,1437683..1437853,
FT                   1440143..1440265,1443580..1443706,1446031..1446162,
FT                   1447057..1447182,1450590..1450711,1451502..1451653,
FT                   1454339..1454507,1456320..1456458,1457157..1457373,
FT                   1460245..1460337,1461288..1461464,1462629..1462775,
FT                   1463581..1463692,1464251..1464438,1465735..1466170)
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), transcript variant mCT189899"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT189899.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<1418753..1418987,1425513..1425596,1437683..1437853,
FT                   1440143..1440265,1443580..1443706,1446031..1446162,
FT                   1447057..1447182,1450590..1450711,1451502..1451653,
FT                   1454339..1454507,1456320..1456458,1457157..1457373,
FT                   1460245..1460337,1461288..1461464,1462629..1462775,
FT                   1463581..1463692,1464251..1464438,1465735..1466169)
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), transcript variant mCT189900"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT189900.0 created
FT                   on 08-MAR-2004"
FT   assembly_gap    1422538..1422691
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    1427487..1427569
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    1437450..1437556
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   CDS             join(<1437739..1437853,1440143..1440265,1443580..1443706,
FT                   1446031..1446162,1447057..1447182,1450590..1450711,
FT                   1451502..1451653,1454339..1454507,1456320..1456458,
FT                   1457157..1457373,1460245..1460337,1461288..1461464,
FT                   1462629..1462775,1463581..1463692,1464251..1464438,
FT                   1465735..1465842)
FT                   /codon_start=1
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), isoform CRA_b"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT189899.0
FT                   protein_id=mCP110887.0 isoform=CRA_b"
FT                   /protein_id="EDL05995.1"
FT                   /translation="VGAMSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLE
FT                   NKFLRQRGIGEPFQGKNSLRKAKLQQGFVTPLKAVDNTYHKETEKENLQKQSIPSNDCS
FT                   SLDAKRAVSGNTPVQPQRRSIRLSAQKDLEQKEKNHVASVEMKAKRCVAPATDCPPQKR
FT                   MKVSHKKKLEEEEEGSAPATSRKNERETLEKAKGKHTVPGVPPAREKVLKSTEEQEIEK
FT                   RLRMQQEVVELRRKNEEFKKLALAGPGQPVKKSTSQVTKTVDFHFLTDERIKQHPKNQE
FT                   EYKEVNFMSELRKHSSTPARGTRGCTIIKPFNLSKGKKRTFDEAASTYVPIAQQVEAFH
FT                   KRTPNRYHLRNKKDESLLPSKSVNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEK
FT                   LQQYKFKARELDPRIFESGPILPKRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQF
FT                   EFHSRPCPTKILEDVVGVPEKKVIPATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQP
FT                   VPHYGVPYKPHIAEARNVEVCPFSFDTRDKERQLQKEKKIKEMQKGEVPKFKALPVPHF
FT                   DTINLPEKKVKNVTQAEPFSLETDKRGAYKAEMWKHQLEEEQKQQKDAACFKARPNTVI
FT                   FQEPFVPKKEKKSLAENPSGSLVQEPFQLATERRAKERQELEKKMAEVEAWKLQQLEEV
FT                   RQQEEEQQKEELARLRKELVHKANPIRKYAAVEVKSSELPLTVPVSPKFSTRFQ"
FT   CDS             join(<1437739..1437853,1440143..1440265,1443580..1443706,
FT                   1446031..1446162,1447057..1447182,1450590..1450711,
FT                   1451502..1451653,1454339..1454507,1456320..1456458,
FT                   1457157..1457373,1460245..1460337,1461288..1461464,
FT                   1462629..1462775,1463581..1463692,1464251..1464438,
FT                   1465735..1465842)
FT                   /codon_start=1
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), isoform CRA_b"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT189900.0
FT                   protein_id=mCP110888.0 isoform=CRA_b"
FT                   /protein_id="EDL05996.1"
FT                   /translation="VGAMSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLE
FT                   NKFLRQRGIGEPFQGKNSLRKAKLQQGFVTPLKAVDNTYHKETEKENLQKQSIPSNDCS
FT                   SLDAKRAVSGNTPVQPQRRSIRLSAQKDLEQKEKNHVASVEMKAKRCVAPATDCPPQKR
FT                   MKVSHKKKLEEEEEGSAPATSRKNERETLEKAKGKHTVPGVPPAREKVLKSTEEQEIEK
FT                   RLRMQQEVVELRRKNEEFKKLALAGPGQPVKKSTSQVTKTVDFHFLTDERIKQHPKNQE
FT                   EYKEVNFMSELRKHSSTPARGTRGCTIIKPFNLSKGKKRTFDEAASTYVPIAQQVEAFH
FT                   KRTPNRYHLRNKKDESLLPSKSVNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEK
FT                   LQQYKFKARELDPRIFESGPILPKRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQF
FT                   EFHSRPCPTKILEDVVGVPEKKVIPATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQP
FT                   VPHYGVPYKPHIAEARNVEVCPFSFDTRDKERQLQKEKKIKEMQKGEVPKFKALPVPHF
FT                   DTINLPEKKVKNVTQAEPFSLETDKRGAYKAEMWKHQLEEEQKQQKDAACFKARPNTVI
FT                   FQEPFVPKKEKKSLAENPSGSLVQEPFQLATERRAKERQELEKKMAEVEAWKLQQLEEV
FT                   RQQEEEQQKEELARLRKELVHKANPIRKYAAVEVKSSELPLTVPVSPKFSTRFQ"
FT   CDS             join(1437748..1437853,1440143..1440265,1443580..1443706,
FT                   1446031..1446162,1447057..1447182,1450590..1450711,
FT                   1451502..1451653,1452734..1452868,1454339..1454507,
FT                   1456320..1456458,1457157..1457373,1460245..1460337,
FT                   1461288..1461464,1462629..1462775,1463581..1463692,
FT                   1464251..1464438,1465735..1465842)
FT                   /codon_start=1
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), isoform CRA_c"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT2819.2
FT                   protein_id=mCP7976.2 isoform=CRA_c"
FT                   /protein_id="EDL05997.1"
FT                   /translation="MSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLENKF
FT                   LRQRGIGEPFQGKNSLRKAKLQQGFVTPLKAVDNTYHKETEKENLQKQSIPSNDCSSLD
FT                   AKRAVSGNTPVQPQRRSIRLSAQKDLEQKEKNHVASVEMKAKRCVAPATDCPPQKRMKV
FT                   SHKKKLEEEEEGSAPATSRKNERETLEKAKGKHTVPGVPPAREKVLKSTEEQEIEKRLR
FT                   MQQEVVELRRKNEEFKKLALAGPGQPVKKSTSQVTKTVDFHFLTDERIKQHPKNQEEYK
FT                   EVNFMSELRKHSSTPSTSQVTKTVDFHFLTDERIKQHPKNQEEYKEVNFMSELRKHSST
FT                   PARGTRGCTIIKPFNLSKGKKRTFDEAASTYVPIAQQVEAFHKRTPNRYHLRNKKDESL
FT                   LPSKSVNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEKLQQYKFKARELDPRIFE
FT                   SGPILPKRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQFEFHSRPCPTKILEDVVG
FT                   VPEKKVIPATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQPVPHYGVPYKPHIAEARN
FT                   VEVCPFSFDTRDKERQLQKEKKIKEMQKGEVPKFKALPVPHFDTINLPEKKVKNVTQAE
FT                   PFSLETDKRGAYKAEMWKHQLEEEQKQQKDAACFKARPNTVIFQEPFVPKKEKKSLAEN
FT                   PSGSLVQEPFQLATERRAKERQELEKKMAEVEAWKLQQLEEVRQQEEEQQKEELARLRK
FT                   ELVHKANPIRKYAAVEVKSSELPLTVPVSPKFSTRFQ"
FT   CDS             join(1437748..1437853,1440143..1440265,1443580..1443706,
FT                   1446031..1446162,1447057..1447182,1450590..1450711,
FT                   1451502..1451653,1454339..1454507,1456320..1456458,
FT                   1457157..1457373,1460245..1460337,1461288..1461464,
FT                   1462629..1462775,1463581..1463692,1464251..1464438,
FT                   1465735..1465842)
FT                   /codon_start=1
FT                   /gene="Tpx2"
FT                   /locus_tag="mCG_3724"
FT                   /product="TPX2, microtubule-associated protein homolog
FT                   (Xenopus laevis), isoform CRA_a"
FT                   /note="gene_id=mCG3724.2 transcript_id=mCT170930.0
FT                   protein_id=mCP93848.0 isoform=CRA_a"
FT                   /db_xref="GOA:A2APB8"
FT                   /db_xref="InterPro:IPR009675"
FT                   /db_xref="InterPro:IPR015128"
FT                   /db_xref="InterPro:IPR027329"
FT                   /db_xref="InterPro:IPR027330"
FT                   /db_xref="MGI:MGI:1919369"
FT                   /db_xref="UniProtKB/Swiss-Prot:A2APB8"
FT                   /protein_id="EDL05994.1"
FT                   /translation="MSQVPTTYSFDAPTDFINFSSLDAEEDTENIDSWFDEKANLENKF
FT                   LRQRGIGEPFQGKNSLRKAKLQQGFVTPLKAVDNTYHKETEKENLQKQSIPSNDCSSLD
FT                   AKRAVSGNTPVQPQRRSIRLSAQKDLEQKEKNHVASVEMKAKRCVAPATDCPPQKRMKV
FT                   SHKKKLEEEEEGSAPATSRKNERETLEKAKGKHTVPGVPPAREKVLKSTEEQEIEKRLR
FT                   MQQEVVELRRKNEEFKKLALAGPGQPVKKSTSQVTKTVDFHFLTDERIKQHPKNQEEYK
FT                   EVNFMSELRKHSSTPARGTRGCTIIKPFNLSKGKKRTFDEAASTYVPIAQQVEAFHKRT
FT                   PNRYHLRNKKDESLLPSKSVNKIARDPQTPILQTKYRTRAVTCKSTAEQEAEELEKLQQ
FT                   YKFKARELDPRIFESGPILPKRAPVKPPTQPVGFDLEIEKRIHERESKKKTEDEQFEFH
FT                   SRPCPTKILEDVVGVPEKKVIPATVPKSPVFALKNRIRVPIKDEEEEKPVVIKAQPVPH
FT                   YGVPYKPHIAEARNVEVCPFSFDTRDKERQLQKEKKIKEMQKGEVPKFKALPVPHFDTI
FT                   NLPEKKVKNVTQAEPFSLETDKRGAYKAEMWKHQLEEEQKQQKDAACFKARPNTVIFQE
FT                   PFVPKKEKKSLAENPSGSLVQEPFQLATERRAKERQELEKKMAEVEAWKLQQLEEVRQQ
FT                   EEEQQKEELARLRKELVHKANPIRKYAAVEVKSSELPLTVPVSPKFSTRFQ"
FT   assembly_gap    1452709..1452728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1453791..1453810
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1474714..1474733
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1483789..1495573
FT                   /locus_tag="mCG_3723"
FT                   /note="gene_id=mCG3723.2"
FT   mRNA            join(1483789..1484038,1484479..1484953,1485870..1486165,
FT                   1487555..1487660,1488076..1488169,1489775..1489884,
FT                   1489966..1490107,1491590..1491660,1491815..1491943,
FT                   1492798..1492950,1493033..1493165,1494588..1495573)
FT                   /locus_tag="mCG_3723"
FT                   /product="mCG3723"
FT                   /note="gene_id=mCG3723.2 transcript_id=mCT2823.2 created on
FT                   24-JUL-2002"
FT   CDS             join(1483987..1484038,1484479..1484953,1485870..1486165,
FT                   1487555..1487660,1488076..1488169,1489775..1489884,
FT                   1489966..1490107,1491590..1491660,1491815..1491943,
FT                   1492798..1492950,1493033..1493165,1494588..1494668)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3723"
FT                   /product="mCG3723"
FT                   /note="gene_id=mCG3723.2 transcript_id=mCT2823.2
FT                   protein_id=mCP7975.2"
FT                   /db_xref="GOA:B2RXZ9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020636"
FT                   /db_xref="MGI:MGI:2139434"
FT                   /db_xref="UniProtKB/TrEMBL:B2RXZ9"
FT                   /protein_id="EDL05998.1"
FT                   /translation="MTTENGAVELGSQSLSTEQTPKAAAGDGPSASEKEPSAPATEKDL
FT                   SPPNAKKDPGAPDPKNNPDPPSLKKDPAKAPGPEKKGDPVPASASSQGPSGEGDGGGGP
FT                   AEGSEGPPAALPLPTATAEASIQKLDPTQAPSGNQGSGEAKAGKKAAECREAGRRGSPA
FT                   FLHSPSCPAIISCSEKTLAVKPLSETTDLVFTGVSVTPDPQDPGPVKAGGTNALAEKKK
FT                   EEAEKASGQAGQAKAQGDTPQRIGFQAVPSERVEVGQALCLTAREEDCFQILDDCPPPP
FT                   APFPHRIVELRTGNVNSEFSMNSKEALGGGKFGAVCTCTERATGLKLAAKVIKKQTPKD
FT                   KEMVLLEIEVMNQLNHRNLIQLYAAIETSHEIILFMEYIEGGELFERIVDEDYHLTEVD
FT                   TMVFVRQICDGILFMHKMRVLHLDLKPENILCVNTTGHLVKIIDFGLARRYNPNEKLKV
FT                   NFGTPEFLSPEVVNYDQISDKTDMWSLGVITYMLLSGLSPFLGDDDTETLNNVLSANWY
FT                   FDEETFEAVSDEAKDFVSNLLTKDQSARMSAEQCLAHPWLNNLAEKAKRCNRRLKSQIL
FT                   LKKYLMKRRWKKNFIAVSAANRFKKISSSGALMALGV"
FT   assembly_gap    1491675..1491779
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            complement(1504410..>1505722)
FT                   /gene="Fkhl18"
FT                   /locus_tag="mCG_1027892"
FT                   /note="gene_id=mCG1027892.1"
FT   mRNA            complement(1504410..>1505722)
FT                   /gene="Fkhl18"
FT                   /locus_tag="mCG_1027892"
FT                   /product="forkhead-like 18 (Drosophila)"
FT                   /note="gene_id=mCG1027892.1 transcript_id=mCT145596.1
FT                   created on 24-JUL-2002"
FT   CDS             complement(1504655..>1505719)
FT                   /codon_start=1
FT                   /gene="Fkhl18"
FT                   /locus_tag="mCG_1027892"
FT                   /product="forkhead-like 18 (Drosophila)"
FT                   /note="gene_id=mCG1027892.1 transcript_id=mCT145596.1
FT                   protein_id=mCP73010.1"
FT                   /protein_id="EDL05999.1"
FT                   /translation="QPGQPVQIASSEYRAWLCGVSNTASMQKQPSPESLAPSAEPTKPP
FT                   YSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKV
FT                   PRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRRRRFTKRTGAQGTKGPVKIDHRPHRATS
FT                   PDPGAPKTTTGRLCPFPQEVPNPKGLSFEGLMGSLPANMSSTTSDVRPQLPTGPKEMCS
FT                   AKSGGPRELSEATSPSPCPAFGFSSAFSDAESLGKAPTPGVAPESVGSSYQCRMQTLNF
FT                   CMGTDPGLEHLLVSSVPTPGSSTPSASHRAPLPLPADSKEPWVAGSFPVQGGSGYPLGL
FT                   PPCLYRTPGMFFFE"
FT   gene            complement(1513538..>1514675)
FT                   /locus_tag="mCG_1027971"
FT                   /note="gene_id=mCG1027971.1"
FT   mRNA            complement(1513538..>1514261)
FT                   /locus_tag="mCG_1027971"
FT                   /product="mCG1027971, transcript variant mCT170922"
FT                   /note="gene_id=mCG1027971.1 transcript_id=mCT170922.0
FT                   created on 24-JUL-2002"
FT   mRNA            complement(join(<1513549..1513767,1514603..>1514675))
FT                   /locus_tag="mCG_1027971"
FT                   /product="mCG1027971, transcript variant mCT145675"
FT                   /note="gene_id=mCG1027971.1 transcript_id=mCT145675.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(1513549..1513767,1514603..>1514608))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027971"
FT                   /product="mCG1027971, isoform CRA_a"
FT                   /note="gene_id=mCG1027971.1 transcript_id=mCT145675.0
FT                   protein_id=mCP73161.0 isoform=CRA_a"
FT                   /protein_id="EDL06000.1"
FT                   /translation="KKLLAYGTKRKRNKNALPPVLVKGRPDSPPLSMLAGTAAALGDFF
FT                   FLLELQFYLQQGLGQPELLNTFHSANISS"
FT   CDS             complement(1513549..>1513800)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027971"
FT                   /product="mCG1027971, isoform CRA_b"
FT                   /note="gene_id=mCG1027971.1 transcript_id=mCT170922.0
FT                   protein_id=mCP93840.0 isoform=CRA_b"
FT                   /protein_id="EDL06001.1"
FT                   /translation="VDSVCMNFMGQLLAYGTKRKRNKNALPPVLVKGRPDSPPLSMLAG
FT                   TAAALGDFFFLLELQFYLQQGLGQPELLNTFHSANISS"
FT   gene            complement(1515425..>1524086)
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /note="gene_id=mCG3728.2"
FT   mRNA            complement(join(1515425..1515985,1516683..1516854,
FT                   1517959..1518033,1518820..1518869,1521566..1521648,
FT                   1523149..1523182,1523842..1524033))
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /product="dual specificity phosphatase-like 15, transcript
FT                   variant mCT2817"
FT                   /note="gene_id=mCG3728.2 transcript_id=mCT2817.2 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(1515713..1515985,1516683..1516854,
FT                   1517959..1518033,1518820..1518869,1521566..1521648,
FT                   1523149..1523182,1523842..1523862))
FT                   /codon_start=1
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /product="dual specificity phosphatase-like 15, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3728.2 transcript_id=mCT2817.2
FT                   protein_id=mCP7980.2 isoform=CRA_a"
FT                   /protein_id="EDL06002.1"
FT                   /translation="MGNGMTKVLPGLYLGNFIDAKDPDQLGRNKITHIISIHESPQPLL
FT                   QDITYLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVHCFAGISRSTTIVIAYVM
FT                   TVTGLGWQEVLEAIKASRPIANPNPGFRQQLEEFGWANSQKLRRQLEERFGEIPFRDEE
FT                   DLRALLPLCRRCRQGSATSAASATTASSAAEGTLQRLVPRSPRDSHQPLPLLARVKQTF
FT                   FCLPRCLSRKGGK"
FT   mRNA            complement(join(<1517959..1518033,1518820..1518869,
FT                   1521566..1521648,1523842..>1524086))
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /product="dual specificity phosphatase-like 15, transcript
FT                   variant mCT170938"
FT                   /note="gene_id=mCG3728.2 transcript_id=mCT170938.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(join(<1517959..1518033,1518820..1518869,
FT                   1521566..1521648,1523842..>1523914))
FT                   /codon_start=1
FT                   /gene="Dusp15"
FT                   /locus_tag="mCG_3728"
FT                   /product="dual specificity phosphatase-like 15, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3728.2 transcript_id=mCT170938.0
FT                   protein_id=mCP93856.0 isoform=CRA_b"
FT                   /protein_id="EDL06003.1"
FT                   /translation="RLEGAKIGVRPATLPQDHGEWHDQDAKDPDQLGRNKITHIISIHE
FT                   SPQPLLQDITYLRISVSDTPEVPIKKHFKECVHFIHSCRLNGGNCLVH"
FT   gene            1534955..1591344
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /note="gene_id=mCG140714.0"
FT   mRNA            join(1534955..1535081,1545056..1545099,1548915..1549007,
FT                   1555806..1555917,1556887..1557072,1573588..1573656,
FT                   1574018..1574092,1575571..1575661,1577162..1577202,
FT                   1578049..1578136,1583312..1583370,1584114..1584310,
FT                   1586208..1586321,1586862..1587194)
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /product="tubulin tyrosine ligase like family 9, transcript
FT                   variant mCT170926"
FT                   /note="gene_id=mCG140714.0 transcript_id=mCT170926.0
FT                   created on 24-JUL-2002"
FT   mRNA            join(<1535031..1535081,1545056..1545099,1548915..1549007,
FT                   1555806..1555917,1556887..1557072,1573588..1573656,
FT                   1574018..1574092,1575571..1575661,1577162..1577202,
FT                   1578049..1578136,1583312..1583370,1584114..1584310,
FT                   1586208..1586321,1586862..1586986,1590855..1591344)
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /product="tubulin tyrosine ligase like family 9, transcript
FT                   variant mCT170927"
FT                   /note="gene_id=mCG140714.0 transcript_id=mCT170927.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<1535034..1535081,1545056..1545099,1548915..1549007,
FT                   1555806..1555917,1556887..1557072,1573588..1573656,
FT                   1574018..1574092,1575571..1575661,1577162..1577202,
FT                   1578049..1578136,1583312..1583370,1584114..1584310,
FT                   1586208..1586321,1586862..1586986,1590855..1590931)
FT                   /codon_start=1
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /product="tubulin tyrosine ligase like family 9, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG140714.0 transcript_id=mCT170927.0
FT                   protein_id=mCP93846.0 isoform=CRA_a"
FT                   /protein_id="EDL06004.1"
FT                   /translation="GARGGLVWAQLMSRQKNQNSKGHGVSKGKEREQRTLIRFKTTLMN
FT                   TLMDVLRHRPGWVEVKDEGEWDFYWCDVSWLRENFDHTYMDEHVRISHFRNHYELTRKN
FT                   YMVKNLKRFRKYLERESGKTEAAKCDFFPKTFEMPCEYHLFVEEFRKNPGITWIMKPVA
FT                   RSQGKGIFLFRRLKDIMDWRKGTSGKKPTGVETQPARANMNPSGSHDTRSSDDQKDDLP
FT                   VENYVAQRYVENPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDD
FT                   HYVHLTNVAVQKTSPDYHLKKGCKWMLQRFRQYLASKHGPKAVETLFSDMDNIFIKSLQ
FT                   SVQKVIISDKHCFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLH
FT                   VVDMEARLTGKEKRVGGFDLMWNDGPVSREDGPSDLSGMGNFVTNTHLGCVNDRKEQLR
FT                   QLFRSLQAQRKAPS"
FT   CDS             join(1535067..1535081,1545056..1545099,1548915..1549007,
FT                   1555806..1555917,1556887..1557072,1573588..1573656,
FT                   1574018..1574092,1575571..1575661,1577162..1577202,
FT                   1578049..1578136,1583312..1583370,1584114..1584310,
FT                   1586208..1586321,1586862..1587072)
FT                   /codon_start=1
FT                   /gene="Ttll9"
FT                   /locus_tag="mCG_140714"
FT                   /product="tubulin tyrosine ligase like family 9, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG140714.0 transcript_id=mCT170926.0
FT                   protein_id=mCP93844.0 isoform=CRA_b"
FT                   /protein_id="EDL06005.1"
FT                   /translation="MSRQKNQNSKGHGVSKGKEREQRTLIRFKTTLMNTLMDVLRHRPG
FT                   WVEVKDEGEWDFYWCDVSWLRENFDHTYMDEHVRISHFRNHYELTRKNYMVKNLKRFRK
FT                   YLERESGKTEAAKCDFFPKTFEMPCEYHLFVEEFRKNPGITWIMKPVARSQGKGIFLFR
FT                   RLKDIMDWRKGTSGKKPTGVETQPARANMNPSGSHDTRSSDDQKDDLPVENYVAQRYVE
FT                   NPYLIGGRKFDLRVYVLVMSYIPLRAWLYRDGFARFSNTRFTLNSIDDHYVHLTNVAVQ
FT                   KTSPDYHLKKGCKWMLQRFRQYLASKHGPKAVETLFSDMDNIFIKSLQSVQKVIISDKH
FT                   CFELYGYDILIDQDLKPWLLEVNASPSLTASSQEDYELKTCLLEDTLHVVDMEARLTGK
FT                   EKRVGGFDLMWNDGPVSREDGPSDLSGMGNFVTNTHLGTLSQTGSEWERNIIGSGGGLG
FT                   PLGRAV"
FT   assembly_gap    1536464..1536835
FT                   /estimated_length=372
FT                   /gap_type="unknown"
FT   assembly_gap    1543440..1544010
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    1549362..1549441
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    1558178..1558422
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    1561515..1561534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1562628..1571271
FT                   /estimated_length=8644
FT                   /gap_type="unknown"
FT   assembly_gap    1572330..1572349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1578157..1578229
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1584577..1585195
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   gene            complement(1592833..1599346)
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /note="gene_id=mCG3726.1"
FT   mRNA            complement(join(1592833..1593680,1594202..1594282,
FT                   1596325..1596399,1597954..1598029,1599189..1599346))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT2815"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT2815.2 created on
FT                   10-JAN-2003"
FT   mRNA            complement(join(1592836..1593680,1594202..1594282,
FT                   1596325..1596399,1597954..1598029,1599163..>1599245))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT170931"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170931.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(1593256..1593680,1594202..1594282,
FT                   1596325..1596396,1597954..1598029,1599189..>1599262))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT170932"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170932.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(1593337..1593680,1594202..1594282,
FT                   1597954..1598029,1599189..>1599285))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT170933"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170933.0 created
FT                   on 10-JAN-2003"
FT   mRNA            complement(join(1593448..1593680,1594202..1594282,
FT                   1596325..1596396,1597961..1598029,1599189..>1599291))
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, transcript
FT                   variant mCT178304"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT178304.0 created
FT                   on 10-JAN-2003"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1596325..1596396,1597961..1598029,1599189..>1599291))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_c"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT178304.0
FT                   protein_id=mCP101226.0 isoform=CRA_c"
FT                   /protein_id="EDL06008.1"
FT                   /translation="RGAWHHAVPRGGAGAAVPGRSRGVGRGRAVGQAADCRPGHQEESE
FT                   PRGPEGPTEGPEYVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRL
FT                   FEAQGKPELKGFNLNPLSPDEVKALKVILKG"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1597954..1598029,1599189..>1599284))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_b"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170933.0
FT                   protein_id=mCP93850.0 isoform=CRA_b"
FT                   /protein_id="EDL06007.1"
FT                   /translation="RGTMLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNRE
FT                   GLRALQKDLSVSDQEHLDKEIERLRSQLKVKVNRLFEAQGKPELKGFNLNPLSPDEVKA
FT                   LKVILKG"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1596325..1596399,1597954..1598029,1599189..1599275))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_d"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT2815.2
FT                   protein_id=mCP7978.2 isoform=CRA_d"
FT                   /db_xref="GOA:Q3UKN2"
FT                   /db_xref="InterPro:IPR002777"
FT                   /db_xref="InterPro:IPR030482"
FT                   /db_xref="MGI:MGI:1915809"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UKN2"
FT                   /protein_id="EDL06009.1"
FT                   /translation="MLSPEAERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLR
FT                   ALQKDLSVSEDVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFE
FT                   AQGKPELKGFNLNPLSPDEVKALKVILKG"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1596325..1596396,1597954..1598029,1599189..>1599260))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_a"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170932.0
FT                   protein_id=mCP93849.0 isoform=CRA_a"
FT                   /protein_id="EDL06006.1"
FT                   /translation="AERVLRYLVEVEELAEAVLSDKRQIVDLDTKRNQNREGLRALQKD
FT                   LSVSDVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFEAQGKPE
FT                   LKGFNLNPLSPDEVKALKVILKG"
FT   CDS             complement(join(1593598..1593680,1594202..1594282,
FT                   1596325..1596399,1597954..1598029,1599163..>1599243))
FT                   /codon_start=1
FT                   /gene="Pdrg1"
FT                   /locus_tag="mCG_3726"
FT                   /product="p53 and DNA damage regulated 1, isoform CRA_e"
FT                   /note="gene_id=mCG3726.1 transcript_id=mCT170931.0
FT                   protein_id=mCP93851.0 isoform=CRA_e"
FT                   /protein_id="EDL06010.1"
FT                   /translation="VPGRSRGVGRGRAVGQAAGERRGGCERIVDLDTKRNQNREGLRAL
FT                   QKDLSVSEDVMVCFGNMFIKMPHPKTKEMIQKDQEHLDKEIERLRSQLKVKVNRLFEAQ
FT                   GKPELKGFNLNPLSPDEVKALKVILKG"
FT   assembly_gap    1605618..1605765
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    1607469..1607488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1609127..1609146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1610734..1611091
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    1612198..1612217
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1617782..>1640535
FT                   /gene="Xkr7"
FT                   /locus_tag="mCG_140715"
FT                   /note="gene_id=mCG140715.0"
FT   mRNA            join(<1617782..1618206,1638276..1638478,1639580..>1640535)
FT                   /gene="Xkr7"
FT                   /locus_tag="mCG_140715"
FT                   /product="X Kell blood group precursor related family
FT                   member 7 homolog"
FT                   /note="gene_id=mCG140715.0 transcript_id=mCT170928.0
FT                   created on 24-JUL-2002"
FT   CDS             join(<1617782..1618206,1638276..1638478,1639580..1640535)
FT                   /codon_start=1
FT                   /gene="Xkr7"
FT                   /locus_tag="mCG_140715"
FT                   /product="X Kell blood group precursor related family
FT                   member 7 homolog"
FT                   /note="gene_id=mCG140715.0 transcript_id=mCT170928.0
FT                   protein_id=mCP93845.0"
FT                   /protein_id="EDL06011.1"
FT                   /translation="LRDCCWVLCALLVFFSDGATDLWLAASYYLQGQSTYFGLTLLFVL
FT                   LPSLVVQLLSFRWFVYDYSEPAGTPGPAVSTKDSDIVGAAISTKDSAVAFRTKEGSAEL
FT                   VPRPAPSSAGTYRRRCCRLCVWLLQTLVHLLQLGQVWRYLRALYLGLQSRWRGERLRRH
FT                   FYWQMLFESADVSMLRLLETFLRSAPQLVLQLSLLVHRGREPELLTALSISASLVSLAW
FT                   TLASYQKVLRDSRDDKRPLSYKGAVVQVLWHLFTIAARTLAFALFASVYKLYFGIFIVA
FT                   HWCIMTFWVIQGETDFCMSKWEEIIYNMVVGIIYIFCWFNVKEGRSRRRVTLYYCIVLL
FT                   ENAALTGFWYSSRNFSTDFYSLILVCVVASSFALGIFFMCVYYCLLHPNGPMLGPQAPG
FT                   CIFPEAPGPCGPPADAITSPPRSLPRTTGTERDGVAVGGERAGTPTLPVFQVRPGLPPT
FT                   PVARPLRTEGPVIRIDLPRKKYPAWDAHFIDRRLRKTILALEYSSPATPRLQYRSMGTS
FT                   QELLEYETTV"
FT   assembly_gap    1640585..1640613
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            <1651519..1667972
FT                   /gene="BC020535"
FT                   /locus_tag="mCG_119792"
FT                   /note="gene_id=mCG119792.1"
FT   mRNA            join(<1651519..1651601,1653402..1653569,1656314..1656397,
FT                   1656495..1656689,1657431..1657885,1660560..1660698,
FT                   1665094..1665223,1666006..1666144,1667128..1667972)
FT                   /gene="BC020535"
FT                   /locus_tag="mCG_119792"
FT                   /product="cDNA sequence BC020535"
FT                   /note="gene_id=mCG119792.1 transcript_id=mCT120970.1
FT                   created on 24-JUL-2002"
FT   assembly_gap    1653249..1653325
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   CDS             join(<1656674..1656689,1657431..1657885,1660560..1660698,
FT                   1665094..1665223,1666006..1666144,1667128..1667247)
FT                   /codon_start=1
FT                   /gene="BC020535"
FT                   /locus_tag="mCG_119792"
FT                   /product="cDNA sequence BC020535"
FT                   /note="gene_id=mCG119792.1 transcript_id=mCT120970.1
FT                   protein_id=mCP72960.1"
FT                   /protein_id="EDL06012.1"
FT                   /translation="DWCGAGLGVDPVPAGMDGSPGGSGRDPGPPGAAPEKRRVGTAERR
FT                   HTICSLDWRVAWGGGAGAEARAAGGGGSLERQRAGARASGSWERRQTFSGSWERRHAGG
FT                   GAGKPGGSWERRQASGGVGGSWERRHPGPNPLDPQNHSPDAYCNLVILAVANRDAAEES
FT                   CALICQVFQIIYGDQSIECVDRAGYHYRSTPKRPWLSSCSAMAPRTHLKRATVAHPHRL
FT                   STAPTAAVSTTAAGPSSSYRITWSRCGVSWVLLRSSSLHCCYETIAWGCLSRTTVQVCR
FT                   NSMGTDGSSFSLECGPSSQIRTSATSRASWRVWVSARAESSPTASAASSGA"
FT   assembly_gap    1658759..1658778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662087..1662106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1662733..1663880
FT                   /estimated_length=1148
FT                   /gap_type="unknown"
FT   assembly_gap    1666277..1666296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1688863..1732539
FT                   /gene="Hck"
FT                   /locus_tag="mCG_119794"
FT                   /note="gene_id=mCG119794.0"
FT   mRNA            join(1688863..1689787,1705213..1705330,1709321..1709363,
FT                   1710101..1710200,1710899..1710997,1712259..1712362,
FT                   1715083..1715232,1715638..1715790,1717721..1717900,
FT                   1719286..1719362,1725431..1725584,1729978..1730109,
FT                   1732048..1732539)
FT                   /gene="Hck"
FT                   /locus_tag="mCG_119794"
FT                   /product="hemopoietic cell kinase"
FT                   /note="gene_id=mCG119794.0 transcript_id=mCT120972.0
FT                   created on 24-JUL-2002"
FT   CDS             join(1705214..1705330,1709321..1709363,1710101..1710200,
FT                   1710899..1710997,1712259..1712362,1715083..1715232,
FT                   1715638..1715790,1717721..1717900,1719286..1719362,
FT                   1725431..1725584,1729978..1730109,1732048..1732250)
FT                   /codon_start=1
FT                   /gene="Hck"
FT                   /locus_tag="mCG_119794"
FT                   /product="hemopoietic cell kinase"
FT                   /note="gene_id=mCG119794.0 transcript_id=mCT120972.0
FT                   protein_id=mCP72988.1"
FT                   /protein_id="EDL06013.1"
FT                   /translation="MGCVKSRFLRDGSKASKTEPSANQKGPVYVPDPTSSSKLGPNNSN
FT                   SMPPGFVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEEAGEWWKARSLATKKEGY
FT                   IPSNYVARVNSLETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSLSVRD
FT                   FDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVLHYKKGKDGLCQKLSVPCVSPK
FT                   PQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAFLA
FT                   EANLMKSLQHDKLVKLHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFSA
FT                   QISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
FT                   WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDN
FT                   CPEELYNIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP"
FT   gene            1742308..1792078
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /note="gene_id=mCG10481.2"
FT   mRNA            join(1742308..1742578,1759682..1759795,1763181..1763280,
FT                   1768051..1768219,1768319..1768451,1769742..1769865,
FT                   1771619..1771737,1771839..1771950,1772718..1772788,
FT                   1775070..1775202,1776102..1776183,1776281..1776356,
FT                   1779138..1779221,1781433..1781608,1783132..1783195,
FT                   1784574..1784693,1785327..1785416,1790209..1792078)
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   transcript variant mCT11069"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT11069.2 created
FT                   on 04-APR-2003"
FT   mRNA            join(1742308..1742578,1759682..1759795,1763181..1763280,
FT                   1768051..1768219,1768319..1768451,1769742..1769865,
FT                   1771619..1771737,1771839..1771950,1772718..1772788,
FT                   1775070..1775202,1776102..1776183,1776281..1776356,
FT                   1779138..1779221,1781433..1781608,1783132..1783195,
FT                   1784574..1784693,1785327..1785654)
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   transcript variant mCT181612"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT181612.0 created
FT                   on 04-APR-2003"
FT   CDS             join(1742564..1742578,1759682..1759795,1763181..1763280,
FT                   1768051..1768219,1768319..1768451,1769742..1769865,
FT                   1771619..1771737,1771839..1771950,1772718..1772788,
FT                   1775070..1775202,1776102..1776183,1776281..1776356,
FT                   1779138..1779221,1781433..1781608,1783132..1783195,
FT                   1784574..1784693,1785327..1785416,1790209..1790358)
FT                   /codon_start=1
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT11069.2
FT                   protein_id=mCP18241.1 isoform=CRA_b"
FT                   /protein_id="EDL06015.1"
FT                   /translation="MAAAMIWWPRFLLLLCLTCKGSTFYVPGVAPINFHQNDPVEIKAV
FT                   KLTSSRTQLPYEYYSLPFCQPIKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLC
FT                   NQSNKPITLTVEQSRLVAERITEEYYVHLIADNLPVATRLELYSSNRDSDDKKKEKDVQ
FT                   FEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKT
FT                   GEKSSCTLPEGANSLPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHW
FT                   FSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQ
FT                   YPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAG
FT                   RLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWF
FT                   GISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFI
FT                   ELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVS
FT                   GGSAFYVLVYAIFYFVNKLDIVEFIPSLLYFGYTTLMVLSFWLLTGTIGFYAAYMFVRK
FT                   IYAAVKID"
FT   CDS             join(1742564..1742578,1759682..1759795,1763181..1763280,
FT                   1768051..1768219,1768319..1768451,1769742..1769865,
FT                   1771619..1771737,1771839..1771950,1772718..1772788,
FT                   1775070..1775202,1776102..1776183,1776281..1776356,
FT                   1779138..1779221,1781433..1781608,1783132..1783195,
FT                   1784574..1784693,1785327..1785443)
FT                   /codon_start=1
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT181612.0
FT                   protein_id=mCP104534.0 isoform=CRA_c"
FT                   /protein_id="EDL06016.1"
FT                   /translation="MAAAMIWWPRFLLLLCLTCKGSTFYVPGVAPINFHQNDPVEIKAV
FT                   KLTSSRTQLPYEYYSLPFCQPIKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLC
FT                   NQSNKPITLTVEQSRLVAERITEEYYVHLIADNLPVATRLELYSSNRDSDDKKKEKDVQ
FT                   FEHGYRLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFEVIPQSIRLEDLKT
FT                   GEKSSCTLPEGANSLPQEIDPTKENQLYFTYSVHWEESDIKWASRWDTYLTMSDVQIHW
FT                   FSIINSVVVVFFLSGILSMIIIRTLRKDIANYNKEDDIEDTMEESGWKLVHGDVFRPPQ
FT                   YPMILSSLLGSGIQLFCMILIVIFVAMLGMLSPSSRGALMTTACFLFMFMGVFGGFSAG
FT                   RLYRTLKGHRWKKGAFCTATLYPGVVFGICFVLNCFIWGKHSSGAVPFPTMVALLCMWF
FT                   GISLPLVYLGYYFGFRKQPYDNPVRTNQIPRQIPEQRWYMNRFVGILMAGILPFGAMFI
FT                   ELFFIFSAIWENQFYYLFGFLFLVFIILVVSCSQISIVMVYFQLCAEDYRWWWRNFLVS
FT                   GGSAFYVLVYAIFYFVNKVLPSQRSP"
FT   mRNA            join(<1759682..1759795,1763181..1763280,1768051..1768219,
FT                   1768319..1768451,1769742..1769837,1771619..1771737,
FT                   1771839..1771950,1772718..1774324)
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   transcript variant mCT181613"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT181613.0 created
FT                   on 04-APR-2003"
FT   CDS             join(<1759682..1759795,1763181..1763280,1768051..1768219,
FT                   1768319..1768451,1769742..1769837,1771619..1771737,
FT                   1771839..1771881)
FT                   /codon_start=1
FT                   /gene="Tm9sf4"
FT                   /locus_tag="mCG_10481"
FT                   /product="transmembrane 9 superfamily protein member 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG10481.2 transcript_id=mCT181613.0
FT                   protein_id=mCP104535.0 isoform=CRA_a"
FT                   /protein_id="EDL06014.1"
FT                   /translation="IWWPRFLLLLCLTCKGSTFYVPGVAPINFHQNDPVEIKAVKLTSS
FT                   RTQLPYEYYSLPFCQPIKITYKAENLGEVLRGDRIVNTPFQVLMNSEKKCEVLCNQSNK
FT                   PITLTVEQSRLVAERITEEYYVHLIADNLPVATRLELYSSNRDSDDKKKEKDVQFEHGY
FT                   RLGFTDVNKIYLHNHLSFILYYHREDMEEDQEHTYRVVRFETSKQARRVHVPYPRVPTP
FT                   YPKKLTPLRRISCTSPTLCTGRKVTSNGPLDGTLT"
FT   gene            complement(1777485..>1777811)
FT                   /locus_tag="mCG_140712"
FT                   /note="gene_id=mCG140712.0"
FT   mRNA            complement(1777485..>1777811)
FT                   /locus_tag="mCG_140712"
FT                   /product="mCG140712"
FT                   /note="gene_id=mCG140712.0 transcript_id=mCT170923.0
FT                   created on 25-JUL-2002"
FT   CDS             complement(1777555..>1777809)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140712"
FT                   /product="mCG140712"
FT                   /note="gene_id=mCG140712.0 transcript_id=mCT170923.0
FT                   protein_id=mCP93841.0"
FT                   /protein_id="EDL06017.1"
FT                   /translation="SPKLRVSTLSIRHPTNMDQVMQFVEPSRQFVKDSIRMVKRCTKPD
FT                   RKEFQKIAMATAIGFAIMGFIGFFVKLIHILINNIIVGD"
FT   assembly_gap    1786943..1786962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1801795..1801814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1804629..>1807683)
FT                   /locus_tag="mCG_49000"
FT                   /note="gene_id=mCG49000.1"
FT   mRNA            complement(1804629..>1807683)
FT                   /locus_tag="mCG_49000"
FT                   /product="mCG49000"
FT                   /note="gene_id=mCG49000.1 transcript_id=mCT49183.2 created
FT                   on 25-JUL-2002"
FT   CDS             complement(1806560..>1807567)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49000"
FT                   /product="mCG49000"
FT                   /note="gene_id=mCG49000.1 transcript_id=mCT49183.2
FT                   protein_id=mCP38872.2"
FT                   /protein_id="EDL06018.1"
FT                   /translation="VMAWEGIGVLEATMCLPPIQERDAHPARPRVPGAEPLRPCNPAAS
FT                   PATAPPSSENTGENSASRVLNLDGCEKGSGNGVGTKGKTEEVTTEEDSVAAEEPAEVGE
FT                   KLEWVAEAQESLRPLDLRALIVDPLEAIQWELEAMSAQADGAHLQLVRRFGRMRRLHLA
FT                   RRSFIIQNIPGFWVTAFLNHPQLSAMISPRDEDMLGYLMNLEVRELRHSRTGCKFKFLF
FT                   ESNPYFRNEVIVKEYECRASGGVVSIATRILWHRGQEPPALVHRNRDAVRSFFSWFSQH
FT                   SLLEADRVAQIIKDDLWPNPLQYYLLGQRPYRARRSLARWSAEARPRPYGFQSG"
FT   gene            complement(1810005..1823607)
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /note="gene_id=mCG10468.3"
FT   mRNA            complement(join(1810005..1814957,1818042..1818414,
FT                   1823518..1823606))
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /product="pleiomorphic adenoma gene-like 2, transcript
FT                   variant mCT11055"
FT                   /note="gene_id=mCG10468.3 transcript_id=mCT11055.2 created
FT                   on 24-DEC-2002"
FT   mRNA            complement(join(1810670..1812816,1814749..1814957,
FT                   1818042..1818414,1823518..1823607))
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /product="pleiomorphic adenoma gene-like 2, transcript
FT                   variant mCT177787"
FT                   /note="gene_id=mCG10468.3 transcript_id=mCT177787.0 created
FT                   on 24-DEC-2002"
FT   CDS             complement(join(1812782..1812816,1814749..1814957,
FT                   1818042..1818301))
FT                   /codon_start=1
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /product="pleiomorphic adenoma gene-like 2, isoform CRA_b"
FT                   /note="gene_id=mCG10468.3 transcript_id=mCT177787.0
FT                   protein_id=mCP100709.0 isoform=CRA_b"
FT                   /protein_id="EDL06020.1"
FT                   /translation="MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEIS
FT                   GTPFSNGEKLRPHSLPHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCD
FT                   KMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSLQFGFS
FT                   PSTS"
FT   CDS             complement(join(1813727..1814957,1818042..1818301))
FT                   /codon_start=1
FT                   /gene="Plagl2"
FT                   /locus_tag="mCG_10468"
FT                   /product="pleiomorphic adenoma gene-like 2, isoform CRA_a"
FT                   /note="gene_id=mCG10468.3 transcript_id=mCT11055.2
FT                   protein_id=mCP18242.2 isoform=CRA_a"
FT                   /protein_id="EDL06019.1"
FT                   /translation="MTTFFTSVPPWIQDAKQEEEVGWKLVPRPRGREAESQVKCQCEIS
FT                   GTPFSNGEKLRPHSLPHPEQRPYSCPQLHCGKAFASKYKLYRHMATHSAQKPHQCMYCD
FT                   KMFHRKDHLRNHLQTHDPNKEALHCSECGKNYNTKLGYRRHLAMHAASSGDLSCKVCLQ
FT                   TFENTQALLEHLKAHSRRVAGGAKEKKHPCDHCDRRFYTRKDVRRHLVVHTGRKDFLCQ
FT                   YCAQRFGRKDHLTRHVKKSHSQELLKIKTEPVDMLGLLSCSSTVSVKEELSPVLCMASR
FT                   DVMGAKAFPGMLPMGMYGAHIPTMPSAGMPHSLVHNTLPMGMSYPLESSPISSSAQLPP
FT                   KYQLGSTSYLPDKLPKVEVDSFLAELPGSLSLSSAEPQPASPQPAAAAALLDEALLAKS
FT                   PANLSEALCAANVDFSHLLGFLPLNLPPCNPPGATGGLVMGYSQAEAQPLLTTLQAQPQ
FT                   DSAGAGGPLNFGPLHSLPPVFTSGLSTTTLPRFHQAFQ"
FT   gene            1823795..1848230
FT                   /gene="Pofut1"
FT                   /locus_tag="mCG_10480"
FT                   /note="gene_id=mCG10480.2"
FT   mRNA            join(1823795..1823967,1825881..1826002,1830692..1830874,
FT                   1831924..1832036,1841834..1842026,1843450..1843692,
FT                   1847946..1848230)
FT                   /gene="Pofut1"
FT                   /locus_tag="mCG_10480"
FT                   /product="protein O-fucosyltransferase 1"
FT                   /note="gene_id=mCG10480.2 transcript_id=mCT11068.2 created
FT                   on 25-JUL-2002"
FT   CDS             join(1823829..1823967,1825881..1826002,1830692..1830874,
FT                   1831924..1832036,1841834..1842026,1843450..1843692,
FT                   1847946..1848134)
FT                   /codon_start=1
FT                   /gene="Pofut1"
FT                   /locus_tag="mCG_10480"
FT                   /product="protein O-fucosyltransferase 1"
FT                   /note="gene_id=mCG10480.2 transcript_id=mCT11068.2
FT                   protein_id=mCP18253.2"
FT                   /protein_id="EDL06021.1"
FT                   /translation="MGAAAWAPPHLLLRASFLLLLLLLPLRGRSAGSWDLAGYLLYCPC
FT                   MGRFGNQADHFLGSLAFAKLLNRTLAVPPWIEYQHHKPPFTNLHVSYQKYFKLEPLQAY
FT                   HRVVSLEDFMENLAPSHWPPEKRVAYCFEVAAQRSPDKKTCPMKEGNPFGPFWDQFHVS
FT                   FNKSELFTGISFSASYKEQWTQRFPAKEHPVLALPGAPAQFPVLEEHRELQKYMVWSDE
FT                   MVRTGEALISAHLVRPYVGIHLRIGSDWKNACAMLKDGTAGSHFMASPQCVGYSRSTAT
FT                   PLTMTMCLPDLKEIQRAVTLWVRALNARSVYIATDSESYVSEIQQLFKDKVRVVSLKPE
FT                   VAQIDLYILGQADHFIGNCVSSFTAFVKRERDLHGRQSSFFGMDRPSQLRDEF"
FT   assembly_gap    1857970..1860809
FT                   /estimated_length=2840
FT                   /gap_type="unknown"
FT   gene            1873070..1928291
FT                   /gene="Kif3b"
FT                   /locus_tag="mCG_119797"
FT                   /note="gene_id=mCG119797.0"
FT   mRNA            join(1873070..1873141,1911060..1912527,1915119..1915220,
FT                   1915423..1915545,1915629..1915747,1917694..1917807,
FT                   1918419..1918524,1924477..1924655,1924964..1928291)
FT                   /gene="Kif3b"
FT                   /locus_tag="mCG_119797"
FT                   /product="kinesin family member 3B"
FT                   /note="gene_id=mCG119797.0 transcript_id=mCT120975.1
FT                   created on 25-JUL-2002"
FT   assembly_gap    1881133..1881152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1882385..1882404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1889586..1889605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1890706..1890725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1895860..1896029
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    1897999..1900385
FT                   /estimated_length=2387
FT                   /gap_type="unknown"
FT   assembly_gap    1901960..1901979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1903012..1903031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1906312..1906331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(1911124..1912527,1915119..1915220,1915423..1915545,
FT                   1915629..1915747,1917694..1917807,1918419..1918524,
FT                   1924477..1924655,1924964..1925060)
FT                   /codon_start=1
FT                   /gene="Kif3b"
FT                   /locus_tag="mCG_119797"
FT                   /product="kinesin family member 3B"
FT                   /note="gene_id=mCG119797.0 transcript_id=mCT120975.1
FT                   protein_id=mCP73031.1"
FT                   /protein_id="EDL06022.1"
FT                   /translation="MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKN
FT                   PKGTSHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTY
FT                   TMEGVRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKR
FT                   LELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVIT
FT                   IECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISA
FT                   LVDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNI
FT                   KNKPRVNEDPKDALLREFQEEIARLKAQLEKRSIGRRKRREKRREGGGSGGGGEEEEEE
FT                   GEEGEEDGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKMRLLKEKEKKMEDLRREKD
FT                   AAEMLGAKIKAMESKLLVGGKNIVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRD
FT                   EETLELKETYTSLQQEVDIKTKKLKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNEL
FT                   TRELKLKHLIIENFIPLEEKNKIMNRSFFDDEEDHWKLHPITRLENQQMMKRPVSAVGY
FT                   KRPLSQHARMSMMIRPEPRYRAENIMLLELDMPSRTTRDYEGPAISPKVQAALDAALQD
FT                   EDEIQVDASSFESTANRKPKARPKSGRKSGSSSSSSGNPASQFYPQSRGLVPK"
FT   assembly_gap    1930738..1932271
FT                   /estimated_length=1534
FT                   /gap_type="unknown"
FT   assembly_gap    1933916..1934052
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            complement(1938304..>1943467)
FT                   /locus_tag="mCG_140752"
FT                   /note="gene_id=mCG140752.0"
FT   mRNA            complement(join(1938304..1940013,1942770..>1943467))
FT                   /locus_tag="mCG_140752"
FT                   /product="mCG140752, transcript variant mCT171251"
FT                   /note="gene_id=mCG140752.0 transcript_id=mCT171251.0
FT                   created on 29-JUL-2002"
FT   mRNA            complement(join(1939656..1940013,1940319..>1940436))
FT                   /locus_tag="mCG_140752"
FT                   /product="mCG140752, transcript variant mCT171252"
FT                   /note="gene_id=mCG140752.0 transcript_id=mCT171252.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(1939775..>1939972)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140752"
FT                   /product="mCG140752, isoform CRA_a"
FT                   /note="gene_id=mCG140752.0 transcript_id=mCT171252.0
FT                   protein_id=mCP94171.0 isoform=CRA_a"
FT                   /protein_id="EDL06023.1"
FT                   /translation="DKRNFCSTPPSLGMSHCFQIYEQSTQIKNNTSKKQQRGTKGHRIP
FT                   DPHCDLVTLVLGLEREMLRA"
FT   CDS             complement(join(1940010..1940013,1942770..>1943092))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140752"
FT                   /product="mCG140752, isoform CRA_b"
FT                   /note="gene_id=mCG140752.0 transcript_id=mCT171251.0
FT                   protein_id=mCP94170.0 isoform=CRA_b"
FT                   /protein_id="EDL06024.1"
FT                   /translation="WRAGPDGETRLSFRRSDACVSAVGMCVYVCARVCVREKSEEGECG
FT                   VFFFFEQKQTERVAGICSPHWLPGLPLSGRKWLPQVLGPHFPECPGLLFSAHFLPYPAA
FT                   LQAR"
FT   assembly_gap    1943494..1948237
FT                   /estimated_length=4744
FT                   /gap_type="unknown"
FT   assembly_gap    1950867..1951141
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    1966273..1966292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1968577..1968596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1970645..1970664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1988707..2001072
FT                   /locus_tag="mCG_10478"
FT                   /note="gene_id=mCG10478.2"
FT   mRNA            join(<1988707..1988827,1989874..1990008,1990432..1990584,
FT                   1990707..1990870,1990965..1991061,1993794..1993899,
FT                   1994452..1995076,1996306..2001072)
FT                   /locus_tag="mCG_10478"
FT                   /product="mCG10478"
FT                   /note="gene_id=mCG10478.2 transcript_id=mCT11066.2 created
FT                   on 29-JUL-2002"
FT   CDS             join(<1988707..1988827,1989874..1990008,1990432..1990584,
FT                   1990707..1990870,1990965..1991061,1993794..1993899,
FT                   1994452..1995076,1996306..1999140)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10478"
FT                   /product="mCG10478"
FT                   /note="gene_id=mCG10478.2 transcript_id=mCT11066.2
FT                   protein_id=mCP18262.2"
FT                   /protein_id="EDL06025.1"
FT                   /translation="KDAVQWSRNAATVDGDEPEDSADVESCGSNEASTVSGENDDNSFF
FT                   SFKFLLGIQANKQKKRTGVMLPRVVLTPLKVNGAHVEPASGFSGRHADGESGSPSSSSS
FT                   GSLALGNSAIRGQAEVTRDPAPLLRGFRKPATGQMKRNRGEEVDFETPGSILVNTNLRA
FT                   LINSRTFHALPLHFQQQLLLLLPEVDRQVGTDGLLRLSGSALNNEFFTHAAQSWRERLA
FT                   DGEFTHEMQVRLRQEMEKEKKVEQWKEKFFEDYYGQKLGLTKEESLQQKEVQEEAKVKS
FT                   GLCVSGESVRPQRGPNTRQRDGHFKKRSRPDLRTRSRRNIYKKQEPEQAGVAKDASAAP
FT                   DVSLSKDTKTDLAGVNSTPGPDVSSATSGQEGPKCPSEPVASQIQAERDNLACASASPD
FT                   RIPTLPQDTVDQETKDQKRKPFEQEASAPFPEKKPRLEDRQSFRNTIESVHTEKPQPTK
FT                   EEPKVPPIRIQLSRIKPPWVAKGRPTYQICPRIVPITESSCRGWTGARTLADIKARALQ
FT                   ARGARGYHCNRETATTAIGGGGGPGGGGSGAIDEGGGRDSSSGDGSEACGHPEPRGAPS
FT                   TSGESASDLQRTQLLPPCPLNGEHTPAEAAMPRARREDSASLRKEESCLLKRVPGVLTS
FT                   GLEDASQPPIAPTGDQPCQALPPLSSQTPVAEMLTEQPKLLLDDRTECESSREDQGPTI
FT                   PSESSSGRFPLGDLLGGGSDQAFDNMKEPISMTPTFISELSLANYLQDRPADDGLGLGA
FT                   TGLLIRESSRQEALTEAFASGSPTSWVPILSNYEVIKTSDPESRENIPCPEPQDEKEWE
FT                   RAVPLIAATESVPQPESCISHWTPPPAAVGSTGSDSEQVDLERLEMNGISEAPSPHSES
FT                   TDTASDSEGHLSEDSSEVDASEVTVVKGSLGGDEKQDWDPSASLSKVNNDLSVLTRTGG
FT                   VAASQSWVSRVCSVPHKIPDSLLLSSTECQPRSVCPLRPGSSVEVTNPLVMHLLHGNLP
FT                   LEKVLPPGHRSSRLESSQLPLREQSQHRGTLQGTGENNRLAARINPGSAQTLKESILAQ
FT                   SYGASAGLVRAMASKAPAMSQKIAKMVTSLDSQHPETELTPSSGNLEEIDSKEHLSSFL
FT                   CEEQKEGHSLSQGSDPGAAPGQCLGDHTTSKVPCFSSTNVSLSFGSEQTDGTLSDQNNA
FT                   GGHEKKLFGPGNTVTTLQCPRSEEQTPLPAEVPPVFPSRKIEPSKNSVSGGVQTTRENR
FT                   MPKPPPVSAGSIRTEQTFLRDPIKADAENRKAAGYSSLELVGHLQGMPFVVDLPFWKLP
FT                   REPGKGFSQPLEPSSIPSQLNIKQALYGKLSKLQLSPTSFNYSSSSATFPKGLAGGVVQ
FT                   LSHKASFGTGHTASLSLQMFTDSSAVESISLQCACSLKAMIMCQGCGAFCHDDCIGPSK
FT                   LCVLCLVVR"
FT   assembly_gap    1988868..1989018
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   gene            complement(2004522..>2126592)
FT                   /gene="8430427H17Rik"
FT                   /locus_tag="mCG_140756"
FT                   /note="gene_id=mCG140756.0"
FT   mRNA            complement(join(2004522..2008901,2013717..2013918,
FT                   2014436..2014558,2014761..2014952,2015033..2015218,
FT                   2017605..2017882,2032991..2033132,2060376..2060602,
FT                   2067434..2067543,2074584..2074695,2076214..2076416,
FT                   2080164..2080319,2126234..>2126592))
FT                   /gene="8430427H17Rik"
FT                   /locus_tag="mCG_140756"
FT                   /product="RIKEN cDNA 8430427H17"
FT                   /note="gene_id=mCG140756.0 transcript_id=mCT171264.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(2008684..2008901,2013717..2013918,
FT                   2014436..2014558,2014761..2014952,2015033..2015218,
FT                   2017605..2017882,2032991..2033132,2060376..>2060435))
FT                   /codon_start=1
FT                   /gene="8430427H17Rik"
FT                   /locus_tag="mCG_140756"
FT                   /product="RIKEN cDNA 8430427H17"
FT                   /note="gene_id=mCG140756.0 transcript_id=mCT171264.0
FT                   protein_id=mCP94183.0"
FT                   /protein_id="EDL06026.1"
FT                   /translation="AAGTYCSVHHSFKIYLLLNSDETSVSSEDFDMNDSAWMSADPHLA
FT                   SSLSPSQEERMRSPQNLHSQEDDDSSSESGSGNGSSTLNPSTSSSTQGDPAFPEMNGNG
FT                   AAAPMDFTATAEDQPINLCEKLPPGTALGTPSYPSDGCGTDGLRSRVKYGVKNTPESPP
FT                   YSSGSYDSIKTEVSGCPEDLTVGRAPAADDDDDDHDDHEDNDKMNDSEGMDPERLKAFN
FT                   MFVRLFVDENLDRMVPISKQPKEKIQAIIESCSRQFPEFQERARKRIRTYLKSCRRMKK
FT                   NGMEMTRPTPPHLTSAMAENILAAACESETRKAAKRMRLEIYQSSQEEPIALDKQHSRD
FT                   STAITHSTYSLPASAYSQDPVYVNGGLNYSYRGYGSLSSNLQPSASLQTGNHSNGPTDL
FT                   SMKGGASTPTPPTPTPSSNSTSRTMPTAQLSPTEISAVRQLIAGYRESAAFLLRSADEL
FT                   ENLILQQN"
FT   gene            2010876..2011456
FT                   /pseudo
FT                   /locus_tag="mCG_10477"
FT                   /note="gene_id=mCG10477.2"
FT   mRNA            2010876..2011456
FT                   /pseudo
FT                   /locus_tag="mCG_10477"
FT                   /note="gene_id=mCG10477.2 transcript_id=mCT11065.2 created
FT                   on 29-JUL-2002"
FT   assembly_gap    2037516..2037613
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    2040660..2042084
FT                   /estimated_length=1425
FT                   /gap_type="unknown"
FT   assembly_gap    2062928..2063957
FT                   /estimated_length=1030
FT                   /gap_type="unknown"
FT   assembly_gap    2082464..2083183
FT                   /estimated_length=720
FT                   /gap_type="unknown"
FT   assembly_gap    2089055..2089741
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    2124884..2125199
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    2125782..2125946
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    2126593..2126797
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    2128384..2128573
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    2151800..2152095
FT                   /estimated_length=296
FT                   /gap_type="unknown"
FT   assembly_gap    2158935..2159028
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    2161181..2161471
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   assembly_gap    2163281..2163300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2166530..2166944
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    2167915..2168524
FT                   /estimated_length=610
FT                   /gap_type="unknown"
FT   assembly_gap    2169740..2170256
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    2177695..2177798
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    2189291..2189491
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    2191634..2192584
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    2193751..2194319
FT                   /estimated_length=569
FT                   /gap_type="unknown"
FT   assembly_gap    2195315..2195617
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    2208118..2208272
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    2210908..2212030
FT                   /estimated_length=1123
FT                   /gap_type="unknown"
FT   assembly_gap    2213241..2213662
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   gene            complement(2214308..>2233553)
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /note="gene_id=mCG52224.2"
FT   mRNA            complement(join(2214308..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229235,2229959..2230012,
FT                   2233391..>2233553))
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, transcript variant
FT                   mCT52407"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT52407.3 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(2215696..2216777,2217714..2217762,
FT                   2219054..2219103,2219331..2219382,2222006..2222045,
FT                   2222556..2222593,2222677..2222733,2229133..2229235,
FT                   2229959..2230012,2233391..>2233537))
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, transcript variant
FT                   mCT185594"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185594.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(2215696..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229235,2229959..2230012,
FT                   2232985..2233059,2233391..2233524))
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, transcript variant
FT                   mCT185593"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185593.0 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(2216247..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229237,2233453..>2233511))
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, transcript variant
FT                   mCT185595"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185595.0 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(2216701..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229235,2229959..2230012,
FT                   2233391..>2233552))
FT                   /codon_start=1
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, isoform CRA_b"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT52407.3
FT                   protein_id=mCP38871.2 isoform=CRA_b"
FT                   /protein_id="EDL06028.1"
FT                   /translation="KCGCGSAARPGWRKRASLPGCGVPGTMGRLHCTQDPVPEAVRGDM
FT                   QQLNQLGAQQFSDLTEVLFHFLTEPKEVERFLAQLSEFATSNQISLGPLKSIMKSLLLV
FT                   PNGALKKGLTAEQVRTDLQTLGLSEEKATYFSEKWKQNASTLAQWAMGQTLMVNQLIDM
FT                   EWRFGVTSGSSELEKVGSIFLQLKLVVKKGKQTENLYIELTLPQFYSFLHEMERVRASM
FT                   ECLS"
FT   CDS             complement(join(2216701..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229237,2233453..>2233510))
FT                   /codon_start=1
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, isoform CRA_d"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185595.0
FT                   protein_id=mCP106851.0 isoform=CRA_d"
FT                   /protein_id="EDL06030.1"
FT                   /translation="RASLPGCGVPGTMGRLHCTQVERFLAQLSEFATSNQISLGPLKSI
FT                   MKSLLLVPNGALKKGLTAEQVRTDLQTLGLSEEKATYFSEKWKQNASTLAQWAMGQTLM
FT                   VNQLIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKGKQTENLYIELTLPQFYSFLHEM
FT                   ERVRASMECLS"
FT   CDS             complement(join(2216701..2216777,2217714..2217762,
FT                   2219054..2219103,2221955..2222045,2222556..2222593,
FT                   2222677..2222733,2229133..2229160))
FT                   /codon_start=1
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, isoform CRA_c"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185593.0
FT                   protein_id=mCP106852.0 isoform=CRA_c"
FT                   /protein_id="EDL06029.1"
FT                   /translation="MKSLLLVPNGALKKGLTAEQVRTDLQTLGLSEEKATYFSEKWKQN
FT                   ASTLAQWAMGQTLMVNQLIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKGKQTENLYI
FT                   ELTLPQFYSFLHEMERVRASMECLS"
FT   CDS             complement(join(2219363..2219382,2222006..2222045,
FT                   2222556..2222593,2222677..2222733,2229133..2229235,
FT                   2229959..2230012,2233391..>2233537))
FT                   /codon_start=1
FT                   /gene="Commd7"
FT                   /locus_tag="mCG_52224"
FT                   /product="COMM domain containing 7, isoform CRA_a"
FT                   /note="gene_id=mCG52224.2 transcript_id=mCT185594.0
FT                   protein_id=mCP106853.0 isoform=CRA_a"
FT                   /protein_id="EDL06027.1"
FT                   /translation="SAARPGWRKRASLPGCGVPGTMGRLHCTQDPVPEAVRGDMQQLNQ
FT                   LGAQQFSDLTEVLFHFLTEPKEVERFLAQLSEFATSNQISLGPLKSIMKSLLLVPNGAL
FT                   KKGLTAEQVRTDLQTLGLSEEKATYFSEKWKQNASTLAQWAMGSDPDG"
FT   assembly_gap    2221857..2221876
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2226643..2226714
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    2228169..2228308
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    2229517..2229702
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    2238167..2238835
FT                   /estimated_length=669
FT                   /gap_type="unknown"
FT   assembly_gap    2239560..2239579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2249288..>2250964)
FT                   /locus_tag="mCG_140754"
FT                   /note="gene_id=mCG140754.0"
FT   mRNA            complement(join(2249288..2249769,2250735..>2250964))
FT                   /locus_tag="mCG_140754"
FT                   /product="mCG140754"
FT                   /note="gene_id=mCG140754.0 transcript_id=mCT171261.0
FT                   created on 29-JUL-2002"
FT   CDS             complement(join(2249418..2249769,2250735..>2250964))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140754"
FT                   /product="mCG140754"
FT                   /note="gene_id=mCG140754.0 transcript_id=mCT171261.0
FT                   protein_id=mCP94180.0"
FT                   /protein_id="EDL06031.1"
FT                   /translation="SQQPATLQHKRLRSGGPRGQRPSSIPTCRYPERHPNLGVRGSKSE
FT                   RIHNHYYIDKTTSASTSQPFLPEEALGKNWARSDAHTHIQAHSQVWMSGPEREELLLES
FT                   HSNPALAFRPSLRCKAVQGAVVALWVTRWGPPFCFLLSPSLAFVSHLEGRGGLGGRKSI
FT                   HVPPTTWVPRASWGGALPCSLGLPRPKGPR"
FT   assembly_gap    2249789..2250089
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   gene            2250136..2288683
FT                   /locus_tag="mCG_10465"
FT                   /note="gene_id=mCG10465.2"
FT   mRNA            join(2250136..2250424,2251467..2251581,2262137..2262314,
FT                   2262855..2262916,2263426..2263545,2265972..2266097,
FT                   2266627..2266821,2268224..2268382,2270468..2270575,
FT                   2271023..2271167,2271569..2271628,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2284573..2284642,2285322..2285440,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171254"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171254.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2251467..2251581,2262137..2262314,
FT                   2262855..2262916,2263426..2263545,2265972..2266097,
FT                   2266627..2266821,2268224..2268382,2270468..2270575,
FT                   2271023..2271167,2271569..2271628,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171256"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171256.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2251467..2251581,2262137..2262314,
FT                   2262855..2262916,2263426..2263545,2265972..2266097,
FT                   2266627..2266821,2268224..2268382,2270468..2270575,
FT                   2271023..2271167,2272936..2273055,2273216..2273260,
FT                   2274707..2274786,2275069..2275181,2275578..2275764,
FT                   2276449..2276533,2277413..2277558,2277888..2277978,
FT                   2278228..2278376,2279188..2279273,2284573..2284642,
FT                   2285322..2285440,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171257"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171257.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2251467..2251581,2262137..2262314,
FT                   2262855..2262916,2263426..2263545,2265972..2266097,
FT                   2266627..2266821,2268224..2268382,2270468..2270575,
FT                   2271023..2271167,2272936..2273055,2273216..2273260,
FT                   2274707..2274786,2275069..2275181,2275578..2275764,
FT                   2276449..2276533,2277413..2277558,2277888..2277978,
FT                   2278228..2278376,2279188..2279273,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT11053"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT11053.2 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2262137..2262314,2262855..2262916,
FT                   2263426..2263545,2265972..2266097,2266627..2266821,
FT                   2268224..2268382,2270468..2270575,2271023..2271167,
FT                   2271569..2271628,2272936..2273055,2273216..2273260,
FT                   2274707..2274786,2275069..2275181,2275578..2275764,
FT                   2276449..2276533,2277413..2277558,2277888..2277978,
FT                   2278228..2278376,2279188..2279273,2284573..2284642,
FT                   2285322..2285440,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171260"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171260.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2262137..2262314,2262855..2262916,
FT                   2263426..2263545,2265972..2266097,2266627..2266821,
FT                   2268224..2268382,2270468..2270575,2271023..2271167,
FT                   2271569..2271628,2272936..2273055,2273216..2273260,
FT                   2274707..2274786,2275069..2275181,2275578..2275764,
FT                   2276449..2276533,2277413..2277558,2277888..2277978,
FT                   2278228..2278376,2279188..2279273,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171259"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171259.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2262137..2262314,2262855..2262916,
FT                   2263426..2263545,2265972..2266097,2266627..2266821,
FT                   2268224..2268382,2270468..2270575,2271023..2271167,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2284573..2284642,2285322..2285440,
FT                   2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171255"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171255.0 created
FT                   on 29-JUL-2002"
FT   mRNA            join(2250136..2250424,2262137..2262314,2262855..2262916,
FT                   2263426..2263545,2265972..2266097,2266627..2266821,
FT                   2268224..2268382,2270468..2270575,2271023..2271167,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2287215..2288683)
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, transcript variant mCT171258"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171258.0 created
FT                   on 29-JUL-2002"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2271569..2271628,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2284573..2284642,2285322..2285440,
FT                   2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_b"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171254.0
FT                   protein_id=mCP94175.0 isoform=CRA_b"
FT                   /protein_id="EDL06033.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASES
FT                   PPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGG
FT                   LCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGT
FT                   AEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAA
FT                   KRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVR
FT                   KITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGD
FT                   NRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVM
FT                   ASKNDKLELQDCLEFSRTAKLKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELE
FT                   RIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2271569..2271628,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2284573..2284642,2285322..2285440,
FT                   2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_b"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171260.0
FT                   protein_id=mCP94178.0 isoform=CRA_b"
FT                   /protein_id="EDL06036.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASES
FT                   PPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGG
FT                   LCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGT
FT                   AEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAA
FT                   KRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVR
FT                   KITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGD
FT                   NRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVM
FT                   ASKNDKLELQDCLEFSRTAKLKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELE
FT                   RIFGFPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2271569..2271628,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_c"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171256.0
FT                   protein_id=mCP94173.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q541E5"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR025766"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030488"
FT                   /db_xref="MGI:MGI:1261819"
FT                   /db_xref="UniProtKB/TrEMBL:Q541E5"
FT                   /protein_id="EDL06034.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASES
FT                   PPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGG
FT                   LCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGT
FT                   AEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAA
FT                   KRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVR
FT                   KITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGD
FT                   NRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRIFG
FT                   FPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2271569..2271628,
FT                   2272936..2273055,2273216..2273260,2274707..2274786,
FT                   2275069..2275181,2275578..2275764,2276449..2276533,
FT                   2277413..2277558,2277888..2277978,2278228..2278376,
FT                   2279188..2279273,2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_c"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171259.0
FT                   protein_id=mCP94177.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q541E5"
FT                   /db_xref="InterPro:IPR000313"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR025766"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030488"
FT                   /db_xref="MGI:MGI:1261819"
FT                   /db_xref="UniProtKB/TrEMBL:Q541E5"
FT                   /protein_id="EDL06039.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPVVNKSKVRRSDSRNLEPRRRENKSRRRTTNDSAASES
FT                   PPPKRLKTNSYGGKDRGEDEESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGG
FT                   LCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGT
FT                   AEDAKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAA
FT                   KRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVR
FT                   KITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGD
FT                   NRPFFWMFENVVAMKVNDKKDISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRIFG
FT                   FPAHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2284573..2284642,2285322..2285440,2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_d"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171255.0
FT                   protein_id=mCP94174.0 isoform=CRA_d"
FT                   /protein_id="EDL06037.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDE
FT                   ESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDG
FT                   YQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRC
FT                   HGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLV
FT                   LKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGS
FT                   PCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKK
FT                   DISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVMASKNDKLELQDCLEFSRTAK
FT                   LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELERIFGFPAHYTDVSNMGRGAR
FT                   QKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2284573..2284642,2285322..2285440,2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_d"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171257.0
FT                   protein_id=mCP94179.0 isoform=CRA_d"
FT                   /protein_id="EDL06038.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDE
FT                   ESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDG
FT                   YQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRC
FT                   HGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLV
FT                   LKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGS
FT                   PCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKK
FT                   DISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRPVMASKNDKLELQDCLEFSRTAK
FT                   LKKVQTITTKSNSIRQGKNQLFPVVMNGKDDVLWCTELERIFGFPAHYTDVSNMGRGAR
FT                   QKLLGRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_a"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT11053.2
FT                   protein_id=mCP18255.1 isoform=CRA_a"
FT                   /protein_id="EDL06032.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDE
FT                   ESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDG
FT                   YQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRC
FT                   HGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLV
FT                   LKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGS
FT                   PCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKK
FT                   DISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRIFGFPAHYTDVSNMGRGARQKLL
FT                   GRSWSVPVIRHLFAPLKDYFACE"
FT   CDS             join(2262143..2262314,2262855..2262916,2263426..2263545,
FT                   2265972..2266097,2266627..2266821,2268224..2268382,
FT                   2270468..2270575,2271023..2271167,2272936..2273055,
FT                   2273216..2273260,2274707..2274786,2275069..2275181,
FT                   2275578..2275764,2276449..2276533,2277413..2277558,
FT                   2277888..2277978,2278228..2278376,2279188..2279273,
FT                   2287215..2287356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10465"
FT                   /product="mCG10465, isoform CRA_a"
FT                   /note="gene_id=mCG10465.2 transcript_id=mCT171258.0
FT                   protein_id=mCP94176.0 isoform=CRA_a"
FT                   /protein_id="EDL06035.1"
FT                   /translation="MKGDSRHLNEEEGASGYEECIIVNGNFSDQSSDTKDAPSPPVLEA
FT                   ICTEPVCTPETRGRRSSSRLSKREVSSLLNYTQDMTGDGDRDDEVDDGNGSDILMPKLT
FT                   RETKDTRTRSESPAVRTRHSNGTSSLERQRASPRITRGRQGRHHVQEYPVEFPATRSRR
FT                   RRASSSASTPWSSPASVDFMEEVTPKSVSTPSVDLSQDGDQEGMDTTQVDAESRDGDST
FT                   EYQDDKEFGIGDLVWGKIKGFSWWPAMVVSWKATSKRQAMPGMRWVQWFGDGKFSEISA
FT                   DKLVALGLFSQHFNLATFNKLVSYRKAMYHTLEKARVRAGKTFSSSPGESLEDQLKPML
FT                   EWAHGGFKPTGIEGLKPNKKQPENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDE
FT                   ESRERMASEVTNNKGNLEDRCLSCGKKNPVSFHPLFEGGLCQSCRDRFLELFYMYDEDG
FT                   YQSYCTVCCEGRELLLCSNTSCCRCFCVECLEVLVGAGTAEDAKLQEPWSCYMCLPQRC
FT                   HGVLRRRKDWNMRLQDFFTTDPDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLV
FT                   LKELGIKVEKYIASEVCAESIAVGTVKHEGQIKYVNDVRKITKKNIEEWGPFDLVIGGS
FT                   PCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYTRPKEGDNRPFFWMFENVVAMKVNDKK
FT                   DISRFLACNPVMIDAIKVSAAHRARYFWGNLPGMNRIFGFPAHYTDVSNMGRGARQKLL
FT                   GRSWSVPVIRHLFAPLKDYFACE"
FT   assembly_gap    2283266..2283285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2291995..2292281
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    2293559..2293578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2294965..>2328243
FT                   /locus_tag="mCG_140755"
FT                   /note="gene_id=mCG140755.0"
FT   mRNA            join(<2294965..2295121,2295955..2296016,2304668..2304877,
FT                   2310188..2310283,2311984..2312128,2313454..2313573,
FT                   2313734..2313778,2314981..2315060,2315343..2315455,
FT                   2315846..2316032,2316717..2316801,2317700..2317845,
FT                   2318440..2318530,2318850..2318998,2321965..2322050,
FT                   2328102..>2328243)
FT                   /locus_tag="mCG_140755"
FT                   /product="mCG140755"
FT                   /note="gene_id=mCG140755.0 transcript_id=mCT171262.0
FT                   created on 29-JUL-2002"
FT   CDS             join(2294965..2295121,2295955..2296016,2304668..2304877,
FT                   2310188..2310283,2311984..2312128,2313454..2313573,
FT                   2313734..2313778,2314981..2315060,2315343..2315455,
FT                   2315846..2316032,2316717..2316801,2317700..2317845,
FT                   2318440..2318530,2318850..2318998,2321965..2322050,
FT                   2328102..2328243)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140755"
FT                   /product="mCG140755"
FT                   /note="gene_id=mCG140755.0 transcript_id=mCT171262.0
FT                   protein_id=mCP94181.0"
FT                   /protein_id="EDL06040.1"
FT                   /translation="MRGGSRHLSNEEDVSGCEDCIIISGTCSDQSSDPKTVPLTQVLEA
FT                   VCTVENRGCRTSSQPSKRKASSLISYVQPLSWQANTSASTPWLSPASPYPIIDLTDEDV
FT                   IPQSISTPSVDWSQDSHQEGMDTTQVDAESRDGGNIEYQVSADKLLLSQSCILAAFYKL
FT                   VPYRESIYRTLEKARVRAGKACPSSPGESLEDQLKPMLEWAHGGFKPTGIEGLKPNKKQ
FT                   PENKSRRRTTNDSAASESPPPKRLKTNSYGGKDRGEDEESREQMASDVTNNKGNLEDHC
FT                   LSCGRKDPVSFHPLFEGGLCQSCRDRFLELFYMYDEDGYQSYCTVCCEGRELLLCSNTS
FT                   CCRCFCVECLEVLVGAGTAEDVKLQEPWSCYMCLPQRCHGVLRRRKDWNMRLQDFFTTD
FT                   PDLEEFEPPKLYPAIPAAKRRPIRVLSLFDGIATGYLVLKELGIKVEKYIASEVCAESI
FT                   AVGTVKHEGQIKYVDDIRNITKEHIDEWGPFDLVIGGSPCNDLSCVNPVRKGLFEGTGR
FT                   LFFEFYRLLNYSCPEEEDDRPFFWMFENVVAMEVGDKRDISRFLECNPVMIDAIKVSAA
FT                   HRARYFWGNLPGMNRIFGFPEHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDHFA
FT                   CE"
FT   assembly_gap    2308182..2308625
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   gene            2339662..2368733
FT                   /gene="Mapre1"
FT                   /locus_tag="mCG_10464"
FT                   /note="gene_id=mCG10464.2"
FT   mRNA            join(2339662..2339765,2344602..2344725,2355830..2355975,
FT                   2357823..2358030,2361434..2361555,2364832..2364984,
FT                   2366793..2368733)
FT                   /gene="Mapre1"
FT                   /locus_tag="mCG_10464"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 1"
FT                   /note="gene_id=mCG10464.2 transcript_id=mCT11052.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(2344605..2344725,2355830..2355975,2357823..2358030,
FT                   2361434..2361555,2364832..2364984,2366793..2366849)
FT                   /codon_start=1
FT                   /gene="Mapre1"
FT                   /locus_tag="mCG_10464"
FT                   /product="microtubule-associated protein, RP/EB family,
FT                   member 1"
FT                   /note="gene_id=mCG10464.2 transcript_id=mCT11052.2
FT                   protein_id=mCP18254.2"
FT                   /db_xref="GOA:Q3U4H0"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR004953"
FT                   /db_xref="InterPro:IPR027328"
FT                   /db_xref="InterPro:IPR027739"
FT                   /db_xref="MGI:MGI:891995"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4H0"
FT                   /protein_id="EDL06041.1"
FT                   /translation="MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYC
FT                   QFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDN
FT                   FEFVQWFKKFFDANYDGKEYDPVAARQGQETAVAPSLVAPALSKPKKPLGSSTAAPQRP
FT                   IATQRTTAAPKAGPGMVRKNPGVGNGDDEAAELMQQVKVLKLTVEDLEKERDFYFGKLR
FT                   NIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY"
FT   assembly_gap    2349432..2349451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2350553..2350572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2374530..2374577
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   gene            2380407..2394756
FT                   /gene="A630008I04"
FT                   /locus_tag="mCG_145769"
FT                   /note="gene_id=mCG145769.0"
FT   mRNA            join(2380407..2380599,2381284..2381335,2383160..2383325,
FT                   2387161..2387279,2388683..2388947,2392234..2392369,
FT                   2393941..2394046,2394339..2394756)
FT                   /gene="A630008I04"
FT                   /locus_tag="mCG_145769"
FT                   /product="hypothetical protein A630008I04"
FT                   /note="gene_id=mCG145769.0 transcript_id=mCT185848.0
FT                   created on 18-JUN-2003"
FT   CDS             join(2380433..2380599,2381284..2381335,2383160..2383325,
FT                   2387161..2387279,2388683..2388790)
FT                   /codon_start=1
FT                   /gene="A630008I04"
FT                   /locus_tag="mCG_145769"
FT                   /product="hypothetical protein A630008I04"
FT                   /note="gene_id=mCG145769.0 transcript_id=mCT185848.0
FT                   protein_id=mCP107106.0"
FT                   /protein_id="EDL06042.1"
FT                   /translation="MPSSLHAPLSGEVSAFSLSCPYFRCQDSTGEDLGRFPSPLPFLMC
FT                   LLLFFPFRARWPRLMSSEKPGESPKPQKMAQPGGSQKKETSRSVPVTDPTSHNSEINQR
FT                   DQQFSDMHLADLQKVFEKEADENGALKKEGFIRIMKGVLSSMSEEMLELLFLKVDSDCN
FT                   GFVTWQKYVDYMMREFQGKEEMRKSQYRLRFHLPMTVIPL"
FT   assembly_gap    2393195..2393387
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    2400080..2400186
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    2406231..2406250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2407578..2407597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2414188..2414315
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   assembly_gap    2416406..2416569
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    2417900..2418174
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    2419056..2419327
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    2420406..2429392
FT                   /estimated_length=8987
FT                   /gap_type="unknown"
FT   assembly_gap    2430554..2430942
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    2431533..2431552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2444874..2459282)
FT                   /gene="Spag4l"
FT                   /locus_tag="mCG_10466"
FT                   /note="gene_id=mCG10466.2"
FT   mRNA            complement(join(2444874..2445044,2446512..2446598,
FT                   2447046..2447213,2448687..2448790,2449517..2449595,
FT                   2453392..2453454,2455103..2455152,2455711..2455772,
FT                   2456420..2456486,2457616..2457671,2459128..2459282))
FT                   /gene="Spag4l"
FT                   /locus_tag="mCG_10466"
FT                   /product="sperm associated antigen 4-like"
FT                   /note="gene_id=mCG10466.2 transcript_id=mCT11054.2 created
FT                   on 04-FEB-2003"
FT   CDS             complement(join(2444901..2445044,2446512..2446598,
FT                   2447046..2447213,2448687..2448790,2449517..2449595,
FT                   2453392..2453454,2455103..2455152,2455711..2455772,
FT                   2456420..2456486,2457616..2457671,2459128..2459201))
FT                   /codon_start=1
FT                   /gene="Spag4l"
FT                   /locus_tag="mCG_10466"
FT                   /product="sperm associated antigen 4-like"
FT                   /note="gene_id=mCG10466.2 transcript_id=mCT11054.2
FT                   protein_id=mCP18245.2"
FT                   /protein_id="EDL06043.1"
FT                   /translation="MPRTRNIGALCTLPEDTTHSGRPRRGVQRSYISRMAEPAPANMTW
FT                   LTYLACFLRTQTQQVFLNTCRCKLFCQKVMEKMGLLVLCVFGFWMFSMHLPSKVEVWQL
FT                   RGSMNQLIAKLQKMEAISDEQKMAQKIMKMIQGDYIEKPDFALKSIGASIDFEHTSATY
FT                   NHDKARSYWNWIRLWNYAQPPDPNVTPGNCWAFASDRGQVTIRLAQKVYLSNITLQHIP
FT                   KTISLSGSLDTAPKDFVIYGLESLPREEVFLGAFQFQPENIIQTFQLQNLPPRSFAAVK
FT                   VKISSNWGNPRFTCMYRVRVHGSVTPPKDSHLEPLS"
FT   assembly_gap    2453457..2454725
FT                   /estimated_length=1269
FT                   /gap_type="unknown"
FT   gene            2462453..2485822
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /note="gene_id=mCG10476.2"
FT   mRNA            join(2462453..2462888,2463649..2463792,2466210..2466303,
FT                   2467807..2467911,2468912..2469058,2470888..2470948,
FT                   2471841..2471901,2479647..2479738,2479934..2480122,
FT                   2480346..2480399,2480954..2481124,2481641..2481708,
FT                   2481830..2481875,2482496..2482559,2482887..2482963,
FT                   2485541..2485822)
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   1, transcript variant mCT11064"
FT                   /note="gene_id=mCG10476.2 transcript_id=mCT11064.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(2463675..2463792,2466210..2466303,2467807..2467911,
FT                   2468912..2469058,2470888..2470948,2471841..2471901,
FT                   2479647..2479738,2479934..2480122,2480346..2480399,
FT                   2480954..2481124,2481641..2481708,2481830..2481875,
FT                   2482496..2482559,2482887..2482963,2485541..2485582)
FT                   /codon_start=1
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG10476.2 transcript_id=mCT11064.2
FT                   protein_id=mCP18246.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q14AV3"
FT                   /db_xref="InterPro:IPR001124"
FT                   /db_xref="InterPro:IPR017942"
FT                   /db_xref="InterPro:IPR017943"
FT                   /db_xref="InterPro:IPR032942"
FT                   /db_xref="MGI:MGI:1913807"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AV3"
FT                   /protein_id="EDL06044.1"
FT                   /translation="MARACSLGLLLLLLLLLRTVVTVSLPVIVVRLNKAALDYVSDIGK
FT                   APLQRALQVTISDFMDPSGEVLQSTRVQILDAHVPFFYLKFIAGFGVHLSAAANFTIKV
FT                   FSVPEPMELVLPVDLLADVHVARDSIGTLVLSVPACSSIFSPAGMLDGSISTSQELLDR
FT                   VQEHIKADLNNKLCLHVYGLVQDLNVHLGTLIGLSPVGPESQIRYSITSMPTITSNYIS
FT                   LDIGAILSLLGKPILLPMHGAHPFVLPWPLGDAGAMATVGLSQHLFDCALLMLQKAGSL
FT                   NLEITGQLNSKNNPLNTSVLGQLIPEVAHLFPEPTPLVLKVQLGATPVVTLHTSNSTLQ
FT                   LQPLVEVFAAPSNLALQFLFSLDVMVNLDLQLSVSKAKLRGSTSLLGGFQLSVATSNVG
FT                   SVDMDQVLTLISTVFQKPLLDHLNALLGMGVVLPRVHNLHYVHSEVLVREGYVVVSSGL
FT                   AYQH"
FT   assembly_gap    2469889..2469908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2472129..2472148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(2472550..2472690,2479647..2479738,2479934..2480122,
FT                   2480346..2480399,2480954..2481124,2481641..2481708,
FT                   2481830..2481875,2482496..2482559,2482887..2482963,
FT                   2485541..2485822)
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   1, transcript variant mCT171263"
FT                   /note="gene_id=mCG10476.2 transcript_id=mCT171263.0 created
FT                   on 30-JUL-2002"
FT   CDS             join(2472591..2472690,2479647..2479738,2479934..2480122,
FT                   2480346..2480399,2480954..2481124,2481641..2481708,
FT                   2481830..2481875,2482496..2482559,2482887..2482963,
FT                   2485541..2485582)
FT                   /codon_start=1
FT                   /gene="Bpil1"
FT                   /locus_tag="mCG_10476"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG10476.2 transcript_id=mCT171263.0
FT                   protein_id=mCP94182.0 isoform=CRA_b"
FT                   /protein_id="EDL06045.1"
FT                   /translation="MCTWPGTLLGPLCSASLPALPSSVQPACWIAVTGLSPVGPESQIR
FT                   YSITSMPTITSNYISLDIGAILSLLGKPILLPMHGAHPFVLPWPLGDAGAMATVGLSQH
FT                   LFDCALLMLQKAGSLNLEITGQLNSKNNPLNTSVLGQLIPEVAHLFPEPTPLVLKVQLG
FT                   ATPVVTLHTSNSTLQLQPLVEVFAAPSNLALQFLFSLDVMVNLDLQLSVSKAKLRGSTS
FT                   LLGGFQLSVATSNVGSVDMDQVLTLISTVFQKPLLDHLNALLGMGVVLPRVHNLHYVHS
FT                   EVLVREGYVVVSSGLAYQH"
FT   assembly_gap    2473259..2474331
FT                   /estimated_length=1073
FT                   /gap_type="unknown"
FT   assembly_gap    2475377..2475396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2476476..2476495
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2477587..2477606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2499119..2503362
FT                   /gene="Bpil3"
FT                   /locus_tag="mCG_10470"
FT                   /note="gene_id=mCG10470.2"
FT   mRNA            join(<2499119..2499220,2499728..2499795,2501281..2501326,
FT                   2502028..2502091,2502474..2502550,2503159..2503362)
FT                   /gene="Bpil3"
FT                   /locus_tag="mCG_10470"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   3"
FT                   /note="gene_id=mCG10470.2 transcript_id=mCT11058.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(2499119..2499220,2499728..2499795,2501281..2501326,
FT                   2502028..2502091,2502474..2502550,2503159..2503191)
FT                   /codon_start=1
FT                   /gene="Bpil3"
FT                   /locus_tag="mCG_10470"
FT                   /product="bactericidal/permeability-increasing protein-like
FT                   3"
FT                   /note="gene_id=mCG10470.2 transcript_id=mCT11058.2
FT                   protein_id=mCP18261.2"
FT                   /protein_id="EDL06046.1"
FT                   /translation="MKAGKSLMHLHGSLEMFAARRHGKHPKSLFRLETHIGLEIHYSVQ
FT                   DNRLQMVTSMDSLLSLARESSSVGDFHEAELTGFITDYLQKAYIPVVNDVLHVGLPLPD
FT                   LLAINYNLAELDIVEDALVLGLKTE"
FT   gene            <2510199..2524026
FT                   /gene="Rya3"
FT                   /locus_tag="mCG_10484"
FT                   /note="gene_id=mCG10484.1"
FT   mRNA            join(<2510199..2510310,2511053..2511209,2512707..2512791,
FT                   2513151..2513269,2514415..2514478,2515810..2515870,
FT                   2516583..2516674,2516792..2516971,2518344..2518397,
FT                   2519716..2519886,2520372..2520439,2521569..2521611,
FT                   2522441..2522504,2522914..2522990,2523738..2524026)
FT                   /gene="Rya3"
FT                   /locus_tag="mCG_10484"
FT                   /product="antimicrobial peptide RYA3"
FT                   /note="gene_id=mCG10484.1 transcript_id=mCT11072.2 created
FT                   on 30-JUL-2002"
FT   CDS             join(2510199..2510310,2511053..2511209,2512707..2512791,
FT                   2513151..2513269,2514415..2514478,2515810..2515870,
FT                   2516583..2516674,2516792..2516971,2518344..2518397,
FT                   2519716..2519886,2520372..2520439,2521569..2521611,
FT                   2522441..2522504,2522914..2522990,2523738..2523767)
FT                   /codon_start=1
FT                   /gene="Rya3"
FT                   /locus_tag="mCG_10484"
FT                   /product="antimicrobial peptide RYA3"
FT                   /note="gene_id=mCG10484.1 transcript_id=mCT11072.2
FT                   protein_id=mCP18239.2"
FT                   /protein_id="EDL06047.1"
FT                   /translation="MLGVYTLLLLWGLATPCLGLLETVGTLARIDKDELGKAIQNSLVG
FT                   GPILQNVLGTVTSVNQGLLGAGGLLGGGGLLSYGGIFSLVEELSGLKIEELTLPKVSLK
FT                   LLPGVGVQLNLHTKLAAEVNVSSKVALGMSPRGTPILVLKRCSTLLGHISLMSGLLPTP
FT                   IFGLVEQTLCKVLPGLLCPVVDSVLSVVNELLGATLSLVPLGPLGSVEFTLATLPLISN
FT                   QYIELDINPIVKSIAGDVIDFPKPRIPVKVPPKEDHTSQVTVPLYLFSTVFGLLQTNGA
FT                   LDLDITPEMVPRNVPLTTTDLAALAPEALGKLPPAQHLLLSLRVTKSPMVLLQNKKATV
FT                   SIPVTIHVLSSVPQGTPVALFQLNGVMTLNAHLAPSSTKLHISLSLERLSVQLASSFPQ
FT                   PFDASRLEEWLSDVVRAAYMQRLNEHLEVGIPLPKILNVNFANSVVDIIENAVVLTVAP
FT                   "
FT   assembly_gap    2515027..2515046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2525100..2525183
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    2531867..2532121
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   gene            <2534016..2555465
FT                   /locus_tag="mCG_10482"
FT                   /note="gene_id=mCG10482.1"
FT   mRNA            join(<2534016..2534351,2535270..2535374,2536003..2536146,
FT                   2538456..2538519,2538873..2538933,2539856..2539947,
FT                   2541436..2541639,2543382..2543435,2545527..2545697,
FT                   2548746..2548813,2549335..2549377,2551266..2551329,
FT                   2553129..2553205,2555196..2555465)
FT                   /locus_tag="mCG_10482"
FT                   /product="mCG10482"
FT                   /note="gene_id=mCG10482.1 transcript_id=mCT11070.2 created
FT                   on 13-AUG-2002"
FT   CDS             join(<2534017..2534351,2535270..2535374,2536003..2536146,
FT                   2538456..2538519,2538873..2538933,2539856..2539947,
FT                   2541436..2541639,2543382..2543435,2545527..2545697,
FT                   2548746..2548813,2549335..2549377,2551266..2551329,
FT                   2553129..2553205,2555196..2555219)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10482"
FT                   /product="mCG10482"
FT                   /note="gene_id=mCG10482.1 transcript_id=mCT11070.2
FT                   protein_id=mCP18259.2"
FT                   /protein_id="EDL06048.1"
FT                   /translation="DLRHEDYRPPDSAYHRGSGRYRSAADSSSVGRLYRRELRPGEIPA
FT                   GVATGALGPGGLLGTGGMLANEGILAGQGGLLGGGGLLGDGGLLGGGGVLGVLGEGGIL
FT                   STVQGITGLRIVELTLPRVSVRLLPGVGVYLSLYTRVAINGRSLIGFLDIAVEVNITAK
FT                   VRLTMDRTGYPRLVIERCDTLLGGIKVKLLRGLLPNLVDNLVNRVLANVLPDLLCPIVD
FT                   VVLGLVNDQLGLVDSLVPLGILGSVQYTFSSLPLVTGEFLELDLNTLVGEAGGDLIDYP
FT                   LGRPAILPRPQMPELPPMGDNTNSQLAISANFLSSVLTMLQKQGAMDIDITDGMFEDLP
FT                   PLTTSTLGALIPKVFQQYPESRPLTIRIQVPNPPTVTLQKDKALVKVFATSEVVVSQPN
FT                   DVETTICLIDVDTDLLASFSVEGDKLMIDAKLDKTSLNLRTSNVGNFDVFILEMLVEKI
FT                   FDLAFMPAMNAILGSGVPLPKILNIDFSNADIDVLEDLLVLST"
FT   assembly_gap    2547763..2547782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2555605..2555624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2559036..2559055
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2560370..2560389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2563416..2565354
FT                   /estimated_length=1939
FT                   /gap_type="unknown"
FT   assembly_gap    2574680..2574699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2580541..2580560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2584685..2584704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2589057..2596298
FT                   /estimated_length=7242
FT                   /gap_type="unknown"
FT   assembly_gap    2598755..2598774
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2599149..2606946
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /note="gene_id=mCG10473.2"
FT   mRNA            join(2599149..2599277,2599982..2600110,2600637..2600778,
FT                   2601339..2601446,2602220..2602372,2604548..2604629,
FT                   2605284..2605347,2605792..2605866,2606770..2606939)
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, transcript variant
FT                   mCT171807"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT171807.0 created
FT                   on 13-AUG-2002"
FT   mRNA            join(2599150..2599181,2599982..2600110,2600637..2600778,
FT                   2601339..2601446,2602220..2602372,2604548..2604629,
FT                   2605284..2605347,2605792..2605866,2606770..2606946)
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, transcript variant
FT                   mCT11061"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT11061.2 created
FT                   on 13-AUG-2002"
FT   mRNA            join(2599166..2599181,2599982..2600110,2600637..2600778,
FT                   2602220..2602372,2604548..2604629,2605284..2605347,
FT                   2605792..2605866,2606770..2606941)
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, transcript variant
FT                   mCT171808"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT171808.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(2599990..2600110,2600637..2600778,2601339..2601446,
FT                   2602220..2602372,2604548..2604629,2605284..2605347,
FT                   2605792..2605829)
FT                   /codon_start=1
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, isoform CRA_a"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT11061.2
FT                   protein_id=mCP18244.1 isoform=CRA_a"
FT                   /protein_id="EDL06049.1"
FT                   /translation="MFQLGSLVVLCGLLIGNSESLLGELGSAVNNLKILNPPSEAVPQN
FT                   LNLDVELLQQATSWPLAKNSILETLNTADLGNLKSFTSLNGLLLKINNLKVLDFQAKLS
FT                   SNGNGIELTVPLAGEASLVLPFIGKTVDISVSLDLINSLSIKTNAQTGLPEVTIGKCSS
FT                   NTDKISISLLGRRLPIINSILDGVSTLLTSTLSTVLQNFLCPLLQYVLSTLNPSVLQGL
FT                   LSNLLAGQVQLAL"
FT   CDS             join(2599990..2600110,2600637..2600778,2601339..2601446,
FT                   2602220..2602372,2604548..2604629,2605284..2605347,
FT                   2605792..2605829)
FT                   /codon_start=1
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, isoform CRA_a"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT171807.0
FT                   protein_id=mCP94726.0 isoform=CRA_a"
FT                   /protein_id="EDL06050.1"
FT                   /translation="MFQLGSLVVLCGLLIGNSESLLGELGSAVNNLKILNPPSEAVPQN
FT                   LNLDVELLQQATSWPLAKNSILETLNTADLGNLKSFTSLNGLLLKINNLKVLDFQAKLS
FT                   SNGNGIELTVPLAGEASLVLPFIGKTVDISVSLDLINSLSIKTNAQTGLPEVTIGKCSS
FT                   NTDKISISLLGRRLPIINSILDGVSTLLTSTLSTVLQNFLCPLLQYVLSTLNPSVLQGL
FT                   LSNLLAGQVQLAL"
FT   CDS             join(2599990..2600110,2600637..2600778,2602220..2602372,
FT                   2604548..2604629,2605284..2605347,2605792..2605829)
FT                   /codon_start=1
FT                   /gene="Psp"
FT                   /locus_tag="mCG_10473"
FT                   /product="parotid secretory protein, isoform CRA_b"
FT                   /note="gene_id=mCG10473.2 transcript_id=mCT171808.0
FT                   protein_id=mCP94727.0 isoform=CRA_b"
FT                   /protein_id="EDL06051.1"
FT                   /translation="MFQLGSLVVLCGLLIGNSESLLGELGSAVNNLKILNPPSEAVPQN
FT                   LNLDVELLQQATSWPLAKNSILETLNTADLGNLKSFTSLNGLLPFIGKTVDISVSLDLI
FT                   NSLSIKTNAQTGLPEVTIGKCSSNTDKISISLLGRRLPIINSILDGVSTLLTSTLSTVL
FT                   QNFLCPLLQYVLSTLNPSVLQGLLSNLLAGQVQLAL"
FT   assembly_gap    2614663..2617814
FT                   /estimated_length=3152
FT                   /gap_type="unknown"
FT   assembly_gap    2619309..2619328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2621709..2622271
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    2623926..2623945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2625386..2625766
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    2632056..2632530
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   assembly_gap    2633914..2634053
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    2637649..2637668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2642888..2643059
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    2649685..2649704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2654792..2654811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2659817..2666003
FT                   /estimated_length=6187
FT                   /gap_type="unknown"
FT   assembly_gap    2667884..2667903
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2670225..2670244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2672623..2672642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2675573..2675592
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2679974..2679993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2682467..2682486
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2690588..2692126
FT                   /estimated_length=1539
FT                   /gap_type="unknown"
FT   gene            <2697785..2698122
FT                   /locus_tag="mCG_1027979"
FT                   /note="gene_id=mCG1027979.1"
FT   mRNA            <2697785..2698122
FT                   /locus_tag="mCG_1027979"
FT                   /product="mCG1027979, transcript variant mCT171805"
FT                   /note="gene_id=mCG1027979.1 transcript_id=mCT171805.0
FT                   created on 13-AUG-2002"
FT   mRNA            join(<2697785..2698007,2698079..2698118)
FT                   /locus_tag="mCG_1027979"
FT                   /product="mCG1027979, transcript variant mCT145683"
FT                   /note="gene_id=mCG1027979.1 transcript_id=mCT145683.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<2697822..2698007,2698079..2698090)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027979"
FT                   /product="mCG1027979, isoform CRA_b"
FT                   /note="gene_id=mCG1027979.1 transcript_id=mCT145683.0
FT                   protein_id=mCP73229.0 isoform=CRA_b"
FT                   /protein_id="EDL06053.1"
FT                   /translation="KDWWSRRSCWSRVGATIGGPYGELTPPPSSELSAVSGCRQGKFTV
FT                   SETCDPRSLGRTSDKIERQV"
FT   CDS             <2697822..2698073
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027979"
FT                   /product="mCG1027979, isoform CRA_a"
FT                   /note="gene_id=mCG1027979.1 transcript_id=mCT171805.0
FT                   protein_id=mCP94724.0 isoform=CRA_a"
FT                   /protein_id="EDL06052.1"
FT                   /translation="KDWWSRRSCWSRVGATIGGPYGELTPPPSSELSAVSGCRQGKFTV
FT                   SETCDPRSLGRTSDKIEVSIKLPGSRHKVTQEFGKDLG"
FT   assembly_gap    2722089..2722399
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    2726557..2726576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2728206..2728225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2731880..2732011
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    2732974..2733812
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    2738821..2738877
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    2741028..2741090
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    2745317..2745392
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            complement(2754492..>2756702)
FT                   /locus_tag="mCG_116890"
FT                   /note="gene_id=mCG116890.1"
FT   mRNA            complement(join(2754492..2756367,2756515..>2756702))
FT                   /locus_tag="mCG_116890"
FT                   /product="mCG116890"
FT                   /note="gene_id=mCG116890.1 transcript_id=mCT118018.1
FT                   created on 13-AUG-2002"
FT   CDS             complement(2755321..>2755638)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116890"
FT                   /product="mCG116890"
FT                   /note="gene_id=mCG116890.1 transcript_id=mCT118018.1
FT                   protein_id=mCP72734.1"
FT                   /protein_id="EDL06054.1"
FT                   /translation="QHPLSCGFHWSACGMTVLEAVMEIQTIADVGLLWRQSHPGHTKLM
FT                   LGPNPTRKDLLGWLLSHGVPREQVDRQPIKVLLELYIKEAKRSRGHPNYGLNEEQPPPP
FT                   P"
FT   assembly_gap    2761055..2762825
FT                   /estimated_length=1771
FT                   /gap_type="unknown"
FT   assembly_gap    2764509..2764528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2768962..2768981
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2772503..2772522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2774652..2775108
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    2778086..2778202
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    2784981..2785000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2791484..2791503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2794644..2795087
FT                   /estimated_length=444
FT                   /gap_type="unknown"
FT   assembly_gap    2801371..2801390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2803107..2803126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2804637..2804656
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2807311..2815247
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /note="gene_id=mCG1239.1"
FT   mRNA            join(2807311..2807629,2810524..2810674,2812418..2812525,
FT                   2813162..2813311,2814010..2814094,2814469..2814532,
FT                   2815031..2815247)
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, transcript variant
FT                   mCT8450"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT8450.1 created on
FT                   13-AUG-2002"
FT   CDS             join(2807503..2807629,2810524..2810674,2812418..2812525,
FT                   2813162..2813311,2814010..2814094,2814469..2814532,
FT                   2815031..2815044)
FT                   /codon_start=1
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, isoform CRA_c"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT8450.1
FT                   protein_id=mCP23122.2 isoform=CRA_c"
FT                   /protein_id="EDL06057.1"
FT                   /translation="MHLLWRLLVLLLGLLALPSALPKQPWPGLTKAHKDGRSTLARIIA
FT                   QGLLKLNAEGRIQSMRLLDRLNVSGTVAPGMVGWLIGGMNFQQQQEISINITNVQLDCG
FT                   GIQMAFPKEWFSANITLEFDIEFKLPFNSNIIKTHACMGLTAESWLEKDEFGRRELVMG
FT                   RCRMEPSSGGASMSTEETSPKMKHFLHNLRESLGKVIPNLVESQVCPLIGEILRQLDVK
FT                   LLKGLVGACS"
FT   mRNA            join(<2807571..2807629,2810524..2810674,2812418..2812525,
FT                   2813162..2813311,2814010..2814094,2814469..2814532,
FT                   2815026..2815142)
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, transcript variant
FT                   mCT189880"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT189880.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2807572..2807629,2810524..2810674,2812418..2812525,
FT                   2813162..2813311,2814010..2814094,2814469..2814532,
FT                   2815026..2815060)
FT                   /codon_start=1
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, isoform CRA_a"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT189880.0
FT                   protein_id=mCP110851.0 isoform=CRA_a"
FT                   /protein_id="EDL06055.1"
FT                   /translation="QPWPGLTKAHKDGRSTLARIIAQGLLKLNAEGRIQSMRLLDRLNV
FT                   SGTVAPGMVGWLIGGMNFQQQQEISINITNVQLDCGGIQMAFPKEWFSANITLEFDIEF
FT                   KLPFNSNIIKTHACMGLTAESWLEKDEFGRRELVMGRCRMEPSSGGASMSTEETSPKMK
FT                   HFLHNLRESLGKVIPNLVESQVCPLIGEILRQLDVKLLKGLVEQVPAHNLGQP"
FT   mRNA            join(<2812434..2812525,2813162..2813311,2813650..2813729,
FT                   2814010..2814094,2814469..2814532,2815026..2815239)
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, transcript variant
FT                   mCT171810"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT171810.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(<2812434..2812525,2813162..2813311,2813650..2813722)
FT                   /codon_start=1
FT                   /gene="1700058C13Rik"
FT                   /locus_tag="mCG_1239"
FT                   /product="RIKEN cDNA 1700058C13, isoform CRA_b"
FT                   /note="gene_id=mCG1239.1 transcript_id=mCT171810.0
FT                   protein_id=mCP94729.0 isoform=CRA_b"
FT                   /protein_id="EDL06056.1"
FT                   /translation="VQLDCGGIQMAFPKEWFSANITLEFDIEFKLPFNSNIIKTHACMG
FT                   LTAESWLEKDEFGRRELVMGRCRMEPSSGGASMSTEGVLISLCNFQTLNHDTFHGCLPS
FT                   "
FT   gene            2819777..2826094
FT                   /gene="Plunc"
FT                   /locus_tag="mCG_1238"
FT                   /note="gene_id=mCG1238.1"
FT   mRNA            join(2819777..2819819,2820648..2820894,2821119..2821278,
FT                   2822554..2822661,2822969..2823118,2824162..2824240,
FT                   2824542..2824605,2824922..2824997,2825923..2826094)
FT                   /gene="Plunc"
FT                   /locus_tag="mCG_1238"
FT                   /product="palate, lung, and nasal epithelium carcinoma
FT                   associated"
FT                   /note="gene_id=mCG1238.1 transcript_id=mCT8449.1 created on
FT                   13-AUG-2002"
FT   CDS             join(2820660..2820894,2821119..2821278,2822554..2822661,
FT                   2822969..2823118,2824162..2824240,2824542..2824605,
FT                   2824922..2824962)
FT                   /codon_start=1
FT                   /gene="Plunc"
FT                   /locus_tag="mCG_1238"
FT                   /product="palate, lung, and nasal epithelium carcinoma
FT                   associated"
FT                   /note="gene_id=mCG1238.1 transcript_id=mCT8449.1
FT                   protein_id=mCP23121.1"
FT                   /protein_id="EDL06058.1"
FT                   /translation="MFLVGSLVVLCGLLAHSTAQLAGLPLPLGQGPPLPLNQGPPLPLN
FT                   QGQLLPLAQGLPLAVSPALPSNPTDLLAGKFTDALSGGLLSGGLLGILENIPLLDVIKS
FT                   GGGNSNGLVGGLLGKLTSSVPLLNNILDIKITDPQLLELGLVQSPDGHRLYVTIPLGLT
FT                   LNVNMPVVGSLLQLAVKLNITAEVLAVKDNQGRIHLVLGDCTHSPGSLKISLLNGVTPV
FT                   QSFLDNLTGILTKVLPELIQGKVCPLVNGILSGLDVTLVHNIAELLIHGLQFVIKV"
FT   assembly_gap    2829890..2830742
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    2833873..2834360
FT                   /estimated_length=488
FT                   /gap_type="unknown"
FT   assembly_gap    2838364..2838383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2839641..2845484
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /note="gene_id=mCG51428.1"
FT   mRNA            join(2839641..2839692,2840523..2840748,2841143..2841299,
FT                   2842546..2842653,2842954..2843103,2843953..2844031,
FT                   2844291..2844354,2844696..2844770,2845312..2845484)
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /product="RIKEN cDNA 2310021H06, transcript variant
FT                   mCT51611"
FT                   /note="gene_id=mCG51428.1 transcript_id=mCT51611.2 created
FT                   on 13-AUG-2002"
FT   mRNA            join(2839646..2839692,2840523..2840748,2841143..2841299,
FT                   2842546..2842653,2842954..2843103,2844291..2844354,
FT                   2844696..2844770,2845312..2845484)
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /product="RIKEN cDNA 2310021H06, transcript variant
FT                   mCT171815"
FT                   /note="gene_id=mCG51428.1 transcript_id=mCT171815.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(2840535..2840748,2841143..2841299,2842546..2842653,
FT                   2842954..2843103,2843953..2844031,2844291..2844354,
FT                   2844696..2844736)
FT                   /codon_start=1
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /product="RIKEN cDNA 2310021H06, isoform CRA_b"
FT                   /note="gene_id=mCG51428.1 transcript_id=mCT51611.2
FT                   protein_id=mCP42850.2 isoform=CRA_b"
FT                   /protein_id="EDL06060.1"
FT                   /translation="MFLAGSFIVLCGLLAQSTAQLAGLPYPLGQDLPMSMGHCRSLHVG
FT                   QTLPYYGVTPVVSTYPSDHLDRNFRDAFRHGLLSGGILSFLEHIPLLNYVRPTGSNAGG
FT                   LVGVLGKVISSIPLLNNILDIRVTNPQLLEIGLVQSYDFHHLYVTIPLGFDLRVNTLVV
FT                   GSLLELSVKLDVTAEVYAVRDSYGRSRLVIGDCIYPPGSLRISLLNRLGPLQNLIDSLT
FT                   DILTRVIPGLVQGVVCPLVNGVLSLLDVTLAHDVADALLRGVQFVIKA"
FT   CDS             join(2840535..2840748,2841143..2841299,2842546..2842653,
FT                   2842954..2843103,2844291..2844339)
FT                   /codon_start=1
FT                   /gene="2310021H06Rik"
FT                   /locus_tag="mCG_51428"
FT                   /product="RIKEN cDNA 2310021H06, isoform CRA_a"
FT                   /note="gene_id=mCG51428.1 transcript_id=mCT171815.0
FT                   protein_id=mCP94734.0 isoform=CRA_a"
FT                   /protein_id="EDL06059.1"
FT                   /translation="MFLAGSFIVLCGLLAQSTAQLAGLPYPLGQDLPMSMGHCRSLHVG
FT                   QTLPYYGVTPVVSTYPSDHLDRNFRDAFRHGLLSGGILSFLEHIPLLNYVRPTGSNAGG
FT                   LVGVLGKVISSIPLLNNILDIRVTNPQLLEIGLVQSYDFHHLYVTIPLGFDLRVNTLVV
FT                   GSLLELSVKLDVTAEVYAVRDSYGRSRLVIGDCIYPPGSLRISLLNRCVLWSMGFSASW
FT                   TSP"
FT   assembly_gap    2847776..2850467
FT                   /estimated_length=2692
FT                   /gap_type="unknown"
FT   assembly_gap    2851151..2851403
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    2854255..2855152
FT                   /estimated_length=898
FT                   /gap_type="unknown"
FT   assembly_gap    2857298..2857631
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    2862871..2863091
FT                   /estimated_length=221
FT                   /gap_type="unknown"
FT   gene            <2870445..2892637
FT                   /gene="U46068"
FT                   /locus_tag="mCG_3683"
FT                   /note="gene_id=mCG3683.2"
FT   mRNA            join(<2870445..2870485,2872635..2872791,2874677..2874815,
FT                   2875419..2875526,2876415..2876564,2877097..2877178,
FT                   2881159..2881222,2882799..2882884,2884249..2884428,
FT                   2884780..2884833,2885309..2885467,2886576..2886643,
FT                   2887115..2887160,2890489..2890566,2892475..2892637)
FT                   /gene="U46068"
FT                   /locus_tag="mCG_3683"
FT                   /product="cDNA sequence U46068"
FT                   /note="gene_id=mCG3683.2 transcript_id=mCT2870.2 created on
FT                   13-AUG-2002"
FT   CDS             join(<2870447..2870485,2872635..2872791,2874677..2874815,
FT                   2875419..2875526,2876415..2876564,2877097..2877178,
FT                   2881159..2881222,2882799..2882884,2884249..2884428,
FT                   2884780..2884833,2885309..2885467,2886576..2886643,
FT                   2887115..2887160,2890489..2890566,2892475..2892507)
FT                   /codon_start=1
FT                   /gene="U46068"
FT                   /locus_tag="mCG_3683"
FT                   /product="cDNA sequence U46068"
FT                   /note="gene_id=mCG3683.2 transcript_id=mCT2870.2
FT                   protein_id=mCP11593.2"
FT                   /protein_id="EDL06061.1"
FT                   /translation="GEEQADPGLRHIQVLLPATYFSATPRKMAGPWIITLLCGLLGATL
FT                   VQANGYPPAVLNLGPEVIQKHLTQALKDHDATAILQELPLLRAMQDKSGSIPILDSFVH
FT                   TVLKYIIWMKVTSANILQLDVQPSTYDQELVVRIPLDMVAGLNTPLIKTIVEFQMSTEV
FT                   QALIRVERSKSGPAHLNLSDCSSNESTLRLSLLHKLSFVVNSLAKNVMNLLVPALPQIV
FT                   KNHLCPMIQQAFDDMYEDFLRLTTAPIALSPGALEFGLLSPAIQDSNILLNLKAKLLDS
FT                   QARVTNWFNNSATSLMETTPDGAPFSLTVRQDLVNAIVTTLVPKEELVILLRFVIPDVA
FT                   RQLQMDIKEINAEAANKLGPTQMLKIFTHSTPHIVLNEGSARAAQSVVLEVFPTNTDVR
FT                   PFFSLGIEASYEAQFFTEDNRLMLNFNNVSIERIKLMISDIKLFDGKLRTGVPMSMSKA
FT                   LGYEKAMWSVSKGALKLTPASS"
FT   assembly_gap    2878924..2880746
FT                   /estimated_length=1823
FT                   /gap_type="unknown"
FT   assembly_gap    2886921..2886940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2887961..2887980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2889299..2889956
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    2895539..2898138
FT                   /estimated_length=2600
FT                   /gap_type="unknown"
FT   gene            <2899144..2913192
FT                   /gene="BC018465"
FT                   /locus_tag="mCG_140852"
FT                   /note="gene_id=mCG140852.0"
FT   mRNA            join(<2899144..2899254,2900121..2900252,2900912..2900996,
FT                   2901089..2901152,2901525..2901610,2902231..2902413,
FT                   2906007..2906074,2906204..2906249,2907045..2907076,
FT                   2907231..2907276,2908802..2908865,2911120..2911199,
FT                   2913050..2913192)
FT                   /gene="BC018465"
FT                   /locus_tag="mCG_140852"
FT                   /product="cDNA sequence BC018465"
FT                   /note="gene_id=mCG140852.0 transcript_id=mCT171814.0
FT                   created on 04-FEB-2003"
FT   CDS             join(<2899145..2899254,2900121..2900252,2900912..2900996,
FT                   2901089..2901152,2901525..2901610,2902231..2902413,
FT                   2906007..2906074,2906204..2906249,2907045..2907076,
FT                   2907231..2907276,2908802..2908865,2911120..2911199,
FT                   2913050..2913079)
FT                   /codon_start=1
FT                   /gene="BC018465"
FT                   /locus_tag="mCG_140852"
FT                   /product="cDNA sequence BC018465"
FT                   /note="gene_id=mCG140852.0 transcript_id=mCT171814.0
FT                   protein_id=mCP94733.0"
FT                   /protein_id="EDL06062.1"
FT                   /translation="HRLVIEDAKGPEVTLQILSDSLLQITLRCKLYLSFLEILWLEAIK
FT                   NIRIGVRLEQIGNKTQVAFEECHTPPGSLNIEILKRSDTLLPNQLLKLVTNTLEKSLPF
FT                   LLQKIVCPVATNLINFLLEDILHIILPPIISGPDDFQYYVTTTEFTEGAILMRVELVTP
FT                   CGPHQRAPRSEHMVPPPLPGLSQNSMADLAFWLEIYNDILACLYTSQEISVEPQDSSQL
FT                   LCRGEFSLRSQKQQLQFAPHGAVVTLGPYPTIIKEQQKQQLQFAPHGAVVTLGPYPTII
FT                   KEQEERLKTLLLAVLKRWFLPHHNEWLREHSLPLPNIKGVSFSLAQMDFSEDYILLTVP
FT                   E"
FT   assembly_gap    2904669..2904929
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    2907025..2907044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2909191..2909427
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    2915642..2922926
FT                   /estimated_length=7285
FT                   /gap_type="unknown"
FT   assembly_gap    2925466..2932737
FT                   /estimated_length=7272
FT                   /gap_type="unknown"
FT   gene            <2932780..2934438
FT                   /locus_tag="mCG_116891"
FT                   /note="gene_id=mCG116891.0"
FT   mRNA            join(<2932780..2932849,2933095..2933125,2934366..2934438)
FT                   /locus_tag="mCG_116891"
FT                   /product="mCG116891, transcript variant mCT118019"
FT                   /note="gene_id=mCG116891.0 transcript_id=mCT118019.0
FT                   created on 13-AUG-2002"
FT   mRNA            join(<2932781..2932849,2934366..>2934433)
FT                   /locus_tag="mCG_116891"
FT                   /product="mCG116891, transcript variant mCT171809"
FT                   /note="gene_id=mCG116891.0 transcript_id=mCT171809.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<2932781..2932849,2934366..>2934433)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116891"
FT                   /product="mCG116891, isoform CRA_b"
FT                   /note="gene_id=mCG116891.0 transcript_id=mCT171809.0
FT                   protein_id=mCP94728.0 isoform=CRA_b"
FT                   /protein_id="EDL06064.1"
FT                   /translation="EIIHLPWQQDFKLHTDTRCQAHKKEEVEGILSEVGKVAWSNFNGM
FT                   "
FT   CDS             join(<2932782..2932849,2933095..2933125,2934366..2934434)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116891"
FT                   /product="mCG116891, isoform CRA_a"
FT                   /note="gene_id=mCG116891.0 transcript_id=mCT118019.0
FT                   protein_id=mCP72748.0 isoform=CRA_a"
FT                   /protein_id="EDL06063.1"
FT                   /translation="KLFISHGSKISNSTLIPDVKLIRSEHSVVPPEAKEEVEGILSEVG
FT                   KVAWSNFNGM"
FT   assembly_gap    2934659..2936559
FT                   /estimated_length=1901
FT                   /gap_type="unknown"
FT   assembly_gap    2939103..2939397
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    2946168..2946187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2961310..2961329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2972512..>2976838
FT                   /locus_tag="mCG_116886"
FT                   /note="gene_id=mCG116886.0"
FT   mRNA            join(<2972512..2972618,2974677..2974956,2976616..>2976838)
FT                   /locus_tag="mCG_116886"
FT                   /product="mCG116886"
FT                   /note="gene_id=mCG116886.0 transcript_id=mCT118014.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<2972514..2972618,2974677..2974956,2976616..>2976838)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116886"
FT                   /product="mCG116886"
FT                   /note="gene_id=mCG116886.0 transcript_id=mCT118014.0
FT                   protein_id=mCP72694.0"
FT                   /protein_id="EDL06065.1"
FT                   /translation="GTGWAIKGDTCFRKTAEAGAGEAAPEDSKPSTRGKVSATKMWVLQ
FT                   ALAIMLSIQAGTLDLVETPPVVGNLPVAVPAPLNLPVGGLSPPVLKGPVNHQMLPPKRP
FT                   VPPPKGGKCAPAARYFLSSDKLHDYLMSTLPPQIEDMVKCDEVNLEGMLADVLNTVESS
FT                   DLLSLLDGISLLKAGEGGGLGIGGLLGNEGNGDSSKPSSG"
FT   assembly_gap    2976839..2980732
FT                   /estimated_length=3894
FT                   /gap_type="unknown"
FT   gene            <2980741..2983447
FT                   /locus_tag="mCG_116895"
FT                   /note="gene_id=mCG116895.0"
FT   mRNA            join(<2980741..2980901,2981507..2981629,2981787..2981854,
FT                   2982100..2982130,2983375..2983447)
FT                   /locus_tag="mCG_116895"
FT                   /product="mCG116895"
FT                   /note="gene_id=mCG116895.0 transcript_id=mCT118023.0
FT                   created on 13-AUG-2002"
FT   CDS             join(<2980743..2980901,2981507..2981629,2981787..2981854,
FT                   2982100..2982130,2983375..2983443)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116895"
FT                   /product="mCG116895"
FT                   /note="gene_id=mCG116895.0 transcript_id=mCT118023.0
FT                   protein_id=mCP73041.0"
FT                   /protein_id="EDL06066.1"
FT                   /translation="LPSLAKANIGNKTVPVPGGRLPPDPKNASIAVTISSTTLKTLVKE
FT                   VAKNSSVQMDGLEAQITHIAFASQENNTLRVVYKVDITKNGEHFATGETKLFISHGSKI
FT                   SNSTLIPDVKLIRSEHSVVPPEAKEEVEGILSEVGKAAWSNFNGM"
FT   assembly_gap    2984155..2985231
FT                   /estimated_length=1077
FT                   /gap_type="unknown"
FT   assembly_gap    2988781..2988800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2992028..2992047
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2997229..2997450
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   gene            complement(3000001..3031650)
FT                   /gene="Cdk5rap1"
FT                   /locus_tag="mCG_3682"
FT                   /note="gene_id=mCG3682.1"
FT   mRNA            complement(join(3000001..3000147,3007021..3007161,
FT                   3010606..3010755,3013391..3013521,3015558..3015613,
FT                   3016922..3017019,3017930..3018160,3018830..3018950,
FT                   3019966..3020176,3024747..3024847,3026990..3027024,
FT                   3027588..3027691,3029412..3029731,3031612..3031650))
FT                   /gene="Cdk5rap1"
FT                   /locus_tag="mCG_3682"
FT                   /product="CDK5 regulatory subunit associated protein 1"
FT                   /note="gene_id=mCG3682.1 transcript_id=mCT2869.1 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(3000061..3000147,3007021..3007161,
FT                   3010606..3010755,3013391..3013521,3015558..3015613,
FT                   3016922..3017019,3017930..3018160,3018830..3018950,
FT                   3019966..3020176,3024747..3024847,3026990..3027024,
FT                   3027588..3027691,3029412..3029712))
FT                   /codon_start=1
FT                   /gene="Cdk5rap1"
FT                   /locus_tag="mCG_3682"
FT                   /product="CDK5 regulatory subunit associated protein 1"
FT                   /note="gene_id=mCG3682.1 transcript_id=mCT2869.1
FT                   protein_id=mCP11592.1"
FT                   /protein_id="EDL06067.1"
FT                   /translation="MHPLRCVLQVQRLSAPFTSMCWVLLRTCRAQSSVSSTPCPSPEAK
FT                   SSEAQKDFSSRLATGPTFQHFLRSASVPQEKPSSPEVEDPPPYLSGDELLGRQRKVYLE
FT                   TYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVILLVTCSIREKAEQTIWNRLHQLKV
FT                   LKTKRPRSRVPLRIGILGCMAERLKGEILNREKMVDLLAGPDAYRDLPRLLAVVESGQQ
FT                   AANVLLSLDETYADIMPVQTSPSATSAFVSIMRGCDNMCSYCIVPFTRGRERSRPVASI
FT                   LDEVRKLSEQGLKEVTLLGQNVNSFRDNSEVQFNNAGSANLSRGFTTNYKPKQGGLRFS
FT                   HLLDQVSRIDPEMRIRFTSPHPKDFPDEVLQLIRERHNICKQIHLPAQSGSSRVLDAMR
FT                   RGYSREAYVALVHHVRETIPGVSLSSDFITGFCGETEDDHRQTVSLLREVQYNTGFLFA
FT                   YSMRQKTRAYHRLKDDVPEEVKLRRLEELITVFREEASKANKTSVGCSQLVLVEGFSKR
FT                   STTDLCGRNDANLKVIFPDAEVEDITNPGLKVRAQPGDYVLVKITSASSQTLKGHILCR
FT                   TTMKDSLTYCTT"
FT   assembly_gap    3000969..3000988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3003296..3003344
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    3022806..3022825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3030773..3030950
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   gene            complement(3035269..3068325)
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /note="gene_id=mCG3681.2"
FT   mRNA            complement(join(3035269..3035856,3035955..3036142,
FT                   3036956..3037206,3039632..3039762,3039869..3040076,
FT                   3042738..3042942,3063966..3064151,3067924..3068325))
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /product="syntrophin, acidic 1, transcript variant mCT2872"
FT                   /note="gene_id=mCG3681.2 transcript_id=mCT2872.2 created on
FT                   13-AUG-2002"
FT   mRNA            complement(join(3035276..3035856,3035955..3036142,
FT                   3036956..3037152,3039632..3039762,3039869..3040076,
FT                   3042738..3042942,3063966..3064151,3067924..>3068276))
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /product="syntrophin, acidic 1, transcript variant
FT                   mCT189873"
FT                   /note="gene_id=mCG3681.2 transcript_id=mCT189873.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3035764..3035856,3035955..3036142,
FT                   3036956..3037152,3039632..3039762,3039869..3040076,
FT                   3042738..3042942,3063966..3064151,3067924..>3068275))
FT                   /codon_start=1
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /product="syntrophin, acidic 1, isoform CRA_a"
FT                   /note="gene_id=mCG3681.2 transcript_id=mCT189873.0
FT                   protein_id=mCP110884.0 isoform=CRA_a"
FT                   /protein_id="EDL06068.1"
FT                   /translation="GAGRVRRDRASAVYWDFEAKMASGRRAPRTGLLELRCGAGSGAGG
FT                   ERWQRVLLSLAEDALTVSPADGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTV
FT                   RKADAGGLGISIKGGRENKMPILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHD
FT                   EAVQALKKTGKEVVLEVKYMKEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRN
FT                   LSEAKHVSLKMAYVSRRCTPTDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQ
FT                   IGTFIPWVKDELQALLTATGTAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLFYCS
FT                   LPQSREALSRPTRTAPLIATRLVHSGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVES
FT                   PQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAM
FT                   LLRQPFEKLQMSSDDGTSLLFLDFGGAEGEIQLDLHSCPKTMVFIIHSFLSAKVTRLGL
FT                   LA"
FT   CDS             complement(join(3035764..3035856,3035955..3036142,
FT                   3036956..3037206,3039632..3039762,3039869..3040076,
FT                   3042738..3042942,3063966..3064151,3067924..3068215))
FT                   /codon_start=1
FT                   /gene="Snta1"
FT                   /locus_tag="mCG_3681"
FT                   /product="syntrophin, acidic 1, isoform CRA_b"
FT                   /note="gene_id=mCG3681.2 transcript_id=mCT2872.2
FT                   protein_id=mCP11591.2 isoform=CRA_b"
FT                   /protein_id="EDL06069.1"
FT                   /translation="MASGRRAPRTGLLELRCGAGSGAGGERWQRVLLSLAEDALTVSPA
FT                   DGEPGPEPEPAQLNGAAEPGAAPPQLPEALLLQRRRVTVRKADAGGLGISIKGGRENKM
FT                   PILISKIFKGLAADQTEALFVGDAILSVNGEDLSSATHDEAVQALKKTGKEVVLEVKYM
FT                   KEVSPYFKNSAGGTSVGWDSPPASPLQRQPSSPGPQPRNLSEAKHVSLKMAYVSRRCTP
FT                   TDPEPRYLEICAADGQDAVFLRAKDEASARSWAGAIQAQIGTFIPWVKDELQALLTATG
FT                   TAGSQDIKQIGWLTEQLPSGGTAPTLALLTEKELLFYCSLPQSREALSRPTRTAPLIAT
FT                   RSLPRPHPAPCLALCSAHRLVHSGPSKGSVPYDAELSFALRTGTRHGVDTHLFSVESPQ
FT                   ELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAMLL
FT                   RQPFEKLQMSSDDGTSLLFLDFGGAEGEIQLDLHSCPKTMVFIIHSFLSAKVTRLGLLA
FT                   "
FT   assembly_gap    3044607..3045357
FT                   /estimated_length=751
FT                   /gap_type="unknown"
FT   assembly_gap    3046478..3046830
FT                   /estimated_length=353
FT                   /gap_type="unknown"
FT   assembly_gap    3047588..3047821
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    3069534..3070482
FT                   /estimated_length=949
FT                   /gap_type="unknown"
FT   assembly_gap    3076447..3082924
FT                   /estimated_length=6478
FT                   /gap_type="unknown"
FT   assembly_gap    3084542..3084561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3085722..3087420
FT                   /locus_tag="mCG_1027983"
FT                   /note="gene_id=mCG1027983.0"
FT   mRNA            join(<3085722..3085851,3086848..3087420)
FT                   /locus_tag="mCG_1027983"
FT                   /product="mCG1027983"
FT                   /note="gene_id=mCG1027983.0 transcript_id=mCT145687.0
FT                   created on 13-AUG-2002"
FT   gene            complement(<3086847..>3088489)
FT                   /locus_tag="mCG_140851"
FT                   /note="gene_id=mCG140851.0"
FT   mRNA            complement(join(<3086847..3087467,3088447..>3088489))
FT                   /locus_tag="mCG_140851"
FT                   /product="mCG140851"
FT                   /note="gene_id=mCG140851.0 transcript_id=mCT171806.0
FT                   created on 13-AUG-2002"
FT   CDS             complement(<3086847..>3087030)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140851"
FT                   /product="mCG140851"
FT                   /note="gene_id=mCG140851.0 transcript_id=mCT171806.0
FT                   protein_id=mCP94725.0"
FT                   /protein_id="EDL06071.1"
FT                   /translation="LWVVKSRKENSGAKELALCSPHSPLPPFLSFFLFFFKIDCFITCK
FT                   YSVAIFRHTRRGHQIS"
FT   CDS             <3086969..3087232
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027983"
FT                   /product="mCG1027983"
FT                   /note="gene_id=mCG1027983.0 transcript_id=mCT145687.0
FT                   protein_id=mCP72922.0"
FT                   /protein_id="EDL06070.1"
FT                   /translation="GEQRANSLAPEFSFLLFTTQSQGLPKSLPLVTHTAPPFCGSPHIH
FT                   TARTQASARATLFLFLADVSHGLFFTQKFPQKHSLVIFPKSQ"
FT   gene            <3103579..3208364
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /note="gene_id=mCG3688.2"
FT   mRNA            join(<3103579..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200239..3200426,3203898..3204768)
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), transcript variant
FT                   mCT189876"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT189876.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3103580..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200239..3200426,3203898..3204194)
FT                   /codon_start=1
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), isoform CRA_a"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT189876.0
FT                   protein_id=mCP110885.0 isoform=CRA_a"
FT                   /protein_id="EDL06072.1"
FT                   /translation="RRRWCGRVRRVQVPACACGGLRQRVEASGARDRLRSAMVGVPGAA
FT                   AFQLGCEKRVPAMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTALSNGINHS
FT                   PPTLNGAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISP
FT                   EIGEKVRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCAR
FT                   AAKQTPSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERDTVPP
FT                   EPPAKRVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKML
FT                   EHREVRERHHNLSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAV
FT                   LRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPAT
FT                   GYVPVEFWKKTEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAA
FT                   EDAFLVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHG
FT                   HSPHSQSRPLLPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL"
FT   mRNA            join(<3103594..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200236..3200426,3203898..3204085,3205332..3208364)
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), transcript variant
FT                   mCT2866"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT2866.2 created on
FT                   13-AUG-2002"
FT   CDS             join(<3103595..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200236..3200426,3203898..3204085,3205332..3205443)
FT                   /codon_start=1
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), isoform CRA_c"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT2866.2
FT                   protein_id=mCP11588.2 isoform=CRA_c"
FT                   /protein_id="EDL06074.1"
FT                   /translation="GRVRRVQVPACACGGLRQRVEASGARDRLRSAMVGVPGAAAFQLG
FT                   CEKRVPAMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLN
FT                   GAPSPPQRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEK
FT                   VRTLVLALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQT
FT                   PSQYLAQHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERDTVPPEPPAK
FT                   RVCTISPAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREV
FT                   RERHHNLSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVLRRCQ
FT                   ESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPATGYVPV
FT                   EFWKKTEEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAAEDAF
FT                   LVINEQEESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHGHSPH
FT                   SQSRPLLPGGRGSARNFSNYLILQIEFGDIDLVIIGPIDQAKYCSHLFLAI"
FT   mRNA            join(<3103612..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200236..3200426,3203898..3204796)
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), transcript variant
FT                   mCT189877"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT189877.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3103613..3103724,3169429..3169572,3173582..3173823,
FT                   3179565..3179654,3184883..3185064,3186775..3187028,
FT                   3190217..3190302,3192970..3193165,3197903..3197971,
FT                   3200236..3200426,3203898..3204194)
FT                   /codon_start=1
FT                   /gene="Cbfa2t2h"
FT                   /locus_tag="mCG_3688"
FT                   /product="core-binding factor, runt domain, alpha subunit
FT                   2, translocated to, 2 homolog (human), isoform CRA_b"
FT                   /note="gene_id=mCG3688.2 transcript_id=mCT189877.0
FT                   protein_id=mCP110886.0 isoform=CRA_b"
FT                   /protein_id="EDL06073.1"
FT                   /translation="QVPACACGGLRQRVEASGARDRLRSAMVGVPGAAAFQLGCEKRVP
FT                   AMPGSPVEVKIQSRSSPPIMPPLPPINPGGPRPVSFTPTALSNGINHSPPTLNGAPSPP
FT                   QRFSNGPASSTSSALTNQQLPATCGARQLSKLKRFLTTLQQFGNDISPEIGEKVRTLVL
FT                   ALVNSTVTIEEFHCKLQEATNFPLRPFVIPFLKANLPLLQRELLHCARAAKQTPSQYLA
FT                   QHEHLLLNTSIASPADSSELLMEVHGNGKRPSPERRDENNFERDTVPPEPPAKRVCTIS
FT                   PAPRHSPALTVPLMNPGGQFHPTPPPLQHYTLEDIATSHLYREPNKMLEHREVRERHHN
FT                   LSLNGGYQDELVDHRLTEREWADEWKHLDHALNCIMEMVEKTRRSMAVLRRCQESDREE
FT                   LNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSNDSQREFTSRPATGYVPVEFWKKT
FT                   EEAVNKVKIQAMSEVQKAVAEAEQKAFEVIATERARMEQTIADVKRQAAEDAFLVINEQ
FT                   EESTENCWNCGRKASETCSGCNIARYCGSFCQHKDWERHHRLCGQSLHGHSPHSQSRPL
FT                   LPGGRGSARSADCSVPSPALDKTSATTSRSSTPASVTAIDANGL"
FT   assembly_gap    3106132..3106151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3130122..3466344)
FT                   /locus_tag="mCG_147175"
FT                   /note="gene_id=mCG147175.0"
FT   mRNA            complement(join(3130122..3130899,3466314..3466344))
FT                   /locus_tag="mCG_147175"
FT                   /product="mCG147175"
FT                   /note="gene_id=mCG147175.0 transcript_id=mCT187438.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3130405..3130530)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147175"
FT                   /product="mCG147175"
FT                   /note="gene_id=mCG147175.0 transcript_id=mCT187438.0
FT                   protein_id=mCP109235.0"
FT                   /protein_id="EDL06075.1"
FT                   /translation="MKTRDLATDRTHFVVVVVWLVGWFWFFLHPQGLEAIPSPRI"
FT   assembly_gap    3151808..3151827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3153434..3156352)
FT                   /locus_tag="mCG_147184"
FT                   /note="gene_id=mCG147184.0"
FT   mRNA            complement(join(3153434..3155287,3155537..3156352))
FT                   /locus_tag="mCG_147184"
FT                   /product="mCG147184"
FT                   /note="gene_id=mCG147184.0 transcript_id=mCT187447.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3155955..3156332)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147184"
FT                   /product="mCG147184"
FT                   /note="gene_id=mCG147184.0 transcript_id=mCT187447.0
FT                   protein_id=mCP109245.0"
FT                   /protein_id="EDL06076.1"
FT                   /translation="MRGTLSCILGSKKSFTSHHHIPGHTTQIFSFYTYLSNSDRACQPP
FT                   LGFHLVVCPLIFEKLCSYGPQKDTVSGLEWEKAHTHKQQRTWGSGVERPKTKTAMRSFW
FT                   QYANCNSIWYGTSDIEHGALR"
FT   assembly_gap    3174603..3174622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3213273..3227766)
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /note="gene_id=mCG3680.3"
FT   mRNA            complement(join(3213273..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3225937..3225968,
FT                   3227626..3227766))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT185429"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185429.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3213279..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3225944..3225968,3227626..3227740))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT2876"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT2876.1 created on
FT                   12-JUN-2003"
FT   mRNA            complement(join(3213279..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3226269..3226365))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT185426"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185426.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3213279..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215196,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3225944..3226168))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT185428"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185428.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(3213280..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215196,3215684..3215763,
FT                   3215920..3216038,3216308..3216444,3223534..3223631,
FT                   3223787..3223812,3224474..3224582,3225944..3225968,
FT                   3227626..3227740))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT171811"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT171811.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215196,3215684..3215763,
FT                   3215920..3216038,3216308..3216444,3223534..3223631,
FT                   3223787..3223812,3224474..3224582,3225944..3225968,
FT                   3227626..3227727))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_a"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT171811.0
FT                   protein_id=mCP94730.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D6J4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1861721"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D6J4"
FT                   /protein_id="EDL06077.1"
FT                   /translation="MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDG
FT                   KLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAAL
FT                   ESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLEAQAH
FT                   GQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQVNRL
FT                   QELIDQLECKRQVQVAEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAFTLYEF
FT                   WQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3225944..3225968,3227626..3227727))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_e"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT2876.1
FT                   protein_id=mCP11587.1 isoform=CRA_e"
FT                   /db_xref="GOA:Q9D6J4"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1861721"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9D6J4"
FT                   /protein_id="EDL06081.1"
FT                   /translation="MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDG
FT                   KLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAAL
FT                   ESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLEAQAH
FT                   GQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQVNRL
FT                   QELIDQLECKAPRLEPTHEEDLTKGFDSHILVAQRQVQVAEDALQDFHRALCCYMNFTG
FT                   AQSHCLHVSAQKMLDNAAFTLYEFWQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTT
FT                   VFFPASWWIMNNN"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3225937..3225968,
FT                   3227626..3227727))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_d"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185429.0
FT                   protein_id=mCP106686.0 isoform=CRA_d"
FT                   /protein_id="EDL06080.1"
FT                   /translation="MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNGEC
FT                   NLETEKLCDYFSTHLGVYRPVLAALESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLR
FT                   ETVNQLQALQTSLEGASDTLEAQAHGQRLDEETIKAQSRPCGSRRAGRRALRSISWSPS
FT                   WSPGSSDTGRSSEAEQQWRLQVNRLQELIDQLECKAPRLEPTHEEDLTKGFDSHILVAQ
FT                   RQVQVAEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAFTLYEFWQDEASWRRH
FT                   QQSPCSKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215214,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223631,3223787..3223812,3224474..3224582,
FT                   3226269..3226278))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_b"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185426.0
FT                   protein_id=mCP106687.0 isoform=CRA_b"
FT                   /protein_id="EDL06078.1"
FT                   /translation="MPKDDGKLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETE
FT                   KLCDYFSTHLGVYRPVLAALESLNRAVLTAMDTTKLEYEQASKVDQFVTRFLLRETVNQ
FT                   LQALQTSLEGASDTLEAQAHGQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGS
FT                   SDTGRSSEAEQQWRLQVNRLQELIDQLECKAPRLEPTHEEDLTKGFDSHILVAQRQVQV
FT                   AEDALQDFHRALCCYMNFTGAQSHCLHVSAQKMLDNAAFTLYEFWQDEASWRRHQQSPC
FT                   SKAFQRTLIDHLQAPDTLTTVFFPASWWIMNNN"
FT   CDS             complement(join(3214013..3214041,3214129..3214220,
FT                   3214900..3214977,3215102..3215196,3215553..3215606,
FT                   3215684..3215763,3215920..3216038,3216308..3216444,
FT                   3223534..3223551))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_c"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185428.0
FT                   protein_id=mCP106684.0 isoform=CRA_c"
FT                   /protein_id="EDL06079.1"
FT                   /translation="MDTTKLEYEQASKVDQFVTRFLLRETVNQLQALQTSLEGASDTLE
FT                   AQAHGQRLDEETIKAQSRPCGSRRAGRRALRSISWSPSWSPGSSDTGRSSEAEQQWRLQ
FT                   VNRLQELIDQLECKAPRLEPTHEEDLTKGFDSRQVQVAEDALQDFHRALCCYMNFTGAQ
FT                   SHCLHVSAQKMLDNAAFTLYEFWQDEASWRRHQQSPCSKAFQRTLIDHLQAPDTLTTVF
FT                   FPASWWIMNNN"
FT   gene            <3216002..3218890
FT                   /locus_tag="mCG_3690"
FT                   /note="gene_id=mCG3690.2"
FT   mRNA            join(<3216002..3216056,3217839..3217950,3218219..>3218713)
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, transcript variant mCT171813"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT171813.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(<3216025..3216056,3217839..3217950,3218219..>3218713)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, isoform CRA_a"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT171813.0
FT                   protein_id=mCP94732.0 isoform=CRA_a"
FT                   /protein_id="EDL06083.1"
FT                   /translation="FLHPTWKESRSSHKRTKAPNQANKDRPPDMDKARHKQFFSHLKRK
FT                   KPSWREAPDPARVGENPRIKAGKVCSGQWVPVGRQGLRVRGTVGLRRLGRARKKPQAPR
FT                   GHVLPFTPAHPQTKIVLLFPLDKRQQLAEAAAGPFVRPVRPTEDPLGAPTCFPAVAPML
FT                   RGAGDGVDRREGARAREMKRILVLLLQLDARLQEEGRRVGGRPGGGAKVP"
FT   mRNA            join(<3217769..3217950,3218219..3218278,3218423..3218890)
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, transcript variant mCT2863"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT2863.2 created on
FT                   13-AUG-2002"
FT   CDS             join(<3217771..3217950,3218219..3218278,3218423..3218830)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, isoform CRA_b"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT2863.2
FT                   protein_id=mCP11589.2 isoform=CRA_b"
FT                   /protein_id="EDL06084.1"
FT                   /translation="PRQHGQWPLVTSPVTSPIMGNSSSHKRTKAPNQANKDRPPDMDKA
FT                   RHKQFFSHLKRKKPSWREAPDPARVGENPRIKAGKTKIVLLFPLDKRQQLAEAAAGPFV
FT                   RPVRPTEDPLGAPTCFPAVAPMLRGAGDGVDRREGARAREMKRILVLLLQLDARLQEEG
FT                   RRVGGRPGGGAKVPQCWQPLYAHVLTQRDACGEGDPREEQPRKRRRCPRPRP"
FT   mRNA            join(<3217810..3217950,3218180..3218278,3218423..>3218579)
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, transcript variant mCT171812"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT171812.0 created
FT                   on 13-AUG-2002"
FT   CDS             join(<3217810..3217950,3218180..3218278,3218423..>3218579)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3690"
FT                   /product="mCG3690, isoform CRA_c"
FT                   /note="gene_id=mCG3690.2 transcript_id=mCT171812.0
FT                   protein_id=mCP94731.0 isoform=CRA_c"
FT                   /protein_id="EDL06085.1"
FT                   /translation="VTSPIMGNSSSHKRTKAPNQANKDRPPDMDKARHKQFFSHLKRKK
FT                   PSPMASQHATFPFFQWREAPDPARVGENPRIKAGKTKIVLLFPLDKRQQLAEAAAGPFV
FT                   RPVRPTEDPLGAPTCFPAVAPMLRGAGD"
FT   mRNA            complement(join(3223177..3223631,3223787..3223812,
FT                   3224474..3224582,3225944..3225968,3227626..3227740))
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, transcript variant
FT                   mCT185427"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185427.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(3223408..3223631,3223787..3223812,
FT                   3224474..3224582,3225944..3225968,3227626..3227727))
FT                   /codon_start=1
FT                   /gene="Apba2bp"
FT                   /locus_tag="mCG_3680"
FT                   /product="amyloid beta (A4) precursor protein-binding,
FT                   family A, member 1 binding protein, isoform CRA_f"
FT                   /note="gene_id=mCG3680.3 transcript_id=mCT185427.0
FT                   protein_id=mCP106685.0 isoform=CRA_f"
FT                   /protein_id="EDL06082.1"
FT                   /translation="MACAGLLTVCLLGPPAPQQPRHSAPAAGHALFQDVFRRADKNDDG
FT                   KLSFEEFQNYFADGVLSSAELRELFSGIDDHLTDNLETEKLCDYFSTHLGVYRPVLAAL
FT                   ESLNRAVLTAMDTTKLVSAGRGRGEPEVSEPSEAVETRVGFKFWHSYLPTVPFPPEP"
FT   assembly_gap    3227767..3227786
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3228664..3240921)
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /note="gene_id=mCG3689.2"
FT   mRNA            complement(join(3228664..3229703,3230099..3230575,
FT                   3230671..3230890,3230987..3231101,3234017..3234169,
FT                   3234968..3235187,3235491..3235581,3240558..3240921))
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /product="E2F transcription factor 1, transcript variant
FT                   mCT2867"
FT                   /note="gene_id=mCG3689.2 transcript_id=mCT2867.2 created on
FT                   21-AUG-2002"
FT   assembly_gap    3229765..3229784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3229785..3230575,3230671..3230890,
FT                   3230987..3231101,3234017..3234169,3234968..3235187,
FT                   3235491..3235581,3240136..3240488))
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /product="E2F transcription factor 1, transcript variant
FT                   mCT172117"
FT                   /note="gene_id=mCG3689.2 transcript_id=mCT172117.0 created
FT                   on 21-AUG-2002"
FT   CDS             complement(join(3230328..3230575,3230671..3230890,
FT                   3230987..3231101,3234017..3234169,3234968..3235187,
FT                   3235491..3235581,3240558..3240803))
FT                   /codon_start=1
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /product="E2F transcription factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG3689.2 transcript_id=mCT2867.2
FT                   protein_id=mCP11586.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q547J6"
FT                   /db_xref="InterPro:IPR003316"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015633"
FT                   /db_xref="InterPro:IPR032198"
FT                   /db_xref="MGI:MGI:101941"
FT                   /db_xref="UniProtKB/TrEMBL:Q547J6"
FT                   /protein_id="EDL06086.1"
FT                   /translation="MAVAPAGGQHAPALEALLGAGALRLLDSSQIVIISTAPDVGAPQL
FT                   PAAPPTGPRDSDVLLFATPQAPRPAPSAPRPALGRPPVKRRLDLETDHQYLAGSSGPFR
FT                   GRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLNWAAEVLKVQKRRIY
FT                   DITNVLEGIQLIAKKSKNHIQWLGSHTMVGIGKRLEGLTQDLQQLQESEQQLDHLMHIC
FT                   TTQLQLLSEDSDTQRLAYVTCQDLRSIADPAEQMVIVIKAPPETQLQAVDSSETFQISL
FT                   KSKQGPIDVFLCPEESADGISPGKTSCQETSSGEDRTADSGPAGPPPSPPSTSPALDPS
FT                   QSLLGLEQEAVLPRMGHLRVPMEEDQLSPLVAADSLLEHVKEDFSGLLPGEFISLSPPH
FT                   EALDYHFGLEEGEGIRDLFDCDFGDLTPLDF"
FT   CDS             complement(join(3230328..3230575,3230671..3230890,
FT                   3230987..3231101,3234017..3234169,3234968..3235187,
FT                   3235491..3235581,3240136..3240246))
FT                   /codon_start=1
FT                   /gene="E2f1"
FT                   /locus_tag="mCG_3689"
FT                   /product="E2F transcription factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG3689.2 transcript_id=mCT172117.0
FT                   protein_id=mCP95036.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q9CYB4"
FT                   /db_xref="InterPro:IPR003316"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR015633"
FT                   /db_xref="InterPro:IPR032198"
FT                   /db_xref="MGI:MGI:101941"
FT                   /db_xref="UniProtKB/TrEMBL:Q9CYB4"
FT                   /protein_id="EDL06087.1"
FT                   /translation="MGKCFTQLQMVGLIFELMSAGLLQNLWLGSAHSCLLEVKRRLDLE
FT                   TDHQYLAGSSGPFRGRGRHPGKGVKSPGEKSRYETSLNLTTKRFLELLSRSADGVVDLN
FT                   WAAEVLKVQKRRIYDITNVLEGIQLIAKKSKNHIQWLGSHTMVGIGKRLEGLTQDLQQL
FT                   QESEQQLDHLMHICTTQLQLLSEDSDTQRLAYVTCQDLRSIADPAEQMVIVIKAPPETQ
FT                   LQAVDSSETFQISLKSKQGPIDVFLCPEESADGISPGKTSCQETSSGEDRTADSGPAGP
FT                   PPSPPSTSPALDPSQSLLGLEQEAVLPRMGHLRVPMEEDQLSPLVAADSLLEHVKEDFS
FT                   GLLPGEFISLSPPHEALDYHFGLEEGEGIRDLFDCDFGDLTPLDF"
FT   assembly_gap    3232490..3232509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3256904..3275205)
FT                   /gene="Pxmp4"
FT                   /locus_tag="mCG_3687"
FT                   /note="gene_id=mCG3687.2"
FT   mRNA            complement(join(3256904..3259237,3263299..3263497,
FT                   3267716..3267778,3275033..3275205))
FT                   /gene="Pxmp4"
FT                   /locus_tag="mCG_3687"
FT                   /product="peroxisomal membrane protein 4"
FT                   /note="gene_id=mCG3687.2 transcript_id=mCT2873.2 created on
FT                   21-AUG-2002"
FT   CDS             complement(join(3258974..3259237,3263299..3263497,
FT                   3267716..3267778,3275033..3275145))
FT                   /codon_start=1
FT                   /gene="Pxmp4"
FT                   /locus_tag="mCG_3687"
FT                   /product="peroxisomal membrane protein 4"
FT                   /note="gene_id=mCG3687.2 transcript_id=mCT2873.2
FT                   protein_id=mCP11585.2"
FT                   /protein_id="EDL06088.1"
FT                   /translation="MAAPPQLQALLQAVNKLLRQRRYHAALAVIKGFRNGAVYGVKIRA
FT                   PHALVMTFLFRSGSLREKLQAILKATYIHSRNLACFVFAYKSLHALQSHVQGETHQMHS
FT                   FLAAFIGGLLLFGENNNINSQINMYLTSRVLYALCRLGVEKGYIPALKWDPFPLHTAVI
FT                   WGLVLWLFEYHRPTLQPSLQSSMTYLYEDSNVWHDLSDFLIFNKSHPSK"
FT   gene            complement(3283341..3284890)
FT                   /locus_tag="mCG_147174"
FT                   /note="gene_id=mCG147174.0"
FT   mRNA            complement(3283341..3284890)
FT                   /locus_tag="mCG_147174"
FT                   /product="mCG147174"
FT                   /note="gene_id=mCG147174.0 transcript_id=mCT187437.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3284467..3284652)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147174"
FT                   /product="mCG147174"
FT                   /note="gene_id=mCG147174.0 transcript_id=mCT187437.0
FT                   protein_id=mCP109234.0"
FT                   /protein_id="EDL06089.1"
FT                   /translation="MIAAHSLLQGCNTNPPHRDCLLHGYPTPCNCATLIGKQPSRRTPI
FT                   SGLNSSVYVRFPQCSS"
FT   assembly_gap    3284891..3284910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3286286..3286305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3287956..3287975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3291030..3292486
FT                   /estimated_length=1457
FT                   /gap_type="unknown"
FT   gene            3295887..3320896
FT                   /gene="Zfp341"
FT                   /locus_tag="mCG_50868"
FT                   /note="gene_id=mCG50868.1"
FT   mRNA            join(3295887..3295997,3299008..3299204,3300931..3301080,
FT                   3302930..3303125,3304532..3304622,3306434..3306624,
FT                   3308211..3308401,3312165..3312373,3315444..3315540,
FT                   3316107..3316239,3317588..3317699,3317886..3317956,
FT                   3319706..3320896)
FT                   /gene="Zfp341"
FT                   /locus_tag="mCG_50868"
FT                   /product="zinc finger protein 341"
FT                   /note="gene_id=mCG50868.1 transcript_id=mCT51051.1 created
FT                   on 21-AUG-2002"
FT   CDS             join(3295889..3295997,3299008..3299204,3300931..3301080,
FT                   3302930..3303125,3304532..3304622,3306434..3306624,
FT                   3308211..3308401,3312165..3312373,3315444..3315540,
FT                   3316107..3316239,3317588..3317699,3317886..3317956,
FT                   3319706..3320220)
FT                   /codon_start=1
FT                   /gene="Zfp341"
FT                   /locus_tag="mCG_50868"
FT                   /product="zinc finger protein 341"
FT                   /note="gene_id=mCG50868.1 transcript_id=mCT51051.1
FT                   protein_id=mCP38964.1"
FT                   /protein_id="EDL06090.1"
FT                   /translation="MDNQTVLAVQSLLDGQGAVPDPTGQSVNAPPAIQPLDDEDVFLCG
FT                   KCKKQFNSLPAFMTHKREQCQANAPALATVSLATNSIYTPSAAPAAVQQAPPPANRQIS
FT                   TYITVPPSPLIQTLVQGNILVSDDVLMSAMSAFTSLDQPMPPGPPPVQVPSQCVEAPVY
FT                   PTPPVYSPGKQEFKPKGPSSTAPMTNATGSTVATFDSPPTLKTRRAKGASGLPEAAGKP
FT                   KAQKLKCSYCDKSFTKNFDLQQHIRSHTGEKPFQCIACGRAFAQKSNVKKHMQTHKVWP
FT                   PGRSGGTVSRNSVTVQVMALNPNRQEEEDTGLGQSLSSTTQPQALPTAGEDEGDKPEAK
FT                   QVVLIGSSYLCQFCPSKFSTYFQLKSHMIQHKKEQVYKCVVKSCAQMFPKLDTFLEHIR
FT                   SHQEELSYRCHLCSKDFPSLYDLGVHQYSHSLLPQHSPKKDSTVYKCVKCVNKYSTPEA
FT                   LEHHVQTATHSFPCPHCQKVFPCERYLRRHLPTHGSGGRFRCQICKKFFRKEHYLKLHA
FT                   HIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSMHTGCSKEFNRQDKLKA
FT                   HILSHAGLKLHKCGLCSKSFSRRAHLAEHQRAHTGNYKFRCAGCAKGFSRHKYLKDHRC
FT                   RLGSTKDKDLQARRPPRRRATARGGGSIASGHKEENPMPDPLGLEELKAAGPSPEAAPG
FT                   KPPFEQDAVLSIVVGGDPELVVPGHTEGLGSNLALAELQAGTEGGCAMLAVPVYIQASE
FT                   "
FT   assembly_gap    3302078..3302097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3304555..>3306789)
FT                   /locus_tag="mCG_140921"
FT                   /note="gene_id=mCG140921.0"
FT   mRNA            complement(join(3304555..3304701,3306421..>3306789))
FT                   /locus_tag="mCG_140921"
FT                   /product="mCG140921"
FT                   /note="gene_id=mCG140921.0 transcript_id=mCT172118.0
FT                   created on 21-AUG-2002"
FT   CDS             complement(join(3304677..3304701,3306421..>3306776))
FT                   /codon_start=1
FT                   /locus_tag="mCG_140921"
FT                   /product="mCG140921"
FT                   /note="gene_id=mCG140921.0 transcript_id=mCT172118.0
FT                   protein_id=mCP95037.0"
FT                   /protein_id="EDL06091.1"
FT                   /translation="GWVCWDRACIAEIELSSRIQETLDLVPTTIRQLSKASEGMRGESG
FT                   SPSPLTRVFLFLPVGVQSHDLYGHRVSGDCAATSPWRPHLMSLHVLLDVRLLGKGTATR
FT                   NALEGLLPCVAIGTRLMDGQRA"
FT   assembly_gap    3307148..3307178
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   gene            <3331010..3377006
FT                   /gene="Chmp4b"
FT                   /locus_tag="mCG_3685"
FT                   /note="gene_id=mCG3685.1"
FT   mRNA            join(<3331010..3331149,3331345..3331476,3371749..3371926,
FT                   3373441..3373555,3374779..3374905,3376171..3377006)
FT                   /gene="Chmp4b"
FT                   /locus_tag="mCG_3685"
FT                   /product="chromatin modifying protein 4B"
FT                   /note="gene_id=mCG3685.1 transcript_id=mCT2868.1 created on
FT                   21-AUG-2002"
FT   CDS             join(<3331011..3331149,3331345..3331476,3371749..3371926,
FT                   3373441..3373555,3374779..3374905,3376171..3376235)
FT                   /codon_start=1
FT                   /gene="Chmp4b"
FT                   /locus_tag="mCG_3685"
FT                   /product="chromatin modifying protein 4B"
FT                   /note="gene_id=mCG3685.1 transcript_id=mCT2868.1
FT                   protein_id=mCP11584.1"
FT                   /protein_id="EDL06092.1"
FT                   /translation="AAGPSCGAEVEARPAAAGSGRPGVGAGAEPSRAGVGAGGRRGEQQ
FT                   PSTPQEAIQRLRDTEEMLSKKQEFLEKKIEQELTAAKKHGTKNKRAALQALKRKKRYEK
FT                   QLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIA
FT                   DQQELAEEISTAISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPETVPLPNVP
FT                   SVALPSKPAKKKEEEDDDMKELENWAGSM"
FT   assembly_gap    3331150..3331344
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    3335935..3335954
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3339020..3339039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3340900..3340919
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3342359..3342378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3352009..3352028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3382502..3383144
FT                   /estimated_length=643
FT                   /gap_type="unknown"
FT   gene            3386304..3387233
FT                   /pseudo
FT                   /locus_tag="mCG_48857"
FT                   /note="gene_id=mCG48857.2"
FT   mRNA            3386304..3387233
FT                   /pseudo
FT                   /locus_tag="mCG_48857"
FT                   /note="gene_id=mCG48857.2 transcript_id=mCT49040.2 created
FT                   on 21-AUG-2002"
FT   assembly_gap    3387556..3387641
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    3394051..3394413
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   gene            complement(3405109..>3421367)
FT                   /locus_tag="mCG_1027985"
FT                   /note="gene_id=mCG1027985.1"
FT   mRNA            complement(join(3405109..3405324,3416287..3416478,
FT                   3421286..>3421367))
FT                   /locus_tag="mCG_1027985"
FT                   /product="mCG1027985"
FT                   /note="gene_id=mCG1027985.1 transcript_id=mCT145689.1
FT                   created on 21-AUG-2002"
FT   CDS             complement(join(3405181..3405324,3416287..>3416400))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027985"
FT                   /product="mCG1027985"
FT                   /note="gene_id=mCG1027985.1 transcript_id=mCT145689.1
FT                   protein_id=mCP72935.0"
FT                   /protein_id="EDL06093.1"
FT                   /translation="KWLKWVKHLPYVCEDLHLSLQHSSWDVGSGESIPWSRQLSTRMGM
FT                   WRSRDNLERSLTPSMWDPGIKLTSSALDSKCLYFAPEPSH"
FT   assembly_gap    3409563..3409920
FT                   /estimated_length=358
FT                   /gap_type="unknown"
FT   assembly_gap    3411099..3411691
FT                   /estimated_length=593
FT                   /gap_type="unknown"
FT   assembly_gap    3414770..3414789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3421518..3422929
FT                   /locus_tag="mCG_147186"
FT                   /note="gene_id=mCG147186.0"
FT   mRNA            3421518..3422929
FT                   /locus_tag="mCG_147186"
FT                   /product="mCG147186"
FT                   /note="gene_id=mCG147186.0 transcript_id=mCT187449.0
FT                   created on 13-JAN-2004"
FT   CDS             3422113..3422418
FT                   /codon_start=1
FT                   /locus_tag="mCG_147186"
FT                   /product="mCG147186"
FT                   /note="gene_id=mCG147186.0 transcript_id=mCT187449.0
FT                   protein_id=mCP109247.0"
FT                   /protein_id="EDL06094.1"
FT                   /translation="MNKPLMKHLLARETGQMPCSKWCLLGFSWLWFCCCCCFVVFAFCP
FT                   LLCVYVYVVCVSIWVLFLRSHPAYLFETGSRPDVLYQMWCSWAGNLSGYMLAPDWA"
FT   assembly_gap    3425136..3425228
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    3428600..3428619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3449561..3450347
FT                   /estimated_length=787
FT                   /gap_type="unknown"
FT   gene            complement(3451834..3452658)
FT                   /pseudo
FT                   /locus_tag="mCG_50388"
FT                   /note="gene_id=mCG50388.2"
FT   mRNA            complement(3451834..3452658)
FT                   /pseudo
FT                   /locus_tag="mCG_50388"
FT                   /note="gene_id=mCG50388.2 transcript_id=mCT50571.2 created
FT                   on 21-AUG-2002"
FT   assembly_gap    3466442..3466461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3473691..3550572
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /note="gene_id=mCG3684.2"
FT   mRNA            join(3473691..3474146,3503609..3503691,3539920..3540184,
FT                   3542329..3542401,3544491..3544657,3546201..3546314,
FT                   3546465..3546700,3548559..3548607,3549545..3550572)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT2871"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT2871.3 created on
FT                   18-JUN-2003"
FT   mRNA            join(<3473704..3473829,3503609..3503691,3539920..3540184,
FT                   3542329..3542401,3544491..3544657,3546201..3546314,
FT                   3546465..3546700,3548559..3548607,3549545..3550572)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT173581"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT173581.1 created
FT                   on 18-JUN-2003"
FT   mRNA            join(<3473947..3474146,3503609..3503691,3527031..3527083,
FT                   3529900..3531142)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172112"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172112.0 created
FT                   on 18-JUN-2003"
FT   mRNA            join(3473963..3474146,3503609..3503691,3539920..3540184,
FT                   3542329..3542401,3544491..3544655,3546201..3546314,
FT                   3546465..3546700,3548559..3548607,3549545..3550572)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT177788"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT177788.1 created
FT                   on 18-JUN-2003"
FT   mRNA            join(<3473967..3474146,3539920..3540184,3542329..3542401,
FT                   3544491..3544657,3546201..>3546314)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172116"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172116.1 created
FT                   on 18-JUN-2003"
FT   CDS             join(<3473967..3474146,3539920..3540184,3542329..3542401,
FT                   3544491..3544657,3546201..>3546314)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172116.1
FT                   protein_id=mCP95031.1 isoform=CRA_c"
FT                   /protein_id="EDL06097.1"
FT                   /translation="RERRGVRSRGKPRGRKRSRLSRVCSGSSRGGQGRLFPPALREQTR
FT                   RRPSVPRGFLQTSARVNTMSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETI
FT                   FSKYGRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKG
FT                   LKRAATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTT
FT                   GSAKIKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANP"
FT   mRNA            join(3473969..3474146,3503609..3503691,3539920..3540184,
FT                   3542329..3542401,3542562..3542609,3544491..3544657,
FT                   3546201..3546223,3546465..3546700,3548559..3548607,
FT                   3549545..3550572)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172113"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172113.1 created
FT                   on 18-JUN-2003"
FT   mRNA            join(3473969..3474146,3539920..3540059,3542329..3542401,
FT                   3544491..3544657,3546201..>3546281)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172114"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172114.0 created
FT                   on 18-JUN-2003"
FT   mRNA            join(<3474016..3474080,3542349..3542401,3544491..3544657,
FT                   3546201..3546314,3546465..>3546481)
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, transcript
FT                   variant mCT172115"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172115.0 created
FT                   on 18-JUN-2003"
FT   CDS             join(<3474018..3474080,3542349..3542401,3544491..3544657,
FT                   3546201..3546314,3546465..>3546481)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_h"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172115.0
FT                   protein_id=mCP95035.0 isoform=CRA_h"
FT                   /protein_id="EDL06102.1"
FT                   /translation="SRLSRVCSGSSRGGQGRLFPPPKPNRPKGLKRAATAIYRLFDYRG
FT                   RLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAKIKLKSSELQTIK
FT                   TELTQIKSNIDALLGRLEQIAEEQKANPDGKKKG"
FT   CDS             join(<3503650..3503691,3539920..3540184,3542329..3542401,
FT                   3544491..3544657,3546201..3546314,3546465..3546700,
FT                   3548559..3548603)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT173581.1
FT                   protein_id=mCP96500.0 isoform=CRA_d"
FT                   /protein_id="EDL06098.1"
FT                   /translation="LKGQTSWLNSFLVLVNTMSLKIQTSNVTNKNDPKSINSRVFIGNL
FT                   NTAVVKKSDVETIFSKYGRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDI
FT                   NMAGEPKPNRPKGLKRAATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTI
FT                   PVKLFARSTAVTTGSAKIKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANPDG
FT                   KKKGDSSSGGGGGSSGGGGSSNVGGGSSGGSGSCSSSSRLPAPQEDTASEAGTPQGEVQ
FT                   TRDDGDEEGLLTHSEEELEHSQDTDAEDGALQ"
FT   assembly_gap    3528071..3528311
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   CDS             <3530754..3531092
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172112.0
FT                   protein_id=mCP95034.0 isoform=CRA_a"
FT                   /protein_id="EDL06095.1"
FT                   /translation="LLPSTCAHLSEHTSYTHTHTHTIYICTSIKKLGHGLSILSGFLIL
FT                   LVPREPSHKYHSSGICPLLRPLAPEQPFWSLLNLNCLPLYMAYTVDNQDILPLKEHILS
FT                   LPIFLTLR"
FT   CDS             join(3539929..3540184,3542329..3542401,3544491..3544657,
FT                   3546201..3546314,3546465..3546700,3548559..3548603)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT2871.3
FT                   protein_id=mCP11583.2 isoform=CRA_f"
FT                   /db_xref="GOA:Q3U3F6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR017347"
FT                   /db_xref="InterPro:IPR034502"
FT                   /db_xref="MGI:MGI:97850"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U3F6"
FT                   /protein_id="EDL06100.1"
FT                   /translation="MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKY
FT                   GRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRA
FT                   ATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAK
FT                   IKLKSSELQTIKTELTQIKSNIDALLGRLEQIAEEQKANPDGKKKGDSSSGGGGGSSGG
FT                   GGSSNVGGGSSGGSGSCSSSSRLPAPQEDTASEAGTPQGEVQTRDDGDEEGLLTHSEEE
FT                   LEHSQDTDAEDGALQ"
FT   CDS             join(3539929..3540184,3542329..3542401,3542562..3542609,
FT                   3544491..3544657,3546201..3546223,3546465..3546680)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172113.1
FT                   protein_id=mCP95033.0 isoform=CRA_g"
FT                   /protein_id="EDL06101.1"
FT                   /translation="MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKY
FT                   GRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRA
FT                   ATAIYSGYSFDYDYYQDYFCARLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIP
FT                   VKLFARSTAVTTGSAKIKLKSSELQTMARRRVTAAVVEEEAAVVEAAVAMLVVAAAAAA
FT                   GAAAAAAGYQRPKKTRLLRQAHPKEKSKLEMMVMRRDC"
FT   CDS             join(3539929..3540184,3542329..3542401,3544491..3544655,
FT                   3546201..3546213)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT177788.1
FT                   protein_id=mCP100710.0 isoform=CRA_e"
FT                   /protein_id="EDL06099.1"
FT                   /translation="MSLKIQTSNVTNKNDPKSINSRVFIGNLNTAVVKKSDVETIFSKY
FT                   GRVAGCSVHKGYAFVQYANERHARAAVLGENGRVLAGQTLDINMAGEPKPNRPKGLKRA
FT                   ATAIYRLFDYRGRLSPVPVPRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAK
FT                   INKEQ"
FT   CDS             join(3540038..3540059,3542329..3542401,3544491..3544657,
FT                   3546201..>3546281)
FT                   /codon_start=1
FT                   /gene="Raly"
FT                   /locus_tag="mCG_3684"
FT                   /product="hnRNP-associated with lethal yellow, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3684.2 transcript_id=mCT172114.0
FT                   protein_id=mCP95032.0 isoform=CRA_b"
FT                   /protein_id="EDL06096.1"
FT                   /translation="MWRPSFPNINMAGEPKPNRPKGLKRAATAIYRLFDYRGRLSPVPV
FT                   PRAVPVKRPRVTVPLVRRVKTTIPVKLFARSTAVTTGSAKIKLKSSELQTIKTELTQIK
FT                   SNIDALLGRL"
FT   gene            complement(3554778..3575548)
FT                   /gene="Eif2s2"
FT                   /locus_tag="mCG_3686"
FT                   /note="gene_id=mCG3686.4"
FT   mRNA            complement(join(3554778..3555543,3556192..3556277,
FT                   3559223..3559279,3560278..3560426,3561077..3561171,
FT                   3566918..3567053,3570311..3570414,3570790..3570967,
FT                   3575297..3575548))
FT                   /gene="Eif2s2"
FT                   /locus_tag="mCG_3686"
FT                   /product="eukaryotic translation initiation factor 2,
FT                   subunit 2 (beta)"
FT                   /note="gene_id=mCG3686.4 transcript_id=mCT2865.4 created on
FT                   18-JUN-2003"
FT   CDS             complement(join(3555368..3555543,3556192..3556277,
FT                   3559223..3559279,3560278..3560426,3561077..3561171,
FT                   3566918..3567053,3570311..3570414,3570790..3570967,
FT                   3575297..3575311))
FT                   /codon_start=1
FT                   /gene="Eif2s2"
FT                   /locus_tag="mCG_3686"
FT                   /product="eukaryotic translation initiation factor 2,
FT                   subunit 2 (beta)"
FT                   /note="gene_id=mCG3686.4 transcript_id=mCT2865.4
FT                   protein_id=mCP11582.1"
FT                   /db_xref="GOA:Q3ULL5"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="MGI:MGI:1914454"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ULL5"
FT                   /protein_id="EDL06103.1"
FT                   /translation="MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDAQTEETQPSETKEVE
FT                   PEPTEEKDVDADEEDSRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEAIKDVKIE
FT                   SDAQEPAEPEDDLDIMLGNKKKKKKNVKFPEEDEILEKDEALEDEDSKKDDGISFSSQT
FT                   AWAGSERDYTYEELLNRVFNIMREKNPDMVAGEKRKFVMKPPQVVRVGTKKTSFVNFTD
FT                   ICKLLHRQPKHLLAFLLAELGTSGSIDGNNQLVIKGRFQQKQIENVLRRYIKEYVTCHT
FT                   CRSPDTILQKDTRLYFLQCETCHSRCSVASIKTGFQAVTGKRAQLRAKAN"
FT   assembly_gap    3557720..3557739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3579902..3579921
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3588328..3588375
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    3600421..3600440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3601581..3609620
FT                   /estimated_length=8040
FT                   /gap_type="unknown"
FT   assembly_gap    3611282..3611301
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3611961..3611980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3613277..3615947
FT                   /estimated_length=2671
FT                   /gap_type="unknown"
FT   gene            <3631591..3732610
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /note="gene_id=mCG21069.2"
FT   mRNA            join(<3631591..3631705,3632947..3632985,3727204..3727373,
FT                   3729268..>3729319)
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, transcript variant mCT172101"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT172101.0 created
FT                   on 21-AUG-2002"
FT   CDS             join(<3631593..3631705,3632947..3632985,3727204..3727373,
FT                   3729268..>3729319)
FT                   /codon_start=1
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, isoform CRA_a"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT172101.0
FT                   protein_id=mCP95021.0 isoform=CRA_a"
FT                   /protein_id="EDL06104.1"
FT                   /translation="RNWHQSTISHQSESLSPCSLRRGSHQLKPPGTTGDPRRERFLMNP
FT                   GTCPVLLLRMDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSLDFSSV
FT                   SIVALNKKSKKISRKEAEKR"
FT   assembly_gap    3639444..3639809
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    3652174..3652353
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    3682150..3682169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(3695219..3695329,3727204..3727373,3729268..3729332,
FT                   3732220..3732610)
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, transcript variant mCT20233"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT20233.2 created
FT                   on 21-AUG-2002"
FT   mRNA            join(3695263..3695326,3727204..3727373,3729268..3729332,
FT                   3732220..3732580)
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, transcript variant mCT172102"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT172102.0 created
FT                   on 21-AUG-2002"
FT   CDS             join(3727214..3727373,3729268..3729332,3732220..3732390)
FT                   /codon_start=1
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, isoform CRA_b"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT172102.0
FT                   protein_id=mCP95020.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q03288"
FT                   /db_xref="InterPro:IPR007733"
FT                   /db_xref="InterPro:IPR027300"
FT                   /db_xref="MGI:MGI:87853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03288"
FT                   /protein_id="EDL06105.1"
FT                   /translation="MDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSL
FT                   DFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAP
FT                   ACCDPCASCQCRFFGSACTCRVLNPNC"
FT   CDS             join(3727214..3727373,3729268..3729332,3732220..3732390)
FT                   /codon_start=1
FT                   /gene="a"
FT                   /locus_tag="mCG_21069"
FT                   /product="nonagouti, isoform CRA_b"
FT                   /note="gene_id=mCG21069.2 transcript_id=mCT20233.2
FT                   protein_id=mCP23001.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q03288"
FT                   /db_xref="InterPro:IPR007733"
FT                   /db_xref="InterPro:IPR027300"
FT                   /db_xref="MGI:MGI:87853"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03288"
FT                   /protein_id="EDL06106.1"
FT                   /translation="MDVTRLLLATLVGFLCFFTVHSHLALEETLGDDRSLRSNSSMNSL
FT                   DFSSVSIVALNKKSKKISRKEAEKRKRSSKKKASMKKVARPPPPSPCVATRDSCKPPAP
FT                   ACCDPCASCQCRFFGSACTCRVLNPNC"
FT   gene            complement(3740900..3756049)
FT                   /locus_tag="mCG_21063"
FT                   /note="gene_id=mCG21063.2"
FT   mRNA            complement(join(3740900..3741902,3741955..3742172,
FT                   3743741..3743935,3745372..3745489,3745581..3745668,
FT                   3745746..3745953,3746406..3746518,3747129..3747278,
FT                   3748915..3748990,3750420..3750610,3755958..3755990))
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, transcript variant mCT20227"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT20227.2 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(3741316..3741482,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..3756049))
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, transcript variant mCT172095"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT172095.0 created
FT                   on 21-AUG-2002"
FT   mRNA            complement(join(3741324..3742172,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..>3756020))
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, transcript variant mCT189893"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT189893.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(3741435..3741482,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..3755985))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, isoform CRA_a"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT172095.0
FT                   protein_id=mCP95014.0 isoform=CRA_a"
FT                   /protein_id="EDL06107.1"
FT                   /translation="MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPL
FT                   KGARIAGCLHMTVETAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKG
FT                   ETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNLIHTKYPQLLSGIRGISEETTTGVHN
FT                   LYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYG
FT                   DVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCVDI
FT                   ILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYWLKNGRRIILLA
FT                   EGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKGLEKQRGKGL
FT                   SLLYS"
FT   CDS             complement(join(3742041..3742172,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..>3756018))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, isoform CRA_b"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT189893.0
FT                   protein_id=mCP110881.0 isoform=CRA_b"
FT                   /protein_id="EDL06108.1"
FT                   /translation="EFISPSGSAASMSDKLPYKVADIGLAAWGRKALDIAENEMPGLMR
FT                   MREMYSASKPLKGARIAGCLHMTVETAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIA
FT                   KAGIPVFAWKGETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNLIHTKYPQLLSGIRG
FT                   ISEETTTGVHNLYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMI
FT                   AGKVAVVAGYGDVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKEGN
FT                   IFVTTTGCVDIILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYW
FT                   LKNGRRIILLAEGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPK
FT                   KLDEAVAEAHLGKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY"
FT   CDS             complement(join(3742041..3742172,3743741..3743935,
FT                   3745372..3745489,3745581..3745668,3745746..3745953,
FT                   3746406..3746518,3747129..3747278,3748915..3748990,
FT                   3750420..3750610,3755958..3755985))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21063"
FT                   /product="mCG21063, isoform CRA_c"
FT                   /note="gene_id=mCG21063.2 transcript_id=mCT20227.2
FT                   protein_id=mCP22986.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TF14"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR034373"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TF14"
FT                   /protein_id="EDL06109.1"
FT                   /translation="MSDKLPYKVADIGLAAWGRKALDIAENEMPGLMRMREMYSASKPL
FT                   KGARIAGCLHMTVETAVLIETLVALGAEVRWSSCNIFSTQDHAAAAIAKAGIPVFAWKG
FT                   ETDEEYLWCIEQTLHFKDGPLNMILDDGGDLTNLIHTKYPQLLSGIRGISEETTTGVHN
FT                   LYKMMSNGILKVPAINVNDSVTKSKFDNLYGCRESLIDGIKRATDVMIAGKVAVVAGYG
FT                   DVGKGCAQALRGFGARVIITEIDPINALQAAMEGYEVTTMDEACKEGNIFVTTTGCVDI
FT                   ILGRHFEQMKDDAIVCNIGHFDVEIDVKWLNENAVEKVNIKPQVDRYWLKNGRRIILLA
FT                   EGRLVNLGCAMGHPSFVMSNSFTNQVMAQIELWTHPDKYPVGVHFLPKKLDEAVAEAHL
FT                   GKLNVKLTKLTEKQAQYLGMPINGPFKPDHYRY"
FT   assembly_gap    3768272..3768291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3781868..>3784226)
FT                   /locus_tag="mCG_1027988"
FT                   /note="gene_id=mCG1027988.0"
FT   mRNA            complement(join(3781868..3783086,3783190..3783314,
FT                   3784107..>3784226))
FT                   /locus_tag="mCG_1027988"
FT                   /product="mCG1027988"
FT                   /note="gene_id=mCG1027988.0 transcript_id=mCT145692.0
FT                   created on 21-AUG-2002"
FT   CDS             complement(3782597..>3782878)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027988"
FT                   /product="mCG1027988"
FT                   /note="gene_id=mCG1027988.0 transcript_id=mCT145692.0
FT                   protein_id=mCP72956.0"
FT                   /protein_id="EDL06110.1"
FT                   /translation="CSLSRITQPVGVRVCGEKVKFLFWSLFQSLLQSNLLVPAHHTLCR
FT                   VWFVCIGATSACSLPTPSKEVMFCNSLFLLSPKLRIFTIWVLVDLMVD"
FT   assembly_gap    3788313..3788332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3798858..3799012
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    3801492..3801511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3806353..3808631
FT                   /estimated_length=2279
FT                   /gap_type="unknown"
FT   assembly_gap    3810190..3810209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3811338..3812486
FT                   /estimated_length=1149
FT                   /gap_type="unknown"
FT   gene            3813580..3913766
FT                   /locus_tag="mCG_119620"
FT                   /note="gene_id=mCG119620.1"
FT   mRNA            join(3813580..3813616,3821560..3821636,3846774..3846864,
FT                   3852065..3852206,3855838..3855962,3857315..3857452,
FT                   3864620..3864665,3866136..3866293,3867756..3867951,
FT                   3869333..3869428,3871028..3871202,3875941..3876010,
FT                   3878630..3878714,3885839..3885967,3888711..3888783,
FT                   3889785..3889856,3892797..3892885,3895563..3895722,
FT                   3896487..3896620,3896940..3897080,3898837..3898957,
FT                   3899498..3899602,3904793..3904889,3907007..3907079,
FT                   3911285..3913766)
FT                   /locus_tag="mCG_119620"
FT                   /product="mCG119620, transcript variant mCT120795"
FT                   /note="gene_id=mCG119620.1 transcript_id=mCT120795.1
FT                   created on 22-AUG-2002"
FT   mRNA            join(3816899..3816949,3821560..3821636,3846774..3846864,
FT                   3852065..3852206,3855838..3855962,3857315..3857452,
FT                   3864620..3864665,3866136..3866293,3867756..3867951,
FT                   3869333..3869428,3871028..3871202,3875941..3876010,
FT                   3878630..3878714,3885839..3885967,3888711..3888783,
FT                   3889785..3889856,3892797..3892885,3895563..3895722,
FT                   3896487..3896620,3896940..3897080,3898837..3898957,
FT                   3899498..3899602,3904793..3904889,3907007..3907079,
FT                   3911285..3913764)
FT                   /locus_tag="mCG_119620"
FT                   /product="mCG119620, transcript variant mCT172093"
FT                   /note="gene_id=mCG119620.1 transcript_id=mCT172093.0
FT                   created on 22-AUG-2002"
FT   assembly_gap    3825441..3825509
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3840857..3840883
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   CDS             join(3846795..3846864,3852065..3852206,3855838..3855962,
FT                   3857315..3857452,3864620..3864665,3866136..3866293,
FT                   3867756..3867951,3869333..3869428,3871028..3871202,
FT                   3875941..3876010,3878630..3878714,3885839..3885967,
FT                   3888711..3888783,3889785..3889856,3892797..3892885,
FT                   3895563..3895722,3896487..3896620,3896940..3897080,
FT                   3898837..3898957,3899498..3899602,3904793..3904889,
FT                   3907007..3907079,3911285..3911384)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119620"
FT                   /product="mCG119620, isoform CRA_b"
FT                   /note="gene_id=mCG119620.1 transcript_id=mCT172093.0
FT                   protein_id=mCP95012.0 isoform=CRA_b"
FT                   /protein_id="EDL06112.1"
FT                   /translation="MSDSGPQLDSMGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEV
FT                   TVDGQSKKTEKCNNTNSPKWKQPLTVIVTPTSKLCFRVWSHQTLKSDVLLGTAGLDIYE
FT                   TLKSNNMKLEEVVMTLQLVGDKEPTETMGDLSVCLDGLQVEAEVVTNGETSCSESTTQN
FT                   DDGCRTRDDTRVSTNGSEDPEVAASGENKRANGNNSPSLSNGGFKPSRPPRPSRPPPPT
FT                   PRRPASVNGSPSTNSDSDGSSTGSLPPTNTNVNTSTSEGATSGLIIPLTISGGSGPRPL
FT                   NTVSQAPLPPGWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDH
FT                   FTRTTTWQRPTLESVRNYEQWQLQRSQLQGAMQQFNQRFIYGNQDLFATSQNKEFDPLG
FT                   PLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFV
FT                   DHNRRATTYIDPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKT
FT                   LFEDSFQQIMSFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYA
FT                   GKDNYCLQINPASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGL
FT                   KDLESIDPEFYNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEEN
FT                   KEEYIRMVAEWRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLND
FT                   WQRHAIYRHYTRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGP
FT                   QKFCIEKVGKENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE"
FT   CDS             join(3846825..3846864,3852065..3852206,3855838..3855962,
FT                   3857315..3857452,3864620..3864665,3866136..3866293,
FT                   3867756..3867951,3869333..3869428,3871028..3871202,
FT                   3875941..3876010,3878630..3878714,3885839..3885967,
FT                   3888711..3888783,3889785..3889856,3892797..3892885,
FT                   3895563..3895722,3896487..3896620,3896940..3897080,
FT                   3898837..3898957,3899498..3899602,3904793..3904889,
FT                   3907007..3907079,3911285..3911384)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119620"
FT                   /product="mCG119620, isoform CRA_a"
FT                   /note="gene_id=mCG119620.1 transcript_id=mCT120795.1
FT                   protein_id=mCP72787.1 isoform=CRA_a"
FT                   /protein_id="EDL06111.1"
FT                   /translation="MGSLTMKSQLQITVISAKLKENKKNWFGPSPYVEVTVDGQSKKTE
FT                   KCNNTNSPKWKQPLTVIVTPTSKLCFRVWSHQTLKSDVLLGTAGLDIYETLKSNNMKLE
FT                   EVVMTLQLVGDKEPTETMGDLSVCLDGLQVEAEVVTNGETSCSESTTQNDDGCRTRDDT
FT                   RVSTNGSEDPEVAASGENKRANGNNSPSLSNGGFKPSRPPRPSRPPPPTPRRPASVNGS
FT                   PSTNSDSDGSSTGSLPPTNTNVNTSTSEGATSGLIIPLTISGGSGPRPLNTVSQAPLPP
FT                   GWEQRVDQHGRVYYVDHVEKRTTWDRPEPLPPGWERRVDNMGRIYYVDHFTRTTTWQRP
FT                   TLESVRNYEQWQLQRSQLQGAMQQFNQRFIYGNQDLFATSQNKEFDPLGPLPPGWEKRT
FT                   DSNGRVYFVNHNTRITQWEDPRSQGQLNEKPLPEGWEMRFTVDGIPYFVDHNRRATTYI
FT                   DPRTGKSALDNGPQIAYVRDFKAKVQYFRFWCQQLAMPQHIKITVTRKTLFEDSFQQIM
FT                   SFSPQDLRRRLWVIFPGEEGLDYGGVAREWFFLLSHEVLNPMYCLFEYAGKDNYCLQIN
FT                   PASYINPDHLKYFRFIGRFIAMALFHGKFIDTGFSLPFYKRILNKPVGLKDLESIDPEF
FT                   YNSLIWVKENNIEECGLEMYFSVDKEILGEIKSHDLKPNGGNILVTEENKEEYIRMVAE
FT                   WRLSRGVEEQTQAFFEGFNEILPQQYLQYFDAKELEVLLCGMQEIDLNDWQRHAIYRHY
FT                   TRTSKQIMWFWQFVKEIDNEKRMRLLQFVTGTCRLPVGGFADLMGSNGPQKFCIEKVGK
FT                   ENWLPRSHTCFNRLDLPPYKSYEQLKEKLLFAIEETEGFGQE"
FT   assembly_gap    3861118..3861137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3863057..3863076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3871953..3872999
FT                   /estimated_length=1047
FT                   /gap_type="unknown"
FT   gene            complement(3885120..3885780)
FT                   /pseudo
FT                   /locus_tag="mCG_21071"
FT                   /note="gene_id=mCG21071.0"
FT   mRNA            complement(3885120..3885780)
FT                   /pseudo
FT                   /locus_tag="mCG_21071"
FT                   /note="gene_id=mCG21071.0 transcript_id=mCT20234.0 created
FT                   on 22-AUG-2002"
FT   assembly_gap    3907800..3908006
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   gene            <3923428..3937321
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /note="gene_id=mCG21072.1"
FT   mRNA            join(<3923428..3923532,3929798..3929873,3934815..3934982,
FT                   3936965..3937321)
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, transcript
FT                   variant mCT20235"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT20235.2 created
FT                   on 22-AUG-2002"
FT   CDS             join(<3923428..3923532,3929798..3929873,3934815..3934982,
FT                   3936965..3937008)
FT                   /codon_start=1
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT20235.2
FT                   protein_id=mCP23008.2 isoform=CRA_c"
FT                   /protein_id="EDL06115.1"
FT                   /translation="AARSVRLHKGLCAGSEGRGTRLSVGDSELQDPSEMAEVEETLKRL
FT                   QSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLR
FT                   IRSKKNEIMVAPDKDYFLIVIQNPTE"
FT   mRNA            join(<3923723..3923851,3929798..3929873,3934815..3934982,
FT                   3936965..3937276)
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, transcript
FT                   variant mCT172104"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT172104.0 created
FT                   on 22-AUG-2002"
FT   mRNA            join(<3923767..3923855,3929798..3929873,3934815..3934982,
FT                   3936965..3937124)
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, transcript
FT                   variant mCT172105"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT172105.0 created
FT                   on 22-AUG-2002"
FT   CDS             join(<3923813..3923851,3929798..3929873,3934815..3934982,
FT                   3936965..3937008)
FT                   /codon_start=1
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT172104.0
FT                   protein_id=mCP95024.0 isoform=CRA_a"
FT                   /protein_id="EDL06113.1"
FT                   /translation="ALTCMAFPPPLWEAEVEETLKRLQSQKGVQGIIVVNTEGIPIKST
FT                   MDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQ
FT                   NPTE"
FT   assembly_gap    3928951..3929254
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   CDS             join(<3929798..3929873,3934815..3934982,3936965..3937008)
FT                   /codon_start=1
FT                   /gene="Dynlrb1"
FT                   /locus_tag="mCG_21072"
FT                   /product="dynein light chain roadblock-type 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21072.1 transcript_id=mCT172105.0
FT                   protein_id=mCP95023.0 isoform=CRA_b"
FT                   /protein_id="EDL06114.1"
FT                   /translation="AEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYANLM
FT                   HNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTE"
FT   assembly_gap    3945128..3945346
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    3948214..3948445
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    3956374..3956639
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   gene            <3963571..3965297
FT                   /gene="Map1lc3a"
FT                   /locus_tag="mCG_21085"
FT                   /note="gene_id=mCG21085.2"
FT   mRNA            join(<3963571..3963872,3964184..3964239,3964324..3964430,
FT                   3964701..3965297)
FT                   /gene="Map1lc3a"
FT                   /locus_tag="mCG_21085"
FT                   /product="microtubule-associated protein 1 light chain 3
FT                   alpha"
FT                   /note="gene_id=mCG21085.2 transcript_id=mCT20249.2 created
FT                   on 22-AUG-2002"
FT   CDS             <3964812..3965276
FT                   /codon_start=1
FT                   /gene="Map1lc3a"
FT                   /locus_tag="mCG_21085"
FT                   /product="microtubule-associated protein 1 light chain 3
FT                   alpha"
FT                   /note="gene_id=mCG21085.2 transcript_id=mCT20249.2
FT                   protein_id=mCP22968.2"
FT                   /protein_id="EDL06116.1"
FT                   /translation="RRIPLHGLRLPRNLRLLSQEEGRGVAGSSGQVLPREVLAPKLSYF
FT                   SPQWIRQRCDTHSPPQVGATSQPTTSWVGPGPVMFGLLFWVLAGLGVGGEQHPCSVGFV
FT                   ILLGPCLSAHLAPHPPEALPPARTCPTPERLAPLVLTRCMDLWSFPLQKE"
FT   gene            complement(3965471..>4044620)
FT                   /gene="Cdc91l1"
FT                   /locus_tag="mCG_140914"
FT                   /note="gene_id=mCG140914.0"
FT   mRNA            complement(join(3965471..3965875,3979892..3980034,
FT                   3984285..3984409,3986248..3986391,3988403..3988557,
FT                   4001682..4001779,4015840..4015940,4018408..4018517,
FT                   4022606..4022668,4023927..4023986,4032850..4032914,
FT                   4044462..>4044620))
FT                   /gene="Cdc91l1"
FT                   /locus_tag="mCG_140914"
FT                   /product="CDC91 cell division cycle 91-like 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG140914.0 transcript_id=mCT172094.0
FT                   created on 22-AUG-2002"
FT   CDS             complement(join(3965762..3965875,3979892..3980034,
FT                   3984285..3984409,3986248..3986391,3988403..3988557,
FT                   4001682..4001779,4015840..4015940,4018408..4018517,
FT                   4022606..4022668,4023927..4023986,4032850..4032914,
FT                   4044462..>4044618))
FT                   /codon_start=1
FT                   /gene="Cdc91l1"
FT                   /locus_tag="mCG_140914"
FT                   /product="CDC91 cell division cycle 91-like 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG140914.0 transcript_id=mCT172094.0
FT                   protein_id=mCP95013.0"
FT                   /protein_id="EDL06117.1"
FT                   /translation="IACAPASVIMAAPLALVLVVAVTVRAALFRSSLAEFISERVEVVS
FT                   PLSSWKRVVEGLALLDLGVSPYSGAVFHETPLIIYLFHFLIDYAELVFMITDALTAIAL
FT                   YFAIQDFNKVVFKKQKLLLELDQYAPDVAELIRTPMEMRYIPLKVALFYLLNPYTILSC
FT                   VAKSTCAINNTLIAFFILTTIKGSVFLSAVFLALATYQSLYPVTLFAPGLLYLLQRQYI
FT                   PVKVKSKAFWIFSWEYAMMYTGSLVVIVCLSFFLLSSWDFIPAVYGFILSVPDLTPNIG
FT                   LFWYFFAEMFEHFSLFFVCVFQINVFFYTVPLAIKLKEHPIFFMFIQIAIISIFKSYPT
FT                   VGDVALYMAFFPVWNHLYRFLRNIFVLTCIIIVCSLLFPVLWHLWIYAGSANSNFFYAI
FT                   TLTFNVGQILLISDYFYAFLRREYYLTHGLYLTAKDGTEAMLVLK"
FT   gene            4004721..4005110
FT                   /pseudo
FT                   /locus_tag="mCG_140920"
FT                   /note="gene_id=mCG140920.0"
FT   mRNA            4004721..4005110
FT                   /pseudo
FT                   /locus_tag="mCG_140920"
FT                   /note="gene_id=mCG140920.0 transcript_id=mCT172111.0
FT                   created on 22-AUG-2002"
FT   assembly_gap    4012407..4012530
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    4038888..4038907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4048372..4049060
FT                   /estimated_length=689
FT                   /gap_type="unknown"
FT   assembly_gap    4058344..4058859
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   assembly_gap    4068586..4068605
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4069036..4077035
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /note="gene_id=mCG21070.1"
FT   mRNA            join(<4069036..4069213,4072484..4072658,4073075..4073363,
FT                   4073734..4077035)
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /product="tumor protein p53 inducible nuclear protein 2,
FT                   transcript variant mCT20236"
FT                   /note="gene_id=mCG21070.1 transcript_id=mCT20236.2 created
FT                   on 22-AUG-2002"
FT   mRNA            join(<4069039..4069213,4072484..4072658,4073195..>4073335)
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /product="tumor protein p53 inducible nuclear protein 2,
FT                   transcript variant mCT172103"
FT                   /note="gene_id=mCG21070.1 transcript_id=mCT172103.0 created
FT                   on 22-AUG-2002"
FT   CDS             join(<4072502..4072658,4073075..4073363,4073734..4073986)
FT                   /codon_start=1
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /product="tumor protein p53 inducible nuclear protein 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21070.1 transcript_id=mCT20236.2
FT                   protein_id=mCP22952.1 isoform=CRA_b"
FT                   /protein_id="EDL06119.1"
FT                   /translation="GAPLRLLHPLTMFQRFTSLFFNTPAPPEDSNCPGAFVSEEDEVDG
FT                   WLIIDLQDSYTAPPDPGASPAPAGRPPPAPSLMDESWFVTPPACFTAEGPGLGPARLQS
FT                   NPLEDLLIEHPSMSVYVTGSTIVLESGPPSPHPEAALPDQDLSDGELAPALREPRALHH
FT                   AAAPMPARAVLLEKAGQVRRLQRARQRAERHTLSAKVLQRQNRARESRSRRPKHQGSFI
FT                   YQPCQRQFNY"
FT   CDS             join(<4072502..4072658,4073195..>4073335)
FT                   /codon_start=1
FT                   /gene="Trp53inp2"
FT                   /locus_tag="mCG_21070"
FT                   /product="tumor protein p53 inducible nuclear protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21070.1 transcript_id=mCT172103.0
FT                   protein_id=mCP95022.0 isoform=CRA_a"
FT                   /protein_id="EDL06118.1"
FT                   /translation="GAPLRLLHPLTMFQRFTSLFFNTPAPPEDSNCPGAFVSEEDEVDG
FT                   WLIIDLQEGPGLGPARLQSNPLEDLLIEHPSMSVYVTGSTIVLESGPPSPHPEA"
FT   gene            complement(4074858..>4077033)
FT                   /locus_tag="mCG_140918"
FT                   /note="gene_id=mCG140918.0"
FT   mRNA            complement(join(4074858..4075165,4076231..>4077033))
FT                   /locus_tag="mCG_140918"
FT                   /product="mCG140918"
FT                   /note="gene_id=mCG140918.0 transcript_id=mCT172108.0
FT                   created on 22-AUG-2002"
FT   CDS             complement(4076557..>4076784)
FT                   /codon_start=1
FT                   /locus_tag="mCG_140918"
FT                   /product="mCG140918"
FT                   /note="gene_id=mCG140918.0 transcript_id=mCT172108.0
FT                   protein_id=mCP95027.0"
FT                   /protein_id="EDL06120.1"
FT                   /translation="GKKVLEAGCGLSAFSPLTQSHPGALVGSLLHLRRYRSQQVDQRVP
FT                   GWGAGTLQNSTKPHSHTRCPAGARLAKVRK"
FT   gene            complement(4077851..4136464)
FT                   /gene="Ncoa6"
FT                   /locus_tag="mCG_21081"
FT                   /note="gene_id=mCG21081.2"
FT   mRNA            complement(join(4077851..4078414,4082914..4083065,
FT                   4086712..4086748,4089797..4089865,4092600..4095575,
FT                   4098650..4098771,4101937..4103053,4106003..4106149,
FT                   4108092..4108994,4109936..4110064,4119925..4120047,
FT                   4121042..4121197,4124969..4125248,4127797..4127894,
FT                   4136392..4136464))
FT                   /gene="Ncoa6"
FT                   /locus_tag="mCG_21081"
FT                   /product="nuclear receptor coactivator 6"
FT                   /note="gene_id=mCG21081.2 transcript_id=mCT20241.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(4078371..4078414,4082914..4083065,
FT                   4086712..4086748,4089797..4089865,4092600..4095575,
FT                   4098650..4098771,4101937..4103053,4106003..4106149,
FT                   4108092..4108994,4109936..4110064,4119925..4120047,
FT                   4121042..4121197,4124969..4125203))
FT                   /codon_start=1
FT                   /gene="Ncoa6"
FT                   /locus_tag="mCG_21081"
FT                   /product="nuclear receptor coactivator 6"
FT                   /note="gene_id=mCG21081.2 transcript_id=mCT20241.2
FT                   protein_id=mCP23026.2"
FT                   /db_xref="GOA:Q5XJV5"
FT                   /db_xref="InterPro:IPR026638"
FT                   /db_xref="InterPro:IPR032715"
FT                   /db_xref="MGI:MGI:1929915"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XJV5"
FT                   /protein_id="EDL06121.1"
FT                   /translation="MVLDDLPNFEDIYTSLCSSTMGDSEVEFDSGLEDDDTKSDSILED
FT                   STIFVAFKGNIDDKDFKWKLDAILKNVPNLLHMESSKLKVQKVEPWNSVRVTFNIPREA
FT                   AERLRILAQSNNQQLRDLGILSVQIEGEGAINLALGQNRSQDVRMNGPVASGNSVRMEA
FT                   GFPMASGPGLIRMTSPAAVMTPQGGNMSSSMMAPGPNPELQPRTPRPASQSDAMDPLLS
FT                   GLHIQQQSHPSGSLPPAHHSMQPVPVNRQMNPANFPQLQQQQQQQQQQQQQQQQQQQQQ
FT                   QQQQQQQQQQQLQTRPLQQHQQQPQGIRPQFTAPTQVPVPPGWNQLPSGALQPPPAQGS
FT                   LGTMTTNQGWKKAPLPSPMQAQLQARPSLATVQTPSHPPPPYPFGSQQASQAHTNFPQM
FT                   SNPGQFTAPQMKGLQGGPSRVPTPLQQPHLTNKSPASSPSSFQQGSPASSPTVNQTQQQ
FT                   MGPRPPQNNPLSQGFQQPVSSPGRNPMVQQGNVPPNFMVMQQQPPNQGPQSLHPGLGGM
FT                   PKRLPPGFSAGQANPNFMQGQVPSTTAATPGNSGALQLQANQNVQHAGGQGAGPPQNQM
FT                   QVSHGPPNMMQPSLMGIHGNINNQQAGSSGVPQVTLGNMQGQPQQGPPSQLMGMHQQIV
FT                   PSQGQMAQQQGTLNPQNPMILSRAQLMPQGQMMVNAQNQNLGPSPQRMTPPKQMLPQQG
FT                   PQMMAPHNQMMGPQGQVLLQQNPMIEQIMTNQMQGNKAQFNSQNQSNVMPGPAQIMRGP
FT                   TPNMQGNMVQFTGQMSGQMLPQQGPVNNSPSQVMGIQGQVLRPPGPSPHMAQQHNDPVT
FT                   TANNDVNLSQMMPDVSMQQASMVPPHVQSMQGNSASGSHFSGHGVSFNAPFGGAPNGSQ
FT                   MSCGQNPGFPVNKDVTLTSPLLVNLLQSDISAGHFGVNNKQNNTNANKPKKKKPPRKKK
FT                   NCHQDLNTPDNRPTGLEEVDQQSLPGEQGINLDTTGPKLPDFSNRPPGYPTQPVEQRPL
FT                   PQMPPQLMQHVAPPPQPPQQQPQPQLPQQQQPPPPSQPQSQQQQQQQQMMMMLMMQQDP
FT                   KSIRLPVSQNVHPPRGPLNPDSQRMPVQQSGNVPVMVGLQGPASVPPSPDKQRMPMSVN
FT                   TPMGSNSRKMVYQENPQNSSSSPLGEMSSLPEASGSEVPSVAGGPNNMPSHLVVSQNQL
FT                   MMTGPKPGPSPLSATQGATPQQPPVNSLPSSHGHHFPNVAAPTQTSRPKTPNRASPRPY
FT                   YPQTPNNRPPSTEPSEISLSPERLNASIAGLFPPQINIPLPPRPNLNRGFDQQGLNPTT
FT                   LKAIGQAPSNLTITNPPNFAAPQAHKLDSVVVNSGKQSNPGTTKRASPSNSRRSSPGSS
FT                   RKTTPSPGRQNSKAPKLTLASQTSTTMLQNMELPRNVLVGPTPLANPPLPGSFPNNTGL
FT                   NPQNPTVPVPAMGTVLEDNKESVNIPQDSDCQNAQGRKEQVNTELKVVPTQEAKMAVPE
FT                   DQSKKDGQPLDPNKLPSVEENKNLMSPAMREAPTSLSQLLDNSGAPNVTIKPPGLTDLE
FT                   VTPPVVSGEDLRKASVIPTLQDPPSKEPSTSLSSPHSSEPCSTLARSELSEVSSNTAPS
FT                   IPPVMSRPVSSSSISTPLPPNQITVFVTSNPITTSSNTSAALPTHLQSALMSTVVTMPN
FT                   VGNKVMVSEGQSAAQSNARPQFITPVFINSSSIIQVMKGSQPSTIPATPLTTNSGLMPP
FT                   SVAVVGPLHIPQNIKFSSAPVTPNV