Dbfetch

ID   CH466550; SV 2; linear; genomic DNA; CON; MUS; 24809537 BP.
XX
AC   CH466550;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
XX
DE   Mus musculus 232000009743879 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-24809537
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-24809537
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-24809537
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 53fde76759ce2e3fda3a2afacf022f39.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000223.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000530; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000000552; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001076; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001280; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001656; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001661; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003352; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003360; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006369; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015365; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015377; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000016664; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018126; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022383; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022385; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022387; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022394; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022401; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022407; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022408; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022412; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022415; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022420; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022429; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022431; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022432; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022435; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022445; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022474; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022479; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022617; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022620; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022993; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000022997; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023000; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023007; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023013; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023022; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023025; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023030; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023031; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023034; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023045; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023046; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023051; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000023484; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032783; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032987; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032988; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033029; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033055; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033237; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035757; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035828; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000035845; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036167; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036561; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000036606; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037579; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041736; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042351; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042406; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042524; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042622; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042632; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044216; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047295; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047878; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048175; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048218; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051786; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051793; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051853; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052560; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000053137; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054117; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054619; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055065; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055782; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056184; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058586; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058794; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059213; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060284; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060992; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061527; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061740; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062906; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063260; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063971; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064232; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067594; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000067614; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068083; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068086; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078907; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079641; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000096852; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000097050; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000099083; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000099353; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022062; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022069; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022070; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022071; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022072; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022075; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022077; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022078; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022085; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022093; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022096; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022097; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022101; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022102; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022104; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022116; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022127; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022146; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022154; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022161; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022163; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022167; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022184; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022186; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022188; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022189; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022190; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022198; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022205; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022206; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022210; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022217; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022220; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022221; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022222; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022223; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022237; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022238; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022242; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022244; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022246; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022256; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022268; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022274; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022281; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022286; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022293; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022294; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022295; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022297; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022302; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022304; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022305; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022309; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022311; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022312; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022316; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022320; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022321; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022322; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022325; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022327; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022328; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022334; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022344; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022346; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022350; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022359; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022365; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022368; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022372; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022373; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022375; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022381; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022383; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022390; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022400; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022401; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022411; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022412; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022418; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022426; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022436; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022437; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022439; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0035630; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022023; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022030; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022031; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022032; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022033; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022036; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022038; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022039; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022046; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022054; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022057; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022058; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022062; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022063; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022065; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022077; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022088; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022106; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022109; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022112; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022113; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022120; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022122; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022126; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022143; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022145; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022147; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022148; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022149; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022157; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022164; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022165; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022169; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022176; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022179; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022180; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022181; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022182; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022196; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022197; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022201; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022203; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022205; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022215; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022227; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022233; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022240; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022245; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022251; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022252; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022253; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022254; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022256; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022260; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022262; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022263; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022267; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022269; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022270; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022274; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022278; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022279; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022280; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022283; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022285; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022286; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022292; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022302; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022304; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022312; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022321; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022327; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022330; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022334; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022335; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022337; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022343; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022346; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022353; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022362; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022363; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022373; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022374; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022380; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022388; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022398; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022399; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0022401; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0021998; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022005; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022006; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022007; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022008; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022011; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022013; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022014; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022021; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022029; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022032; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022033; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022037; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022038; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022040; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022052; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022063; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022082; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022083; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022087; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022088; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022095; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022097; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022101; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022118; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022120; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022122; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022123; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022124; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022132; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022139; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022140; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022144; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022151; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022154; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022156; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022157; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022171; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022172; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022176; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022178; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022180; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022190; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022202; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022208; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022215; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022220; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022226; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022227; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022228; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022230; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022235; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022237; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022238; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022242; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022244; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022245; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022249; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022254; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022255; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022256; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022259; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022261; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022262; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022268; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022278; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022280; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022288; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022297; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022303; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022306; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022310; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022311; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022313; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022328; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022337; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022338; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022348; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022349; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022355; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022363; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022373; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022374; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0022376; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0035540; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022029; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022036; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022037; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022038; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022039; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022042; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022044; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022045; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022052; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022059; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022060; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022063; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022064; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022068; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022069; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022071; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022083; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022094; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022112; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022118; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022119; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022126; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022128; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022132; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022149; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022151; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022153; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022154; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022155; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022163; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022170; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022171; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022175; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022182; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022185; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022186; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022187; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022188; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022202; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022203; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022207; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022209; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022211; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022221; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022233; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022239; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022246; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022251; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022257; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022258; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022259; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022260; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022262; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022267; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022269; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022270; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022274; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022276; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022277; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022281; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022284; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022285; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022286; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022289; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022291; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022292; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022298; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022308; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022310; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022316; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022325; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022331; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022334; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022338; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022339; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022341; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022347; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022349; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022356; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022366; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022367; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022377; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022378; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022384; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022392; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022402; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022403; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022405; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0035600; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021800; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021807; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021808; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021809; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021810; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021813; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021815; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021816; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021823; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021831; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021834; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021835; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021839; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021840; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021842; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021849; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021854; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021865; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021883; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021889; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021896; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021898; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021902; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021919; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021921; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021923; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021924; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021925; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021933; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021940; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021941; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021945; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021952; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021955; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021956; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021957; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021958; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021972; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021973; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021977; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021979; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021981; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0021991; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022003; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022009; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022016; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022021; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022027; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022028; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022029; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022031; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022035; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022037; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022038; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022042; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022044; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022045; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022049; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022052; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022053; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022054; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022057; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022059; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022060; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022066; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022076; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022078; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022086; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022095; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022101; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022104; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022108; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022116; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022122; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022133; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022134; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022144; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022145; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022151; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022159; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022169; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022170; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022172; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0035318; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022472; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022479; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022480; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022481; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022482; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022485; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022487; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022488; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022495; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022503; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022506; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022507; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022511; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022512; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022514; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022526; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022537; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022555; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022563; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022564; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022571; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022573; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022577; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022594; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022596; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022598; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022599; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022600; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022608; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022615; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022616; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022620; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022627; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022630; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022631; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022632; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022633; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022647; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022648; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022652; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022654; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022656; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022660; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022666; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022678; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022684; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022691; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022696; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022702; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022703; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022704; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022705; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022707; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022712; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022714; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022715; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022719; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022721; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022722; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022726; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022729; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022730; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022731; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022734; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022736; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022737; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022743; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022753; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022755; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022759; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022764; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022773; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022782; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022786; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022787; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022795; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022805; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022815; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022816; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022826; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022827; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022841; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022851; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022852; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022854; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0036136; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021321; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021328; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021329; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021330; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021331; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021334; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021336; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021337; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021344; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021351; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021352; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021355; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021356; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021360; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021361; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021363; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021374; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021384; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021403; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021406; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021410; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021411; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021418; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021420; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021424; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021441; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021443; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021445; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021446; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021447; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021455; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021462; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021463; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021467; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021474; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021477; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021478; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021479; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021480; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021494; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021495; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021499; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021501; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021503; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021507; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021513; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021525; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021531; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021538; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021543; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021548; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021549; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021550; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021551; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021553; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021558; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021560; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021561; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021565; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021567; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021568; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021572; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021576; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021577; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021578; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021581; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021583; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021584; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021591; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021600; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021602; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021611; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021620; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021626; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021629; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021633; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021634; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021641; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021642; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021649; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021659; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021660; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021670; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021671; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021677; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021679; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021685; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021695; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021696; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021698; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0034608; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021765; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021772; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021773; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021774; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021775; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021778; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021780; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021781; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021788; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021796; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021799; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021800; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021804; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021805; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021807; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021814; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021818; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021829; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021848; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021851; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021855; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021856; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021863; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021865; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021869; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021886; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021888; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021890; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021891; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021892; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021900; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021907; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021908; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021912; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021919; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021922; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021923; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021924; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021925; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021939; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021940; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021944; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021946; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021948; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021958; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021970; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021976; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021983; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021988; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021995; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021997; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0021999; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022004; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022006; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022007; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022011; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022013; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022014; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022018; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022021; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022022; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022023; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022026; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022028; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022029; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022035; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022045; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022047; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022055; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022064; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022070; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022073; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022077; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022078; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022080; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022085; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022092; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022102; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022103; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022113; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022114; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022120; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022128; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022138; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022139; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0022141; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0035287; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0021894; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021901; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021902; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021903; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021904; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021907; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021909; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021910; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021917; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021925; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021928; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021929; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021933; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021934; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021936; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021948; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021959; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021976; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021982; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021983; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021990; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021992; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0021996; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022013; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022015; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022017; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022018; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022019; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022027; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022034; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022035; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022039; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022046; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022049; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022050; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022051; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022052; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022066; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022067; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022071; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022073; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022075; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022079; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022085; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022097; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022103; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022110; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022115; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022121; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022122; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022123; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022125; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022130; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022132; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022133; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022137; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022139; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022140; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022144; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022148; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022149; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022150; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022153; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022155; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022156; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022162; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022172; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022174; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022182; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022191; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022197; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022200; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022204; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022205; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022207; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022216; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022223; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022233; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022234; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022244; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022245; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022251; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022259; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022269; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022270; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0022272; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0035438; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0021872; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021879; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021880; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021881; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021882; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021885; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021887; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021888; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021895; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021903; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021906; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021907; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021911; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021912; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021914; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021925; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021936; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021953; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021958; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021961; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021962; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021969; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021971; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021975; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021992; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021994; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021996; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021997; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0021998; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022006; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022013; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022014; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022018; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022025; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022028; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022029; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022030; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022031; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022045; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022046; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022050; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022052; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022054; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022064; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022076; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022082; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022089; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022094; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022100; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022101; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022102; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022103; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022105; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022110; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022112; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022113; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022117; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022119; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022120; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022124; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022128; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022129; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022130; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022133; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022135; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022136; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022142; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022152; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022154; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022161; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022170; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022176; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022179; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022183; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022184; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022186; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022199; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022209; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022220; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022221; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022227; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022235; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022245; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022246; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0022248; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0035385; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0021962; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021969; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021970; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021971; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021972; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021975; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021977; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021978; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021985; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021993; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021996; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0021997; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022001; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022002; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022004; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022016; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022027; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022045; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022048; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022049; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022053; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022054; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022061; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022063; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022067; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022084; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022086; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022088; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022089; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022090; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022098; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022105; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022106; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022110; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022117; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022120; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022121; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022122; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022123; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022137; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022138; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022142; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022144; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022146; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022150; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022156; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022168; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022174; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022181; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022186; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022192; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022193; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022194; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022195; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022197; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022202; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022204; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022205; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022209; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022211; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022212; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022216; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022219; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022220; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022221; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022224; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022226; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022227; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022233; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022243; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022245; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022253; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022262; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022268; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022271; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022275; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022276; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022283; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022285; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022292; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022302; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022303; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022313; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022314; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022320; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022328; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022338; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022339; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0022341; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0035520; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021892; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021899; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021900; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021901; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021902; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021905; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021907; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021908; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021915; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021923; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021926; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021927; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021931; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021932; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021934; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021946; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021957; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021974; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021977; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021978; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021981; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021982; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021989; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021991; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0021995; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022012; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022014; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022016; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022017; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022018; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022026; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022033; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022034; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022038; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022045; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022048; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022049; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022050; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022051; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022065; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022066; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022070; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022072; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022074; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022078; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022084; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022096; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022102; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022109; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022114; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022120; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022121; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022122; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022123; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022125; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022130; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022132; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022133; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022137; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022139; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022140; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022144; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022148; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022149; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022150; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022153; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022155; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022156; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022162; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022172; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022174; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022182; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022191; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022197; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022200; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022204; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022205; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022207; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022213; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022214; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022221; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022231; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022232; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022242; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022243; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022249; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022251; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022257; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022267; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022268; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022270; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0035429; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022486; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022493; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022494; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022495; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022496; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022499; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022501; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022502; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022509; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022517; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022520; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022521; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022525; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022526; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022528; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022540; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022551; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022569; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022578; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022579; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022586; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022588; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022592; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022609; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022611; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022613; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022614; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022615; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022623; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022630; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022631; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022635; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022642; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022645; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022646; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022647; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022648; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022662; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022663; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022667; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022669; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022671; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022681; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022693; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022699; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022706; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022711; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022717; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022718; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022719; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022720; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022722; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022727; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022729; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022730; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022734; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022736; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022737; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022741; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022744; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022745; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022746; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022749; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022751; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022752; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022758; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022768; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022770; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022778; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022787; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022796; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022800; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022801; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022809; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022810; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022817; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022827; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022828; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022838; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022839; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022845; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022847; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022853; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022863; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022864; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022866; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0036143; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021063; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021070; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021071; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021072; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021073; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021076; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021078; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021079; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021086; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021094; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021097; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021098; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021102; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021103; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021105; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021112; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021127; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021145; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021151; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021152; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021159; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021161; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021165; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021182; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021184; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021186; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021187; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021188; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021196; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021203; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021204; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021206; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021208; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021215; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021218; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021219; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021220; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021221; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021235; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021236; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021240; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021242; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021244; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021254; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021266; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021272; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021279; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021284; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021290; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021291; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021292; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021293; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021295; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021299; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021301; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021302; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021306; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021308; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021309; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021313; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021315; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021316; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021317; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021320; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021322; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021323; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021329; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021339; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021350; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021359; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021365; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021368; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021372; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021373; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021380; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021382; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021389; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021399; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021400; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021410; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021411; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021417; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021419; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021425; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021435; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021436; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021438; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0034310; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021373; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021380; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021381; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021382; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021383; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021386; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021388; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021389; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021396; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021404; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021407; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021408; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021412; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021413; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021415; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021422; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021426; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021437; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021454; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021459; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021460; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021467; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021469; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021473; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021490; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021492; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021494; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021495; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021496; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021504; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021511; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021512; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021516; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021523; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021526; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021527; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021528; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021529; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021543; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021544; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021548; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021550; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021552; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021562; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021574; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021580; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021587; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021592; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021598; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021599; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021600; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021601; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021603; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021608; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021610; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021611; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021615; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021617; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021618; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021622; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021627; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021628; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021629; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021632; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021634; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021635; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021641; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021651; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021653; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021661; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021670; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021676; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021679; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021683; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021685; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021691; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021699; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021709; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021710; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021720; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021721; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021729; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021735; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021745; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021746; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021748; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0034744; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000542; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001326; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001701; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003442; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000003450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006094; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015509; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023029; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023044; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023048; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023065; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023067; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023068; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023070; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023083; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023291; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023709; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023728; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023734; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023737; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023774; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023775; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023781; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023806; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023807; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000023813; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000024249; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029441; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039665; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040676; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041415; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041609; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042818; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043087; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043149; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046259; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047104; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047419; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049122; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049530; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053106; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000053183; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055721; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056177; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057386; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057979; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059112; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060808; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000062879; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064391; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000064462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066949; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000067752; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068457; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068861; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069511; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069877; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075420; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075444; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078218; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078508; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000078953; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079736; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081650; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081945; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000082197; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087996; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088049; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088788; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000088823; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000089311; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096143; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000096350; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100162; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100206; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000100439; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000108828; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109024; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109100; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109256; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109276; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109353; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109380; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109422; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109423; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109605; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115231; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117984; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119063; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120028; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000121718; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123626; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123922; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000130700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134554; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000134985; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000138843; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143400; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000145482; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000149111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000155781; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000156927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163691; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163754; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164614; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165095; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165199; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165408; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165443; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165924; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166030; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166977; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168828; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169033; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169604; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170629; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170955; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171436; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172403; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000173163; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181801; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184485; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000184616; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187550; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188562; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000189724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190959; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000191513; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216901; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217517; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041649; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041686; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041687; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041692; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041704; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041720; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041722; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041723; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041743; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041786; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041792; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041793; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041803; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041804; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041807; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041867; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041910; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041962; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0041970; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042008; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042012; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042020; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042081; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042085; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042087; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042088; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042089; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042112; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042134; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042135; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042147; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042172; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042191; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042192; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042197; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042198; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042255; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042257; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042280; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042282; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042292; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042330; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042359; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042371; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042402; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042428; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042438; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042439; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042441; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042442; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042451; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042466; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042469; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042471; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042482; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042487; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042488; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042498; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042507; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042509; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042510; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042514; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042516; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042517; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042552; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042583; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042588; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042605; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042639; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042672; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042685; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042695; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042696; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042698; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042704; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042706; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042714; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042728; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042729; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042767; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042768; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042796; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042834; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042853; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042863; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042865; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0095875; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0041616; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041652; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041653; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041658; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041670; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041685; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041687; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041688; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041708; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041751; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041757; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041758; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041768; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041769; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041771; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041832; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041875; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041926; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041930; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041934; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041935; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041968; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041972; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0041980; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042040; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042044; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042046; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042047; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042048; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042072; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042094; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042095; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042107; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042131; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042150; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042151; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042156; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042157; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042216; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042218; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042241; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042243; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042252; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042290; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042320; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042332; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042364; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042389; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042400; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042401; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042403; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042404; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042413; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042426; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042429; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042431; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042442; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042447; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042448; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042458; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042467; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042469; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042470; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042474; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042476; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042477; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042512; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042543; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042548; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042569; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042601; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042634; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042647; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042656; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042657; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042659; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042666; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042669; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042677; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042690; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042691; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042729; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042730; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042758; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042798; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042818; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042828; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0042830; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0041577; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041613; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041614; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041619; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041631; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041647; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041649; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041650; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041670; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041713; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041719; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041721; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041731; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041732; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041735; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041797; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041840; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041892; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041893; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041897; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041898; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041934; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041938; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0041946; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042006; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042010; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042013; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042014; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042015; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042038; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042061; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042062; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042075; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042099; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042118; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042124; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042125; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042183; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042185; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042208; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042210; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042218; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042253; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042281; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042294; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042326; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042352; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042364; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042366; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042367; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042376; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042391; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042394; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042396; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042407; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042412; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042413; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042423; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042433; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042435; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042436; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042440; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042442; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042443; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042478; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042507; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042512; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042533; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042566; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042598; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042611; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042620; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042621; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042623; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042640; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042653; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042654; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042696; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042697; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042725; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042765; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042784; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042794; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0042796; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0095910; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041610; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041646; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041647; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041652; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041664; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041680; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041682; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041683; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041703; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041740; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041747; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041753; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041754; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041764; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041765; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041767; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041829; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041872; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041924; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041931; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041932; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041964; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041968; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0041976; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042036; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042040; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042042; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042043; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042044; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042067; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042089; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042090; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042102; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042127; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042146; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042147; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042152; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042153; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042212; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042214; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042237; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042239; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042247; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042283; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042311; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042324; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042355; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042381; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042392; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042393; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042395; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042396; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042405; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042420; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042423; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042425; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042436; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042441; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042442; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042452; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042460; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042462; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042463; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042467; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042469; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042470; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042505; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042536; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042541; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042560; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042592; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042624; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042637; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042646; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042647; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042649; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042656; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042658; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042666; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042680; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042681; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042719; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042720; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042748; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042788; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042807; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042817; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042819; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0095874; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041344; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041380; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041381; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041386; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041398; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041413; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041416; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041436; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041479; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041485; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041487; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041497; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041498; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041501; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041543; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041563; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041606; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041657; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041663; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041699; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041703; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041711; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041771; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041775; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041777; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041778; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041779; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041802; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041824; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041825; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041837; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041862; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041881; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041882; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041887; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041888; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041946; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041948; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041971; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041973; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0041981; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042019; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042048; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042061; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042093; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042119; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042129; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042131; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042132; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042141; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042154; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042157; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042159; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042170; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042175; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042176; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042186; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042196; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042197; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042201; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042203; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042204; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042239; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042270; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042275; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042296; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042329; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042361; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042374; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042383; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042391; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042398; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042414; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042415; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042453; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042454; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042482; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042522; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042542; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042552; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042554; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0095453; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042091; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042127; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042128; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042133; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042145; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042161; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042163; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042164; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042183; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042228; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042234; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042236; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042246; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042247; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042250; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042308; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042351; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042401; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042405; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042409; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042410; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042448; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042451; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042459; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042519; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042523; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042525; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042526; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042527; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042570; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042583; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042607; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042626; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042627; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042632; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042633; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042692; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042694; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042717; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042719; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042727; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042741; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042768; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042796; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042809; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042840; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042866; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042878; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042879; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042881; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042882; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042891; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042905; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042908; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042910; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042921; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042926; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042927; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042936; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042944; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042946; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042947; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042951; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042953; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042954; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042989; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043021; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043026; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043039; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043045; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043078; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043109; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043122; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043131; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043132; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043140; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043151; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043165; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043166; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043205; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043206; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043271; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043290; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043300; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043302; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0096405; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041416; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041453; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041454; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041459; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041471; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041486; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041488; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041489; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041509; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041547; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041554; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041560; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041562; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041572; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041573; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041576; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041636; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041677; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041731; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041734; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041740; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041741; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041774; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041778; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041784; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041844; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041848; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041850; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041851; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041852; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041876; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041899; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041900; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041913; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041942; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041961; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041962; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041967; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0041968; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042028; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042030; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042053; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042056; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042066; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042079; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042106; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042137; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042151; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042187; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042214; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042224; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042225; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042227; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042228; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042237; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042252; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042255; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042258; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042268; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042273; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042274; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042283; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042292; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042294; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042295; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042300; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042302; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042303; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042339; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042367; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042373; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042396; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042431; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042462; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042484; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042485; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042493; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042494; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042502; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042516; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042517; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042557; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042558; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042586; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042601; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042623; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042642; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042652; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042654; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0096048; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0041252; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041288; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041289; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041294; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041322; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041324; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041325; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041345; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041385; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041391; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041393; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041403; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041404; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041407; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041449; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041468; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041511; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041563; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041566; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041570; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041571; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041608; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041612; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041620; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041678; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041682; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041684; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041685; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041686; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041709; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041731; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041732; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041744; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041769; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041788; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041789; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041794; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041795; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041853; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041855; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041878; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041880; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041888; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041926; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041956; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0041969; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042001; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042027; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042039; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042041; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042042; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042050; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042065; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042068; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042070; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042081; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042086; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042087; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042097; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042105; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042107; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042108; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042112; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042114; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042115; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042150; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042188; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042210; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042243; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042275; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042288; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042297; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042298; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042300; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042305; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042313; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042327; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042328; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042366; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042367; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042395; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042435; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042454; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042464; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0042466; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0095370; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0041409; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041445; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041446; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041451; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041463; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041479; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041481; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041482; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041502; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041545; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041551; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041552; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041562; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041563; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041566; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041606; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041626; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041669; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041719; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041725; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041726; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041759; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041763; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041769; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041831; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041835; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041837; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041838; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041839; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041862; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041883; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041884; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041896; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041920; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041939; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041940; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041945; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0041946; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042005; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042007; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042030; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042033; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042041; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042054; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042080; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042109; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042122; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042154; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042180; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042192; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042194; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042195; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042204; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042220; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042223; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042225; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042236; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042241; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042242; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042252; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042261; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042263; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042264; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042268; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042270; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042271; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042306; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042337; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042341; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042361; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042394; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042425; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042438; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042447; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042448; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042450; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042460; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042468; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042483; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042484; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042522; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042523; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042551; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042591; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042610; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042620; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0042622; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0095569; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0041380; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041416; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041417; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041422; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041434; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041450; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041452; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041453; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041473; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041514; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041520; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041522; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041532; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041533; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041536; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041596; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041638; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041687; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041692; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041695; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041696; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041733; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041736; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041744; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041805; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041809; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041811; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041812; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041813; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041836; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041858; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041859; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041871; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041895; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041914; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041915; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041920; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041921; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041977; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0041979; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042002; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042004; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042012; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042050; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042078; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042091; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042122; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042148; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042158; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042159; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042161; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042162; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042171; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042186; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042189; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042191; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042202; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042207; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042208; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042218; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042227; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042229; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042230; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042234; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042237; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042238; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042273; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042304; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042309; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042326; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042358; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042390; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042403; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042412; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042413; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042415; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042429; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042443; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042482; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042483; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042511; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042551; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042570; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042580; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0042582; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0095415; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0041472; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041508; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041509; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041514; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041526; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041541; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041543; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041544; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041564; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041607; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041613; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041615; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041625; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041626; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041629; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041688; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041731; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041782; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041785; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041786; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041790; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041791; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041826; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041830; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041838; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041900; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041904; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041907; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041908; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041909; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041932; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041954; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041955; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041967; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0041991; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042010; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042011; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042016; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042017; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042074; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042076; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042099; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042101; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042110; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042123; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042149; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042178; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042191; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042223; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042249; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042262; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042263; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042265; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042266; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042275; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042289; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042292; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042294; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042305; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042310; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042311; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042321; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042329; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042331; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042332; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042336; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042338; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042339; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042374; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042405; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042410; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042432; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042466; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042499; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042513; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042522; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042523; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042530; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042532; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042540; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042554; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042555; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042593; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042594; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042622; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042662; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042681; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042691; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0042693; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0095585; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041351; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041386; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041387; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041392; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041404; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041420; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041422; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041423; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041444; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041488; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041494; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041495; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041505; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041506; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041509; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041570; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041613; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041663; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041666; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041667; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041671; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041672; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041701; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041705; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041713; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041771; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041775; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041777; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041778; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041779; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041802; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041824; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041825; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041837; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041861; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041880; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041881; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041886; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041887; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041945; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041947; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041970; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041972; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041980; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0041993; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042020; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042049; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042061; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042093; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042119; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042135; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042136; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042138; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042139; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042163; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042166; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042168; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042179; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042184; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042185; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042195; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042204; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042206; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042207; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042211; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042213; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042214; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042249; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042280; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042285; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042304; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042338; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042370; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042383; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042392; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042393; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042395; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042402; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042403; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042411; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042425; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042426; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042464; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042465; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042492; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042507; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042532; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042552; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042562; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042564; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0095387; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042124; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042160; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042161; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042166; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042178; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042193; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042195; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042196; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042216; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042263; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042269; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042270; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042280; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042281; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042284; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042343; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042386; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042438; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042447; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042448; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042485; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042489; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042497; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042558; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042562; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042564; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042566; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042589; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042611; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042612; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042624; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042649; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042668; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042669; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042674; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042675; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042733; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042735; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042758; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042760; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042769; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042807; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042836; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042848; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042880; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042906; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042918; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042919; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042921; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042922; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042931; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042946; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042949; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042951; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042962; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042967; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042968; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042978; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042986; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042988; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042989; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042993; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042996; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042997; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043032; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043063; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043067; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043083; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043116; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043148; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043161; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043170; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043171; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043179; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043180; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043188; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043202; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043203; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043241; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043242; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043271; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043286; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043311; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043330; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043340; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043342; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0096725; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0040999; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041036; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041037; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041042; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041054; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041069; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041071; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041072; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041092; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041136; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041142; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041144; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041154; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041155; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041158; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041200; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041221; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041265; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041317; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041323; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041324; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041358; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041362; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041368; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041431; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041435; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041437; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041438; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041439; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041462; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041486; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041487; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041495; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041500; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041528; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041547; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041548; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041555; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041557; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041617; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041619; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041642; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041645; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041655; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041690; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041722; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041736; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041773; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041800; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041812; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041813; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041815; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041816; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041824; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041837; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041840; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041843; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041854; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041859; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041860; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041869; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041876; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041878; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041879; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041884; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041886; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041887; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041922; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041953; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041978; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042012; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042043; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042056; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042065; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042066; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042073; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042075; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042083; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042097; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042098; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042138; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042139; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042167; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042182; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042207; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042226; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042236; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042238; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0095467; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040742; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040777; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040778; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040783; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040795; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040810; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040812; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040813; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040833; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040876; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040882; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040883; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040893; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040894; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040896; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040938; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040957; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0040999; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041049; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041054; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041055; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041087; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041091; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041097; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041158; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041162; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041164; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041165; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041166; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041189; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041211; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041212; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041224; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041249; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041268; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041269; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041274; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041275; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041333; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041335; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041358; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041360; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041368; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041405; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041434; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041446; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041482; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041508; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041521; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041522; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041524; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041525; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041534; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041548; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041551; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041553; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041564; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041568; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041569; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041578; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041588; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041590; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041591; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041595; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041597; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041598; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041633; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041664; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041669; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041686; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041720; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041752; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041765; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041774; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041776; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041782; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041791; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041805; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041806; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041844; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041845; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041885; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041910; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041930; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041940; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041942; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0094434; mus_musculus_wsbeij.
DR   EuropePMC; PMC4807263; 26757819.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980430.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..24809537
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            8127..30906
FT                   /locus_tag="mCG_13124"
FT                   /note="gene_id=mCG13124.1"
FT   mRNA            join(8127..8255,12935..12991,15860..15928,16028..16117,
FT                   16372..16481,17947..18475,19085..19195,24838..24985,
FT                   26562..26664,27089..27248,27326..27439,28747..28833,
FT                   29486..29646,30238..30906)
FT                   /locus_tag="mCG_13124"
FT                   /product="mCG13124"
FT                   /note="gene_id=mCG13124.1 transcript_id=mCT13965.2 created
FT                   on 28-AUG-2002"
FT   CDS             join(8250..8255,12935..12991,15860..15928,16028..16117,
FT                   16372..16481,17947..18475,19085..19195,24838..24985,
FT                   26562..26664,27089..27248,27326..27439,28747..28833,
FT                   29486..29644)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13124"
FT                   /product="mCG13124"
FT                   /note="gene_id=mCG13124.1 transcript_id=mCT13965.2
FT                   protein_id=mCP10104.2"
FT                   /protein_id="EDL04685.1"
FT                   /translation="MTPDLLNFKKGWMSILDEPGEWKKHWFVLTDSSLKYYRDSTAEEA
FT                   DELDGEIDLRSCTDVTEYAVQRNYGFQIHTKDAVYTLSAMTSGIRRNWIEALRKTVRPT
FT                   SAPDVTKLSDCNKENTLHGYGTQKSSLKIGEQRTGSEVIGRGGPRKADGPRPSLDYVEL
FT                   SPLAPSSPQRMRTLSRSTPERPTKQEDLERDLAQRSEERRKWFESTDGRTPETPSGDGS
FT                   RRGLGAPLTDDQQSRLSEEIEKKWQELEKLPLRENKRVPLTALLNQAHNDRRGPTSDSH
FT                   EALEKEVQSLRAQLEAWRLRGEAPQNAPRLQEDSHIPPGYISQEACERSLAEMESSHQQ
FT                   VMEQLQRHHERELQRLQQEKEWLLAEETAATASAIEAMKKAYQEELSRELSKTRSLQQG
FT                   PESLRKQHQLDMEALKQELQVLSERYSQKCLEIGALTRQAEEREHTLRRCQQEGQELLR
FT                   HNQELHSHLSEEIDRLRSFIASQGTGNSCGRSNERSSCELEVLLRVKENELQYLKKEVQ
FT                   CLRDELQVIQKDKRFTGKYQDVYVELNHIKTRSEREIEQLKEHLRLAMAALQEKEAVRN
FT                   SLAE"
FT   gene            complement(<41251..48558)
FT                   /locus_tag="mCG_147093"
FT                   /note="gene_id=mCG147093.0"
FT   mRNA            complement(join(<41251..42168,48510..48558))
FT                   /locus_tag="mCG_147093"
FT                   /product="mCG147093"
FT                   /note="gene_id=mCG147093.0 transcript_id=mCT187356.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<41251..41443)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147093"
FT                   /product="mCG147093"
FT                   /note="gene_id=mCG147093.0 transcript_id=mCT187356.0
FT                   protein_id=mCP108752.0"
FT                   /protein_id="EDL04684.1"
FT                   /translation="MLHSTLHTLLRYDGRLTLSLPYHHVSSSASLHRAHTAVFCLSHLP
FT                   ITYDHHSGLFPKEMNFCFV"
FT   gene            53503..55525
FT                   /gene="H1f0"
FT                   /locus_tag="mCG_13142"
FT                   /note="gene_id=mCG13142.1"
FT   mRNA            53503..55525
FT                   /gene="H1f0"
FT                   /locus_tag="mCG_13142"
FT                   /product="H1 histone family, member 0"
FT                   /note="gene_id=mCG13142.1 transcript_id=mCT14010.1 created
FT                   on 26-AUG-2002"
FT   CDS             53749..54333
FT                   /codon_start=1
FT                   /gene="H1f0"
FT                   /locus_tag="mCG_13142"
FT                   /product="H1 histone family, member 0"
FT                   /note="gene_id=mCG13142.1 transcript_id=mCT14010.1
FT                   protein_id=mCP10079.1"
FT                   /protein_id="EDL04683.1"
FT                   /translation="MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGS
FT                   SRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKGDEPKRS
FT                   VAFKKTKKEVKKVATPKKAAKPKKAASKAPSKKPKATPVKKAKKKPAATPKKAKKPKVV
FT                   KVKPVKASKPKKAKTVKPKAKSSAKRASKKK"
FT   gene            55943..63388
FT                   /gene="Gcat"
FT                   /locus_tag="mCG_13143"
FT                   /note="gene_id=mCG13143.2"
FT   mRNA            join(55943..56147,58965..59095,59994..60095,60291..60437,
FT                   60811..60965,61054..61136,61301..61472,61787..61908,
FT                   62177..63384)
FT                   /gene="Gcat"
FT                   /locus_tag="mCG_13143"
FT                   /product="glycine C-acetyltransferase
FT                   (2-amino-3-ketobutyrate-coenzyme A ligase), transcript
FT                   variant mCT14011"
FT                   /note="gene_id=mCG13143.2 transcript_id=mCT14011.2 created
FT                   on 26-AUG-2002"
FT   mRNA            join(55946..56147,58965..59095,59994..60019,61775..61908,
FT                   62177..63388)
FT                   /gene="Gcat"
FT                   /locus_tag="mCG_13143"
FT                   /product="glycine C-acetyltransferase
FT                   (2-amino-3-ketobutyrate-coenzyme A ligase), transcript
FT                   variant mCT173519"
FT                   /note="gene_id=mCG13143.2 transcript_id=mCT173519.0 created
FT                   on 26-AUG-2002"
FT   mRNA            join(55946..56147,58965..59095,59994..60095,60291..60323,
FT                   60354..60437,60811..60965,61054..61136,61301..61472,
FT                   61787..61908,62177..62754)
FT                   /gene="Gcat"
FT                   /locus_tag="mCG_13143"
FT                   /product="glycine C-acetyltransferase
FT                   (2-amino-3-ketobutyrate-coenzyme A ligase), transcript
FT                   variant mCT173520"
FT                   /note="gene_id=mCG13143.2 transcript_id=mCT173520.0 created
FT                   on 26-AUG-2002"
FT   CDS             join(55961..56147,58965..59095,59994..60095,60291..60437,
FT                   60811..60965,61054..61136,61301..61472,61787..61908,
FT                   62177..62328)
FT                   /codon_start=1
FT                   /gene="Gcat"
FT                   /locus_tag="mCG_13143"
FT                   /product="glycine C-acetyltransferase
FT                   (2-amino-3-ketobutyrate-coenzyme A ligase), isoform CRA_a"
FT                   /note="gene_id=mCG13143.2 transcript_id=mCT14011.2
FT                   protein_id=mCP10082.1 isoform=CRA_a"
FT                   /protein_id="EDL04680.1"
FT                   /translation="MWASFMWHGALSPGRRAHSALAQLRCILDSELEGIRGAGTWKSER
FT                   VITSRQGPSIRVDGISGGILNFCANNYLGLSSHPAVIQAGLQTLEEFGAGLSSTRFICG
FT                   TQSIHKNLEAKIAHFHQREDAILYPSCFDANAGLFEALLTPEDAVLSDELNHASIIDGI
FT                   RLCKAHKYRYRHLDMADLEAKLKEAQKHRLRLVATDGAFSMDGDIAPLQDICRLAAQYG
FT                   ALVFVDECHATGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPEPLVSL
FT                   LRQRSRPYLFSNSLPPAVVGCASKALDLLMESNAIIQSMAAKTRRFRSKMEAAGFTVSG
FT                   ADHPICPVMLGDARLSSQMADDMLKKGIFVIGFSYPVVPKGKARIRVQISAVHSEEDID
FT                   RCVEAFVEVGRLHGALP"
FT   CDS             join(55961..56147,58965..59095,59994..60095,60291..60323,
FT                   60354..60437,60811..60965,61054..61136,61301..61472,
FT                   61787..61908,62177..62328)
FT                   /codon_start=1
FT                   /gene="Gcat"
FT                   /locus_tag="mCG_13143"
FT                   /product="glycine C-acetyltransferase
FT                   (2-amino-3-ketobutyrate-coenzyme A ligase), isoform CRA_c"
FT                   /note="gene_id=mCG13143.2 transcript_id=mCT173520.0
FT                   protein_id=mCP96438.0 isoform=CRA_c"
FT                   /protein_id="EDL04682.1"
FT                   /translation="MWASFMWHGALSPGRRAHSALAQLRCILDSELEGIRGAGTWKSER
FT                   VITSRQGPSIRVDGISGGILNFCANNYLGLSSHPAVIQAGLQTLEEFGAGLSSTRFICG
FT                   TQSIHKNLEAKIAHFHQREDAILYPSCFDANAGLFEALLTPEDAVLSGIRLCKAHKYRY
FT                   RHLDMADLEAKLKEAQKHRLRLVATDGAFSMDGDIAPLQDICRLAAQYGALVFVDECHA
FT                   TGFLGPTGRGTDELLGVMDQVTIINSTLGKALGGASGGYTTGPEPLVSLLRQRSRPYLF
FT                   SNSLPPAVVGCASKALDLLMESNAIIQSMAAKTRRFRSKMEAAGFTVSGADHPICPVML
FT                   GDARLSSQMADDMLKKGIFVIGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVG
FT                   RLHGALP"
FT   CDS             join(55961..56147,58965..59095,59994..60019,61775..61908,
FT                   62177..62328)
FT                   /codon_start=1
FT                   /gene="Gcat"
FT                   /locus_tag="mCG_13143"
FT                   /product="glycine C-acetyltransferase
FT                   (2-amino-3-ketobutyrate-coenzyme A ligase), isoform CRA_b"
FT                   /note="gene_id=mCG13143.2 transcript_id=mCT173519.0
FT                   protein_id=mCP96439.0 isoform=CRA_b"
FT                   /protein_id="EDL04681.1"
FT                   /translation="MWASFMWHGALSPGRRAHSALAQLRCILDSELEGIRGAGTWKSER
FT                   VITSRQGPSIRVDGISGGILNFCANNYLGLSSHPAVIQAGLQTLEEFGAGLSSTRFICG
FT                   TQSIHKNLEANCVPRFRSKMEAAGFTVSGADHPICPVMLGDARLSSQMADDMLKKGIFV
FT                   IGFSYPVVPKGKARIRVQISAVHSEEDIDRCVEAFVEVGRLHGALP"
FT   gene            <66962..68502
FT                   /gene="Galr3"
FT                   /locus_tag="mCG_13154"
FT                   /note="gene_id=mCG13154.1"
FT   mRNA            join(<66962..67320,67750..68502)
FT                   /gene="Galr3"
FT                   /locus_tag="mCG_13154"
FT                   /product="galanin receptor 3"
FT                   /note="gene_id=mCG13154.1 transcript_id=mCT14022.1 created
FT                   on 03-FEB-2003"
FT   CDS             join(66962..67320,67750..68476)
FT                   /codon_start=1
FT                   /gene="Galr3"
FT                   /locus_tag="mCG_13154"
FT                   /product="galanin receptor 3"
FT                   /note="gene_id=mCG13154.1 transcript_id=mCT14022.1
FT                   protein_id=mCP10107.1"
FT                   /protein_id="EDL04679.1"
FT                   /translation="MADIQNISLDSPGSVGAVAVPVVFALIFLLGMVGNGLVLAVLLQP
FT                   GPSAWQEPGSTTDLFILNLAVADLCFILCCVPFQAAIYTLDAWLFGAFVCKTVHLLIYL
FT                   TMYASSFTLAAVSVDRYLAVRHPLRSRALRTPRNARAAVGLVWLLAALFSAPYLSYYGT
FT                   VRYGALELCVPAWEDARRRALDVATFAAGYLLPVTVVSLAYGRTLCFLWAAVGPAGAAA
FT                   AEARRRATGRAGRAMLTVAALYALCWGPHHALILCFWYGRFAFSPATYACRLGRTASPT
FT                   PTPASTRSSIPLPPATSARASAACGPAATAATATTTTAFIEPSVVSSRRLRAPPAIPAT
FT                   PDLAVGVWSPEGMPCAVERLD"
FT   gene            complement(78124..>87913)
FT                   /gene="Ankrd54"
FT                   /locus_tag="mCG_13129"
FT                   /note="gene_id=mCG13129.2"
FT   mRNA            complement(join(78124..79111,79523..79630,80319..80443,
FT                   80522..80569,81041..81112,82982..83080,86191..86238,
FT                   87500..87897))
FT                   /gene="Ankrd54"
FT                   /locus_tag="mCG_13129"
FT                   /product="ankyrin repeat domain 54, transcript variant
FT                   mCT13969"
FT                   /note="gene_id=mCG13129.2 transcript_id=mCT13969.2 created
FT                   on 10-SEP-2002"
FT   mRNA            complement(join(78130..79111,79523..80443,80522..80569,
FT                   81041..81112,82982..83080,86191..86238,87500..>87913))
FT                   /gene="Ankrd54"
FT                   /locus_tag="mCG_13129"
FT                   /product="ankyrin repeat domain 54, transcript variant
FT                   mCT189656"
FT                   /note="gene_id=mCG13129.2 transcript_id=mCT189656.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(78130..79111,79523..79630,80319..80443,
FT                   80522..80569,81041..81112,82982..83080,86191..86238,
FT                   87507..87596,87773..87891))
FT                   /gene="Ankrd54"
FT                   /locus_tag="mCG_13129"
FT                   /product="ankyrin repeat domain 54, transcript variant
FT                   mCT173200"
FT                   /note="gene_id=mCG13129.2 transcript_id=mCT173200.0 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(79037..79111,79523..79630,80319..80443,
FT                   80522..80569,81041..81112,82982..83080,86191..86238,
FT                   87507..87596,87773..87824))
FT                   /codon_start=1
FT                   /gene="Ankrd54"
FT                   /locus_tag="mCG_13129"
FT                   /product="ankyrin repeat domain 54, isoform CRA_a"
FT                   /note="gene_id=mCG13129.2 transcript_id=mCT173200.0
FT                   protein_id=mCP96119.0 isoform=CRA_a"
FT                   /protein_id="EDL04676.1"
FT                   /translation="MAATGGGADDESRSGRSTSRRTALQDSRRAVEACRQAPPSARAHR
FT                   QGALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHG
FT                   ADPNQQDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQE
FT                   GHSQCLEAVRLEVKQIIHMLREYLERLGRHEQRERLDDLCTRLQMTSTKEQVDEVTDLL
FT                   ASFTSLSLQMQSMEKR"
FT   CDS             complement(join(79037..79111,79523..79630,80319..80443,
FT                   80522..80569,81041..81112,82982..83080,86191..86238,
FT                   87500..87824))
FT                   /codon_start=1
FT                   /gene="Ankrd54"
FT                   /locus_tag="mCG_13129"
FT                   /product="ankyrin repeat domain 54, isoform CRA_c"
FT                   /note="gene_id=mCG13129.2 transcript_id=mCT13969.2
FT                   protein_id=mCP10036.2 isoform=CRA_c"
FT                   /db_xref="GOA:A7YB12"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:2444209"
FT                   /db_xref="UniProtKB/TrEMBL:A7YB12"
FT                   /protein_id="EDL04678.1"
FT                   /translation="MAATGGGADDESRSGRSSSDGECAVAPEPLAEAGGLVSFADFGVS
FT                   LGSGAGLPGRSVGRAQSSLRYLQVLWQQDVEPRDELRCKIPAGRLRRAARPHRRLGPTG
FT                   KEVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLD
FT                   HGADPNQQDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNIL
FT                   QEGHSQCLEAVRLEVKQIIHMLREYLERLGRHEQRERLDDLCTRLQMTSTKEQVDEVTD
FT                   LLASFTSLSLQMQSMEKR"
FT   CDS             complement(join(80250..80443,80522..80569,81041..81112,
FT                   82982..83080,86191..86238,87500..>87911))
FT                   /codon_start=1
FT                   /gene="Ankrd54"
FT                   /locus_tag="mCG_13129"
FT                   /product="ankyrin repeat domain 54, isoform CRA_b"
FT                   /note="gene_id=mCG13129.2 transcript_id=mCT189656.0
FT                   protein_id=mCP110645.0 isoform=CRA_b"
FT                   /protein_id="EDL04677.1"
FT                   /translation="TARLLLEGSGSVGRFGARLALPGPRLAVAMAATGGGADDESRSGR
FT                   SSSDGECAVAPEPLAEAGGLVSFADFGVSLGSGAGLPGRSVGRAQSSLRYLQVLWQQDV
FT                   EPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQQLLEDGAD
FT                   PCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQQDGLGNTPLHLAACTNHVPVITT
FT                   LLRGGARVDALDRAGRTPLHLAKSKLNILQEGHSQCLEAVRLEVKQVSDSSWWAPGLAD
FT                   SLSLLGLPV"
FT   assembly_gap    99128..102930
FT                   /estimated_length=3803
FT                   /gap_type="unknown"
FT   gene            104403..131167
FT                   /gene="Eif3s6ip"
FT                   /locus_tag="mCG_13139"
FT                   /note="gene_id=mCG13139.1"
FT   mRNA            join(104403..104492,104971..105019,106031..106134,
FT                   110736..110845,111878..111957,112797..112858,
FT                   115399..115468,115666..115739,118147..118318,
FT                   122311..122465,123184..123354,126219..126716,
FT                   130098..130178,130962..131167)
FT                   /gene="Eif3s6ip"
FT                   /locus_tag="mCG_13139"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 6 interacting protein"
FT                   /note="gene_id=mCG13139.1 transcript_id=mCT14008.2 created
FT                   on 28-AUG-2002"
FT   CDS             join(104460..104492,104971..105019,106031..106134,
FT                   110736..110845,111878..111957,112797..112858,
FT                   115399..115468,115666..115739,118147..118318,
FT                   122311..122465,123184..123354,126219..126716,
FT                   130098..130178,130962..131000)
FT                   /codon_start=1
FT                   /gene="Eif3s6ip"
FT                   /locus_tag="mCG_13139"
FT                   /product="eukaryotic translation initiation factor 3,
FT                   subunit 6 interacting protein"
FT                   /note="gene_id=mCG13139.1 transcript_id=mCT14008.2
FT                   protein_id=mCP10101.2"
FT                   /protein_id="EDL04675.1"
FT                   /translation="MSYPADDYESEAAYDPYAYPGDYDMHTGDPKQDLAYERQYEQQTY
FT                   QVIPEVIKNFIQYFHKTTVSDLIDQKVYELQASRVSSDVIDQKVYEIQDIYENSWTKLT
FT                   ERFFKNTPWPEAEAIAPQVGNDAVFLILYKELYYRHIYAKVSGGPSLEQRFESYYNYCN
FT                   LFNYILNADGPAPLELPNQWLWDIIDEFIYQFQSFSQYRCKTAKKSEGEMDFLRSNPKV
FT                   WNVHSVLNVLHSLVDKSNINRQLEVYTSGGDPESVAGEYGRHSLYKMLGYFSLVGLLRL
FT                   HSLLGDYYQAIKVLENIELNKKSMYSRVPECQVTTYYYVGFAYLMMRRYQDAIRVFANI
FT                   LLYIQRTKSMFQRTTYKYEMINKQNEQMHALLAIALTMYPMRIDESIHLQLREKYGDKM
FT                   LRMQKGDPQVYEELFSYACPKFLSPVVPNYDNVHPNYHKEPFLQQLKVFSDEVQQQAQL
FT                   STIRSFLKLYTTMPVAKLAGFLDLTEQEFRIQLLVFKHKMKNLVWTSGISALDGEFQSA
FT                   SEVDFYIDKDMIHIADTKVARRYGDFFIRQIHKFEELNRTLKKMGQRP"
FT   assembly_gap    109386..109405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    110641..110660
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    118563..118582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    121190..121209
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            145146..173026
FT                   /locus_tag="mCG_13144"
FT                   /note="gene_id=mCG13144.2"
FT   mRNA            join(145146..145591,150793..150841,151168..151309,
FT                   155876..155967,156899..157041,158682..159121,
FT                   160636..160693,161385..161809,163095..163471,
FT                   165927..166061,166581..166707,166827..166917,
FT                   167056..167129,167892..168006,168171..168217,
FT                   169118..173026)
FT                   /locus_tag="mCG_13144"
FT                   /product="mCG13144, transcript variant mCT14012"
FT                   /note="gene_id=mCG13144.2 transcript_id=mCT14012.2 created
FT                   on 28-AUG-2002"
FT   mRNA            join(<145409..145591,150793..150841,151168..151309,
FT                   155876..155967,156899..157041,158682..159121,
FT                   160636..160693,161385..161809,163065..163471,
FT                   165927..166061,166581..166707,166827..166917,
FT                   167056..167129,167892..168006,168171..168217,
FT                   169118..173025)
FT                   /locus_tag="mCG_13144"
FT                   /product="mCG13144, transcript variant mCT189718"
FT                   /note="gene_id=mCG13144.2 transcript_id=mCT189718.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<145530..145591,150793..150841,151168..151309,
FT                   155876..155967,156899..157041,158682..159121,
FT                   160636..160693,161385..161809,163065..163471,
FT                   165927..166061,166581..166707,166827..166917,
FT                   167056..167129,167892..168006,168171..168217,
FT                   169118..169239)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13144"
FT                   /product="mCG13144, isoform CRA_b"
FT                   /note="gene_id=mCG13144.2 transcript_id=mCT189718.0
FT                   protein_id=mCP110689.0 isoform=CRA_b"
FT                   /protein_id="EDL04674.1"
FT                   /translation="AAPSGRPGFLRHPAPDRPHLLDFQSLSKENVFENNRLAFEVAEKE
FT                   LGIPALLDPNDMVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKPGKDPAPPSPTST
FT                   SPAVQPGEEAQGDDLSPDSLSEQGKQQPPSSACAACGQRVHLVQRYLAEGRLYHRHCFR
FT                   CRQCSSTLVPGSYSSGPEEGTFVCAERCTRLGPGSRSGTRLLSQQRQQPAAAEAKDAED
FT                   NDPSLSVAAVAEADRLQASSEVQFHTPTKPPLPSKPQELASPPGGRPTPAPRKASESSA
FT                   LTPPTPRPRSSLQQDGTVEQSVSSGLVNGRLQEPPVPKPRGTPKLSERMAAPRKDPPWI
FT                   TLVQTEPKKKPAPQPPSSGPGPLSQAYRQVEDGGLEEQTQKSSGTEPEPKPYNPFEEEE
FT                   EEEGEPAPPVPSPSLAPPVPSPSPAPPVPSPAPAPSEATPKSLHPWYGITPTSSPKTKK
FT                   RPAPRAPSASPLAIHASRLSHSEPPSATPSPALSVESLSSESSSHTANAEPLEPPAVPK
FT                   SSSDPAVHVPGTPGTSGNSVTPSANSSLSSSGELGQPSGEQMLQVRTKGSAGTHSTKPF
FT                   SGATPTPFLLAGDRNPAPPVGSASPQLQIKSSCKENPFNRKPSPSASPTVRKATKGAKP
FT                   VRPPAPGHGFPLIKRKVQADQYIPEEDIYGEMDNIERQLDALEHSGVLLEEKLRGGANE
FT                   GSEDDMLVDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWT
FT                   DEDRAREKVLMQELMTLIEQRDAIVNCLDEDRQREEEEDKMLETMIKKKDFQREAESDS
FT                   KKKGKFKTIKVLKFLGNKREAKSKAPGDKS"
FT   CDS             join(151225..151309,155876..155967,156899..157041,
FT                   158682..159121,160636..160693,161385..161809,
FT                   163095..163471,165927..166061,166581..166707,
FT                   166827..166917,167056..167129,167892..168006,
FT                   168171..168217,169118..169239)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13144"
FT                   /product="mCG13144, isoform CRA_a"
FT                   /note="gene_id=mCG13144.2 transcript_id=mCT14012.2
FT                   protein_id=mCP10087.2 isoform=CRA_a"
FT                   /protein_id="EDL04673.1"
FT                   /translation="MVSMSVPDCLSIMTYVSQYYNHFTSSGQAAASPPKPGKDPAPPSP
FT                   TSTSPAVQPGEEAQGDDLSPDSLSEQGKQQPPSSACAACGQRVHLVQRYLAEGRLYHRH
FT                   CFRCRQCSSTLVPGSYSSGPEEGTFVCAERCTRLGPGSRSGTRLLSQQRQQPAAAEAKD
FT                   AEDNDPSLSVAAVAEADRLQASSEVQFHTPTKPPLPSKPQELASPPGGRPTPAPRKASE
FT                   SSALTPPTPRPRSSLQQDGTVEQSVSSGLVNGRLQEPPVPKPRGTPKLSERMAAPRKDP
FT                   PWITLVQTEPKKKPAPQPPSSGPGPLSQAYRQVEDGGLEEQTQKSSGTEPEPKPYNPFE
FT                   EEEEEEGEPAPPVPSPSLAPPVPSPSPAPPVPSPAPAPSEATPKSLHPWYGITPTSSPK
FT                   TKKRPAPRAPSASPLEPPSATPSPALSVESLSSESSSHTANAEPLEPPAVPKSSSDPAV
FT                   HVPGTPGTSGNSVTPSANSSLSSSGELGQPSGEQMLQVRTKGSAGTHSTKPFSGATPTP
FT                   FLLAGDRNPAPPVGSASPQLQIKSSCKENPFNRKPSPSASPTVRKATKGAKPVRPPAPG
FT                   HGFPLIKRKVQADQYIPEEDIYGEMDNIERQLDALEHSGVLLEEKLRGGANEGSEDDML
FT                   VDWFKLIHEKHLLVRRESELIYVFKQQNLEQRQADVEFELRCLLNKPEKDWTDEDRARE
FT                   KVLMQELMTLIEQRDAIVNCLDEDRQREEEEDKMLETMIKKKDFQREAESDSKKKGKFK
FT                   TIKVLKFLGNKREAKSKAPGDKS"
FT   gene            complement(170774..177367)
FT                   /gene="1700088E04Rik"
FT                   /locus_tag="mCG_13157"
FT                   /note="gene_id=mCG13157.2"
FT   mRNA            complement(join(170774..171341,171472..171572,
FT                   171756..171884,172434..172616,177270..177356))
FT                   /gene="1700088E04Rik"
FT                   /locus_tag="mCG_13157"
FT                   /product="RIKEN cDNA 1700088E04, transcript variant
FT                   mCT172401"
FT                   /note="gene_id=mCG13157.2 transcript_id=mCT172401.0 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(170809..171341,171472..171572,
FT                   171756..171884,172434..172616,175361..175423,
FT                   176996..177107,177270..177367))
FT                   /gene="1700088E04Rik"
FT                   /locus_tag="mCG_13157"
FT                   /product="RIKEN cDNA 1700088E04, transcript variant
FT                   mCT14025"
FT                   /note="gene_id=mCG13157.2 transcript_id=mCT14025.2 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(170996..171341,171472..171572,
FT                   171756..171884,175361..175423,176996..177240))
FT                   /gene="1700088E04Rik"
FT                   /locus_tag="mCG_13157"
FT                   /product="RIKEN cDNA 1700088E04, transcript variant
FT                   mCT172400"
FT                   /note="gene_id=mCG13157.2 transcript_id=mCT172400.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(171270..171341,171472..171572,
FT                   171756..171884,175361..175423,176996..177098))
FT                   /codon_start=1
FT                   /gene="1700088E04Rik"
FT                   /locus_tag="mCG_13157"
FT                   /product="RIKEN cDNA 1700088E04, isoform CRA_b"
FT                   /note="gene_id=mCG13157.2 transcript_id=mCT172400.0
FT                   protein_id=mCP95320.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR007914"
FT                   /db_xref="MGI:MGI:1920774"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V9V4"
FT                   /protein_id="EDL04671.1"
FT                   /translation="MASQERVDSVTKGTGFRRCRKQAGYTPGTCELLRVMMKESKLTNF
FT                   QQRHIMDTMKRDLEKEKRRLQNIFATGKDKEERKKVPHVRQEDPAPELDRFDELVKEIQ
FT                   DRKEFLAAMEALGQGRQYRSIILAEISQKLREMEDIDRRRSKELRKALATT"
FT   CDS             complement(join(171270..171341,171472..171572,
FT                   171756..171884,172434..172616,175361..175423,
FT                   176996..177098))
FT                   /codon_start=1
FT                   /gene="1700088E04Rik"
FT                   /locus_tag="mCG_13157"
FT                   /product="RIKEN cDNA 1700088E04, isoform CRA_a"
FT                   /note="gene_id=mCG13157.2 transcript_id=mCT14025.2
FT                   protein_id=mCP10053.2 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR007914"
FT                   /db_xref="MGI:MGI:1920774"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AC9"
FT                   /protein_id="EDL04670.1"
FT                   /translation="MASQERVDSVTKGTGFRRCRKQAGYTPGTCELLRVMMKESKLTNF
FT                   QQRHIMDTMKRGAPLPLQCNPTSSLRGSPSKKAASAIYLPPILATHSHLRPASLCQANG
FT                   AYSREQFKPQATRDLEKEKRRLQNIFATGKDKEERKKVPHVRQEDPAPELDRFDELVKE
FT                   IQDRKEFLAAMEALGQGRQYRSIILAEISQKLREMEDIDRRRSKELRKALATT"
FT   CDS             complement(join(171270..171341,171472..171531))
FT                   /codon_start=1
FT                   /gene="1700088E04Rik"
FT                   /locus_tag="mCG_13157"
FT                   /product="RIKEN cDNA 1700088E04, isoform CRA_c"
FT                   /note="gene_id=mCG13157.2 transcript_id=mCT172401.0
FT                   protein_id=mCP95319.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR007914"
FT                   /db_xref="MGI:MGI:1920774"
FT                   /db_xref="UniProtKB/TrEMBL:A0A087WPW6"
FT                   /protein_id="EDL04672.1"
FT                   /translation="MEALGQGRQYRSIILAEISQKLREMEDIDRRRSKELRKALATT"
FT   gene            177119..187940
FT                   /gene="Polr2f"
FT                   /locus_tag="mCG_13150"
FT                   /note="gene_id=mCG13150.1"
FT   mRNA            join(177119..177549,180723..180792,182145..182275,
FT                   187425..187496,187678..187940)
FT                   /gene="Polr2f"
FT                   /locus_tag="mCG_13150"
FT                   /product="polymerase (RNA) II (DNA directed) polypeptide F"
FT                   /note="gene_id=mCG13150.1 transcript_id=mCT14018.1 created
FT                   on 28-AUG-2002"
FT   CDS             join(177530..177549,180723..180792,182145..182275,
FT                   187425..187496,187678..187768)
FT                   /codon_start=1
FT                   /gene="Polr2f"
FT                   /locus_tag="mCG_13150"
FT                   /product="polymerase (RNA) II (DNA directed) polypeptide F"
FT                   /note="gene_id=mCG13150.1 transcript_id=mCT14018.1
FT                   protein_id=mCP10112.2"
FT                   /protein_id="EDL04669.1"
FT                   /translation="MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERP
FT                   QANQKRITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPI
FT                   IIRRYLPDGSYEDWGVDELIISD"
FT   gene            complement(191002..201705)
FT                   /locus_tag="mCG_13137"
FT                   /note="gene_id=mCG13137.2"
FT   mRNA            complement(join(191002..192760,195241..195509,
FT                   199396..199901,200388..200612,201659..201705))
FT                   /locus_tag="mCG_13137"
FT                   /product="mCG13137"
FT                   /note="gene_id=mCG13137.2 transcript_id=mCT14006.2 created
FT                   on 10-SEP-2002"
FT   CDS             complement(join(192057..192760,195241..195509,
FT                   199396..199901,200388..200612,201659..201664))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13137"
FT                   /product="mCG13137"
FT                   /note="gene_id=mCG13137.2 transcript_id=mCT14006.2
FT                   protein_id=mCP10091.2"
FT                   /protein_id="EDL04668.1"
FT                   /translation="MEPSAAAQSVSAVQPGCLVVRIQAPSRQGSGLRLRAPQPLPPSPS
FT                   ASLPSPELDRTPWDTVFHFLRTSPRLEERSEEVGVGLFTRTPAAGPGEAAEAAAAGSDM
FT                   AEEQDLSEVELSPVGSEEPRCLSPGSAPSLGPDGGGGGSGLRASPGPGELGKVKKEQQD
FT                   GEADDDKFPVCIREAVSQVLSGYDWTLVPMPVRVNGASKSKPHVKRPMNAFMVWAQAAR
FT                   RKLADQYPHLHNAELSKTLGKLWRLLNESDKRPFIEEAERLRMQHKKDHPDYKYQPRRR
FT                   KNGKAAQGEAECPGGEAEQGGAAAIQAHYKSAHLDHRHPEEGSPMSDGNPEHPSGQSHG
FT                   PPTPPTTPKTELQSGKADPKRDGRSLGEGGKPHIDFGNVDIGEISHEVMSNMETFDVTE
FT                   LDQYLPPNGHPGHVGSYSAAGYGLGSALAVASGHSAWISKPPGVALPTVSPPGVDAKAQ
FT                   VKTETTGPQGPPHYTDQPSTSQIAYTSLSLPHYGSAFPSISRPQFDYSDHQPSGPYYGH
FT                   AGQASGLYSAFSYMGPSQRPLYTAISDPSPSGPQSHSPTHWEQPVYTTLSRP"
FT   assembly_gap    200639..200976
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    226560..226830
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    252248..253499
FT                   /estimated_length=1252
FT                   /gap_type="unknown"
FT   assembly_gap    255679..255698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    257085..257104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    258738..258757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    261238..266125
FT                   /estimated_length=4888
FT                   /gap_type="unknown"
FT   gene            272220..292633
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /note="gene_id=mCG13134.2"
FT   mRNA            join(272220..272451,272781..272884,273575..273686,
FT                   282805..282933,284434..284500,286175..286264,
FT                   288023..288076,288458..288520,289150..289283,
FT                   289580..289672,290437..290487,291317..291461,
FT                   291887..292633)
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, transcript
FT                   variant mCT13974"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT13974.2 created
FT                   on 23-AUG-2002"
FT   mRNA            join(272442..272601,272781..272884,273575..273686,
FT                   282805..282933,286175..286264,288023..288076,
FT                   288458..288520,289150..289283,289580..289672,
FT                   290437..290487,291317..291461,291887..292626)
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, transcript
FT                   variant mCT172398"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT172398.0 created
FT                   on 23-AUG-2002"
FT   mRNA            join(<272442..272601,272781..272884,273575..273686,
FT                   282805..282933,286175..286264,288023..288076,
FT                   288458..289672,290437..291127)
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, transcript
FT                   variant mCT189681"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT189681.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(272503..272601,272781..272884,273575..273686,
FT                   282805..282933,284434..284500,286175..286264,
FT                   288023..288076,288458..288520,289150..289283,
FT                   289580..289672,290437..290487,291317..291461,
FT                   291887..292626)
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, transcript
FT                   variant mCT172397"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT172397.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(<272509..272601,272781..272884,273575..273686,
FT                   282805..282933,286175..286180)
FT                   /codon_start=1
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT189681.0
FT                   protein_id=mCP110646.0 isoform=CRA_c"
FT                   /protein_id="EDL04666.1"
FT                   /translation="ATEAAPKALETVGRAPESEPVALAWGPPLYQTQFPIPLPSWAVSQ
FT                   SAPTLGTMFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQV
FT                   FDNTPAALDGTVAAGDEITGVNGKSIKGKTKVEVAKMIQEVKC"
FT   mRNA            join(272778..272849,289188..289283,289580..289672,
FT                   290437..290487,291317..291461,291887..292626)
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, transcript
FT                   variant mCT172399"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT172399.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(272844..272884,273575..273686,282805..282933,
FT                   284434..284500,286175..286264,288023..288076,
FT                   288458..288520,289150..289283,289580..289672,
FT                   290437..290487,291317..291461,291887..292158)
FT                   /codon_start=1
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT13974.2
FT                   protein_id=mCP10030.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q80VC8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR030798"
FT                   /db_xref="MGI:MGI:894645"
FT                   /db_xref="UniProtKB/TrEMBL:Q80VC8"
FT                   /protein_id="EDL04663.1"
FT                   /translation="MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCP
FT                   CLYIVQVFDNTPAALDGTVAAGDEITGVNGKSIKGKTKVEVAKMIQEVKGEVTIHYNKL
FT                   QADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELY
FT                   KGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGI
FT                   RLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALG
FT                   EPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVST
FT                   MSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGPNQGSFTDGEEEDEEEEDGAAREVSKD
FT                   ACGATGPTDKGGSWCDS"
FT   CDS             join(272844..272884,273575..273686,282805..282933,
FT                   284434..284500,286175..286264,288023..288076,
FT                   288458..288520,289150..289283,289580..289672,
FT                   290437..290487,291317..291461,291887..292158)
FT                   /codon_start=1
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT172397.0
FT                   protein_id=mCP95317.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q80VC8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR030798"
FT                   /db_xref="MGI:MGI:894645"
FT                   /db_xref="UniProtKB/TrEMBL:Q80VC8"
FT                   /protein_id="EDL04664.1"
FT                   /translation="MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCP
FT                   CLYIVQVFDNTPAALDGTVAAGDEITGVNGKSIKGKTKVEVAKMIQEVKGEVTIHYNKL
FT                   QADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLSRAILCNDGLVKRLEELERTAELY
FT                   KGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGI
FT                   RLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALG
FT                   EPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVST
FT                   MSKYYNDCYAVLRDADVFPIEVDLAHTTLAYGPNQGSFTDGEEEDEEEEDGAAREVSKD
FT                   ACGATGPTDKGGSWCDS"
FT   CDS             join(272844..272849,289188..289283,289580..289672,
FT                   290437..290487,291317..291461,291887..292158)
FT                   /codon_start=1
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT172399.0
FT                   protein_id=mCP95316.0 isoform=CRA_d"
FT                   /protein_id="EDL04667.1"
FT                   /translation="MFPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPMLTDLNTYLNK
FT                   AIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGNYEYRLILRC
FT                   RQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYAVLRDADVFP
FT                   IEVDLAHTTLAYGPNQGSFTDGEEEDEEEEDGAAREVSKDACGATGPTDKGGSWCDS"
FT   CDS             join(286210..286264,288023..288076,288458..288520,
FT                   289150..289283,289580..289672,290437..290487,
FT                   291317..291461,291887..292158)
FT                   /codon_start=1
FT                   /gene="Pick1"
FT                   /locus_tag="mCG_13134"
FT                   /product="protein interacting with C kinase 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG13134.2 transcript_id=mCT172398.0
FT                   protein_id=mCP95318.0 isoform=CRA_b"
FT                   /protein_id="EDL04665.1"
FT                   /translation="MSSGTADALGLSRAILCNDGLVKRLEELERTAELYKGMTEHTKNL
FT                   LRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKFADAHRSIEKFGIRLLKTIKPML
FT                   TDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIALGEPLYRVSTGN
FT                   YEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRFVSTMSKYYNDCYA
FT                   VLRDADVFPIEVDLAHTTLAYGPNQGSFTDGEEEDEEEEDGAAREVSKDACGATGPTDK
FT                   GGSWCDS"
FT   assembly_gap    287232..287268
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(294180..297927)
FT                   /gene="Slc16a8"
FT                   /locus_tag="mCG_13136"
FT                   /note="gene_id=mCG13136.1"
FT   mRNA            complement(join(294180..294646,295041..295808,
FT                   296017..296160,296760..296984,297123..297201,
FT                   297809..297927))
FT                   /gene="Slc16a8"
FT                   /locus_tag="mCG_13136"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 8"
FT                   /note="gene_id=mCG13136.1 transcript_id=mCT14005.1 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(294294..294646,295041..295808,
FT                   296017..296160,296760..296973))
FT                   /codon_start=1
FT                   /gene="Slc16a8"
FT                   /locus_tag="mCG_13136"
FT                   /product="solute carrier family 16 (monocarboxylic acid
FT                   transporters), member 8"
FT                   /note="gene_id=mCG13136.1 transcript_id=mCT14005.1
FT                   protein_id=mCP10054.1"
FT                   /db_xref="GOA:Q5UB50"
FT                   /db_xref="InterPro:IPR004743"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR030759"
FT                   /db_xref="MGI:MGI:1929519"
FT                   /db_xref="UniProtKB/TrEMBL:Q5UB50"
FT                   /protein_id="EDL04662.1"
FT                   /translation="MGAGGPRRGAGPPDGGWGWVVLGACFVVTGFAYGFPKAVSVFFRE
FT                   LKRDFGAGYSDTAWVSSIMLAMLYGTGPLSSILVTRFGCRPVMLAGGLLASAGMILASF
FT                   ASRLVELYLTAGVLTGLGLALNFQPSLIMLGLYFERRRPLANGLAAAGSPVFLSMLSPL
FT                   GQLLGERFGWRGGFLLFGGLLLHCCACGAVMRPPPGPPPRRDPSPHGGPARRRRLLDVA
FT                   VCTDRAFVVYVVTKFLMALGLFVPAILLVNYAKDAGVPDAEAAFLLSIVGFVDIVARPA
FT                   CGALAGLGRLRPHVPYLFSLALLANGLTDLISARARSYGTLVAFCIAFGLSYGMVGALQ
FT                   FEVLMATVGAPRFPSALGLVLLVEAVAVLIGPPSAGRLVDALKNYEIIFYLAGSEVALA
FT                   GVFMAVTTYCCLRCSKNISSGRSAEGGASDPEDVEAERDSEPMPASTEEPGSLEALEVL
FT                   SPRAGSPEQEPEEEAVPELDHESIGGHEARGQKA"
FT   gene            complement(301388..328953)
FT                   /gene="Baiap2l2"
FT                   /locus_tag="mCG_13152"
FT                   /note="gene_id=mCG13152.2"
FT   mRNA            complement(join(301388..301827,301979..302022,
FT                   302359..302566,302823..302945,304245..304458,
FT                   304573..304711,305058..305210,313758..313904,
FT                   314454..314570,314777..314848,326842..326903,
FT                   327423..327509,327991..328066,328754..328953))
FT                   /gene="Baiap2l2"
FT                   /locus_tag="mCG_13152"
FT                   /product="BAI1-associated protein 2-like 2"
FT                   /note="gene_id=mCG13152.2 transcript_id=mCT14020.2 created
FT                   on 18-SEP-2002"
FT   CDS             complement(join(301752..301827,301979..302022,
FT                   302359..302566,302823..302945,304245..304458,
FT                   304573..304711,305058..305210,313758..313904,
FT                   314454..314570,314777..314848,326842..326903,
FT                   327423..327509,327991..328066,328754..328804))
FT                   /codon_start=1
FT                   /gene="Baiap2l2"
FT                   /locus_tag="mCG_13152"
FT                   /product="BAI1-associated protein 2-like 2"
FT                   /note="gene_id=mCG13152.2 transcript_id=mCT14020.2
FT                   protein_id=mCP10033.2"
FT                   /db_xref="GOA:Q80Y61"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR013606"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR027681"
FT                   /db_xref="InterPro:IPR030126"
FT                   /db_xref="InterPro:IPR035593"
FT                   /db_xref="MGI:MGI:2652819"
FT                   /db_xref="PDB:3OK8"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q80Y61"
FT                   /protein_id="EDL04661.1"
FT                   /translation="MAPEMDQFYRSTMAIYKSIMEQFNPALENLVYLGNNYLRAFHALS
FT                   EAAEVYFSAIQKIGEQALQSSTSQILGEILVQMSDTQRHLNSDLEVVVQTFHGDLLQHM
FT                   EKNTKLDMQFIKDSCQHYEIEYRHRAANLEKCMSELWRMERKRDKNAREMKESVNRLHA
FT                   QMQAFVSESKRAAELEEKRRYRFLAEKHLLLSNTFLQFLGRARGMLQNRVLLWKEQSEA
FT                   SRSPSRAHSPGLLGPALGPPYPSGRLTPTRLDMPPRPLGEYGSPRSRHGSGSYGPEPAE
FT                   ARSASQLEPDRRSLPRTPSASSLYASSTQRSRSNSFGERLGGGGARRVRALVSHSEGAN
FT                   HTLLRFSAGDVVEVLVPEAQNGWLYGKLEGSSASGWFPEAYVKPVEEIPVNPMNPVAPM
FT                   NSMAPMSPMNELPSRSYPLRGSHSLDDLLDRPGNPTASSEYWDSQSRSRTPSRVPSRAP
FT                   SPAPPPLPSSRRSSVGSMGAATDVKKLMSWEQNPPELFPRGTNPFATVKLRPTVTNDRS
FT                   APLIR"
FT   assembly_gap    304829..304848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    321949..321968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    323444..323463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(329637..>371308)
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /note="gene_id=mCG128876.2"
FT   mRNA            complement(join(329637..330311,330526..330599,
FT                   331032..331199,332547..332701,332995..333131,
FT                   340719..340869,342452..342615,345787..345865,
FT                   348904..349012,349485..349667,350514..350610,
FT                   351870..352057,354995..355178,356150..356365,
FT                   360968..361217,371213..371279))
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /product="phospholipase A2, group VI, transcript variant
FT                   mCT130181"
FT                   /note="gene_id=mCG128876.2 transcript_id=mCT130181.1
FT                   created on 23-AUG-2002"
FT   mRNA            complement(join(329646..330311,330526..330599,
FT                   331032..331199,332547..332701,332995..333131,
FT                   340719..340869,342452..342615,345787..345865,
FT                   348904..349012,349485..349667,350514..350610,
FT                   351870..352057,354995..355178,356150..356365,
FT                   360968..361212,371209..>371308))
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /product="phospholipase A2, group VI, transcript variant
FT                   mCT189735"
FT                   /note="gene_id=mCG128876.2 transcript_id=mCT189735.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(329646..330311,330526..330599,
FT                   331032..331199,332547..332701,332995..333131,
FT                   340719..340869,342452..342615,345787..345865,
FT                   348904..349012,349485..349667,350514..350610,
FT                   351870..352057,354995..355178,356150..356365,
FT                   360968..361217,370759..>371221))
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /product="phospholipase A2, group VI, transcript variant
FT                   mCT189733"
FT                   /note="gene_id=mCG128876.2 transcript_id=mCT189733.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(329646..330311,330526..330599,
FT                   331032..331199,332547..332701,332995..333131,
FT                   340719..340869,342452..342615,345787..345865,
FT                   347473..347637,348904..349012,349485..349667,
FT                   350514..350610,351870..352057,354995..355178,
FT                   356150..356365,360968..361217,370759..>371088))
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /product="phospholipase A2, group VI, transcript variant
FT                   mCT189734"
FT                   /note="gene_id=mCG128876.2 transcript_id=mCT189734.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(330167..330311,330526..330599,
FT                   331032..331199,332547..332701,332995..333131,
FT                   340719..340869,342452..342615,345787..345865,
FT                   348904..349012,349485..349667,350514..350610,
FT                   351870..352057,354995..355178,356150..356365,
FT                   360968..361212,371209..>371301))
FT                   /codon_start=1
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /product="phospholipase A2, group VI, isoform CRA_c"
FT                   /note="gene_id=mCG128876.2 transcript_id=mCT189735.0
FT                   protein_id=mCP110688.0 isoform=CRA_c"
FT                   /protein_id="EDL04658.1"
FT                   /translation="RPFPKPPGAPVLNVVTWTLLRTGLVSATLRHRGRLGLSAAPQRMQ
FT                   FFGRLVNTLSSVTNLFSNPFRVKEVSLTDYVSSERVREEGQLILLQNVSNRTWDCVLVS
FT                   PRNPQSGFRLFQLESEADALVNFQQFSSQLPPFYESSVQVLHVEVLQHLTDLIRNHPSW
FT                   TVTHLAVELGIRECFHHSRIISCANSTENEEGCTPLHLACRKGDSEILVELVQYCHAQM
FT                   DVTDNKGETAFHYAVQGDNPQVLQLLGKNASAGLNQVNNQGLTPLHLACKMGKQEMVRV
FT                   LLLCNARCNIMGPGGFPIHTAMKFSQKGCAEMIISMDSNQIHSKDPRYGASPLHWAKNA
FT                   EMARMLLKRGCDVDSTSSSGNTALHVAVMRNRFDCVMVLLTYGANAGARGEHGNTPLHL
FT                   AMSKDNMEMVKALIVFGAEVDTPNDFGETPALIASKISKQLQDLMPISRARKPAFILSS
FT                   MRDEKRSHDHLLCLDGGGVKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAI
FT                   LHSKSMAYMRGVYFRMKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVKKPKVMLTGT
FT                   LSDRQPAELHLFRNYDAPEAVREPRCNQNINLKPPTQPADQLVWRAARSSGAAPTYFRP
FT                   NGRFLDGGLLANNPTLDAMTEIHEYNQDMIRKGQGNKVKKLSIVVSLGTGKSPQVPVTC
FT                   VDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQL
FT                   GSDIMLDEVSDAVLVNALWETEVYIYEHREEFQKLVQLLLSP"
FT   CDS             complement(join(330167..330311,330526..330599,
FT                   331032..331199,332547..332701,332995..333131,
FT                   340719..340869,342452..342615,345787..345865,
FT                   348904..349012,349485..349667,350514..350610,
FT                   351870..352057,354995..355178,356150..356365,
FT                   360968..361217,370759..>370792))
FT                   /codon_start=1
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /product="phospholipase A2, group VI, isoform CRA_a"
FT                   /note="gene_id=mCG128876.2 transcript_id=mCT189733.0
FT                   protein_id=mCP110686.0 isoform=CRA_a"
FT                   /protein_id="EDL04656.1"
FT                   /translation="PGSWRLGACDPEQRGRLGLSAAPQRMQFFGRLVNTLSSVTNLFSN
FT                   PFRVKEVSLTDYVSSERVREEGQLILLQNVSNRTWDCVLVSPRNPQSGFRLFQLESEAD
FT                   ALVNFQQFSSQLPPFYESSVQVLHVEVLQHLTDLIRNHPSWTVTHLAVELGIRECFHHS
FT                   RIISCANSTENEEGCTPLHLACRKGDSEILVELVQYCHAQMDVTDNKGETAFHYAVQGD
FT                   NPQVLQLLGKNASAGLNQVNNQGLTPLHLACKMGKQEMVRVLLLCNARCNIMGPGGFPI
FT                   HTAMKFSQKGCAEMIISMDSNQIHSKDPRYGASPLHWAKNAEMARMLLKRGCDVDSTSS
FT                   SGNTALHVAVMRNRFDCVMVLLTYGANAGARGEHGNTPLHLAMSKDNMEMVKALIVFGA
FT                   EVDTPNDFGETPALIASKISKQLQDLMPISRARKPAFILSSMRDEKRSHDHLLCLDGGG
FT                   VKGLVIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGVYFRMKD
FT                   EVFRGSRPYESGPLEEFLKREFGEHTKMTDVKKPKVMLTGTLSDRQPAELHLFRNYDAP
FT                   EAVREPRCNQNINLKPPTQPADQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDA
FT                   MTEIHEYNQDMIRKGQGNKVKKLSIVVSLGTGKSPQVPVTCVDVFRPSNPWELAKTVFG
FT                   AKELGKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGSDIMLDEVSDAVLVNAL
FT                   WETEVYIYEHREEFQKLVQLLLSP"
FT   CDS             complement(join(330167..330311,330526..330599,
FT                   331032..331199,332547..332701,332995..333131,
FT                   340719..340869,342452..342615,345787..345865,
FT                   347473..347637,348904..349012,349485..349667,
FT                   350514..350610,351870..352057,354995..355178,
FT                   356150..356365,360968..361217,370759..>370792))
FT                   /codon_start=1
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /product="phospholipase A2, group VI, isoform CRA_b"
FT                   /note="gene_id=mCG128876.2 transcript_id=mCT189734.0
FT                   protein_id=mCP110687.0 isoform=CRA_b"
FT                   /protein_id="EDL04657.1"
FT                   /translation="PGSWRLGACDPEQRGRLGLSAAPQRMQFFGRLVNTLSSVTNLFSN
FT                   PFRVKEVSLTDYVSSERVREEGQLILLQNVSNRTWDCVLVSPRNPQSGFRLFQLESEAD
FT                   ALVNFQQFSSQLPPFYESSVQVLHVEVLQHLTDLIRNHPSWTVTHLAVELGIRECFHHS
FT                   RIISCANSTENEEGCTPLHLACRKGDSEILVELVQYCHAQMDVTDNKGETAFHYAVQGD
FT                   NPQVLQLLGKNASAGLNQVNNQGLTPLHLACKMGKQEMVRVLLLCNARCNIMGPGGFPI
FT                   HTAMKFSQKGCAEMIISMDSNQIHSKDPRYGASPLHWAKNAEMARMLLKRGCDVDSTSS
FT                   SGNTALHVAVMRNRFDCVMVLLTYGANAGARGEHGNTPLHLAMSKDNMEMVKALIVFGA
FT                   EVDTPNDFGETPALIASKISKLITRKALLTLLKTVGADHHFPIIQGVSTEQGSAAATHP
FT                   LFSLDRTQPPAISLNNLELQDLMPISRARKPAFILSSMRDEKRSHDHLLCLDGGGVKGL
FT                   VIIQLLIAIEKASGVATKDLFDWVAGTSTGGILALAILHSKSMAYMRGVYFRMKDEVFR
FT                   GSRPYESGPLEEFLKREFGEHTKMTDVKKPKVMLTGTLSDRQPAELHLFRNYDAPEAVR
FT                   EPRCNQNINLKPPTQPADQLVWRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEI
FT                   HEYNQDMIRKGQGNKVKKLSIVVSLGTGKSPQVPVTCVDVFRPSNPWELAKTVFGAKEL
FT                   GKMVVDCCTDPDGRAVDRARAWCEMVGIQYFRLNPQLGSDIMLDEVSDAVLVNALWETE
FT                   VYIYEHREEFQKLVQLLLSP"
FT   CDS             complement(join(330167..330311,330526..330599,
FT                   331032..331199,332547..332701,332995..333131,
FT                   340719..340869,342452..342615,345787..345865,
FT                   348904..349012,349485..349667,350514..350610,
FT                   351870..352057,354995..355178,356150..356365,
FT                   360968..361176))
FT                   /codon_start=1
FT                   /gene="Pla2g6"
FT                   /locus_tag="mCG_128876"
FT                   /product="phospholipase A2, group VI, isoform CRA_d"
FT                   /note="gene_id=mCG128876.2 transcript_id=mCT130181.1
FT                   protein_id=mCP83561.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q3UN31"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1859152"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UN31"
FT                   /protein_id="EDL04659.1"
FT                   /translation="MQFFGRLVNTLSSVTNLFSNPFRVKEVSLTDYVSSERVREEGQLI
FT                   LLQNVSNRTWDCVLVSPRNPQSGFRLFQLESEADALVNFQQFSSQLPPFYESSVQVLHV
FT                   EVLQHLTDLIRNHPSWTVTHLAVELGIRECFHHSRIISCANSTENEEGCTPLHLACRKG
FT                   DSEILVELVQYCHAQMDVTDNKGETAFHYAVQGDNPQVLQLLGKNASAGLNQVNNQGLT
FT                   PLHLACKMGKQEMVRVLLLCNARCNIMGPGGFPIHTAMKFSQKGCAEMIISMDSNQIHS
FT                   KDPRYGASPLHWAKNAEMARMLLKRGCDVDSTSSSGNTALHVAVMRNRFDCVMVLLTYG
FT                   ANAGARGEHGNTPLHLAMSKDNMEMVKALIVFGAEVDTPNDFGETPALIASKISKQLQD
FT                   LMPISRARKPAFILSSMRDEKRSHDHLLCLDGGGVKGLVIIQLLIAIEKASGVATKDLF
FT                   DWVAGTSTGGILALAILHSKSMAYMRGVYFRMKDEVFRGSRPYESGPLEEFLKREFGEH
FT                   TKMTDVKKPKVMLTGTLSDRQPAELHLFRNYDAPEAVREPRCNQNINLKPPTQPADQLV
FT                   WRAARSSGAAPTYFRPNGRFLDGGLLANNPTLDAMTEIHEYNQDMIRKGQGNKVKKLSI
FT                   VVSLGTGKSPQVPVTCVDVFRPSNPWELAKTVFGAKELGKMVVDCCTDPDGRAVDRARA
FT                   WCEMVGIQYFRLNPQLGSDIMLDEVSDAVLVNALWETEVYIYEHREEFQKLVQLLLSP"
FT   assembly_gap    338107..338126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    348324..348391
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    356438..356457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            357400..359865
FT                   /locus_tag="mCG_147099"
FT                   /note="gene_id=mCG147099.0"
FT   mRNA            join(357400..357784,358510..359865)
FT                   /locus_tag="mCG_147099"
FT                   /product="mCG147099"
FT                   /note="gene_id=mCG147099.0 transcript_id=mCT187362.0
FT                   created on 13-JAN-2004"
FT   CDS             358865..359152
FT                   /codon_start=1
FT                   /locus_tag="mCG_147099"
FT                   /product="mCG147099"
FT                   /note="gene_id=mCG147099.0 transcript_id=mCT187362.0
FT                   protein_id=mCP108758.0"
FT                   /protein_id="EDL04660.1"
FT                   /translation="MAEGSHSVTAACHTEANANTTMALRSRKSMNLGEKLSPVNQGQCR
FT                   ELQRKGLEEPWPPCPALFISECWDRTSHQNDWAISLALTQEGESWVLLLF"
FT   assembly_gap    389023..389042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            390973..402535
FT                   /gene="Maff"
FT                   /locus_tag="mCG_13146"
FT                   /note="gene_id=mCG13146.1"
FT   mRNA            join(390973..391053,400266..400332,400720..402535)
FT                   /gene="Maff"
FT                   /locus_tag="mCG_13146"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   family, protein F (avian)"
FT                   /note="gene_id=mCG13146.1 transcript_id=mCT14014.1 created
FT                   on 23-AUG-2002"
FT   CDS             join(400297..400332,400720..401154)
FT                   /codon_start=1
FT                   /gene="Maff"
FT                   /locus_tag="mCG_13146"
FT                   /product="v-maf musculoaponeurotic fibrosarcoma oncogene
FT                   family, protein F (avian)"
FT                   /note="gene_id=mCG13146.1 transcript_id=mCT14014.1
FT                   protein_id=mCP10096.0"
FT                   /db_xref="GOA:Q3U0G5"
FT                   /db_xref="InterPro:IPR004826"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR008917"
FT                   /db_xref="InterPro:IPR024874"
FT                   /db_xref="InterPro:IPR033531"
FT                   /db_xref="MGI:MGI:96910"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U0G5"
FT                   /protein_id="EDL04655.1"
FT                   /translation="MAVDPLSSKALKVKRELSENTPHLSDEALMGLSVRELNRNLRGLS
FT                   AEEVTRLKQRRRTLKNRGYAASCRVKRVCQKEELQKQKSELEREVDKLARENAAMRLEL
FT                   DALRGKCEALQGFARSVAAARGPAALVAPASVITIVKSAPGPAPAADPAPCS"
FT   gene            complement(403983..449873)
FT                   /gene="4732495E13Rik"
FT                   /locus_tag="mCG_13159"
FT                   /note="gene_id=mCG13159.2"
FT   mRNA            complement(join(403983..406183,408583..408777,
FT                   409085..409254,409885..409976,412972..413047,
FT                   413200..413290,420342..420507,421759..422008,
FT                   449782..449873))
FT                   /gene="4732495E13Rik"
FT                   /locus_tag="mCG_13159"
FT                   /product="RIKEN cDNA 4732495E13, transcript variant
FT                   mCT14027"
FT                   /note="gene_id=mCG13159.2 transcript_id=mCT14027.2 created
FT                   on 18-SEP-2002"
FT   mRNA            complement(join(403983..406183,408583..408777,
FT                   409085..409254,409885..409976,412972..413047,
FT                   413200..413290,420342..420507,421759..422008,
FT                   449444..>449516))
FT                   /gene="4732495E13Rik"
FT                   /locus_tag="mCG_13159"
FT                   /product="RIKEN cDNA 4732495E13, transcript variant
FT                   mCT189769"
FT                   /note="gene_id=mCG13159.2 transcript_id=mCT189769.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(404002..406183,406956..406976,
FT                   408583..408777,409085..409254,409885..409976,
FT                   412972..413047,413200..413290,420342..420507,
FT                   421759..422008,449782..>449854))
FT                   /gene="4732495E13Rik"
FT                   /locus_tag="mCG_13159"
FT                   /product="RIKEN cDNA 4732495E13, transcript variant
FT                   mCT189768"
FT                   /note="gene_id=mCG13159.2 transcript_id=mCT189768.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(405942..406183,406956..406976,
FT                   408583..408777,409085..409254,409885..409976,
FT                   412972..413047,413200..413290,420342..420507,
FT                   421759..422008,449782..>449852))
FT                   /codon_start=1
FT                   /gene="4732495E13Rik"
FT                   /locus_tag="mCG_13159"
FT                   /product="RIKEN cDNA 4732495E13, isoform CRA_a"
FT                   /note="gene_id=mCG13159.2 transcript_id=mCT189768.0
FT                   protein_id=mCP110744.0 isoform=CRA_a"
FT                   /protein_id="EDL04652.1"
FT                   /translation="AAAEIPGCGAACSACSLQRHGLLRPARHSLHEILSGSLLLLGTMT
FT                   VRGAALAPDPASPTTTTASPSVSATPEGSPTAMEHPVFLMTTAAQAISGFFVWTALLIT
FT                   CHQIYMHLRCYSRPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEA
FT                   FVIYNFLSLCYEYLGGESAIMSEIRGKAIESSCMYGTCCLWGKTYSIGFLRFCKQATLQ
FT                   FCVVKPLMAVSTVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRE
FT                   LLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKINSARVSVGEGTVAAGYQDF
FT                   IICVEMFFAALALRHAFTYKVYADKRLDAQVLTYGPYGRCAPMKSISSSLKETMNPHDI
FT                   VQDAIHNFSPAYQQYTQQSTLEPGPTWRGGTHSLSRSHSLSGARDNEKTLLLSSDDEF"
FT   CDS             complement(join(405942..406183,408583..408777,
FT                   409085..409254,409885..409976,412972..413047,
FT                   413200..413290,420342..420507,421759..422008,
FT                   449444..>449514))
FT                   /codon_start=1
FT                   /gene="4732495E13Rik"
FT                   /locus_tag="mCG_13159"
FT                   /product="RIKEN cDNA 4732495E13, isoform CRA_b"
FT                   /note="gene_id=mCG13159.2 transcript_id=mCT189769.0
FT                   protein_id=mCP110745.0 isoform=CRA_b"
FT                   /protein_id="EDL04653.1"
FT                   /translation="ERGGETSVLSAVALTWPGGRPLRRPARHSLHEILSGSLLLLGTMT
FT                   VRGAALAPDPASPTTTTASPSVSATPEGSPTAMEHPVFLMTTAAQAISGFFVWTALLIT
FT                   CHQIYMHLRCYSRPNEQRHIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEA
FT                   FVIYNFLSLCYEYLGGESAIMSEIRGKAIESSCMYGTCCLWGKTYSIGFLRFCKQATLQ
FT                   FCVVKPLMAVSTVILQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRE
FT                   LLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKINSARVSVGEGTVAAGYQDF
FT                   IICVEMFFAALALRHAFTYKVYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHN
FT                   FSPAYQQYTQQSTLEPGPTWRGGTHSLSRSHSLSGARDNEKTLLLSSDDEF"
FT   CDS             complement(join(405942..406183,408583..408777,
FT                   409085..409254,409885..409976,412972..413047,
FT                   413200..413290,420342..420507,421759..421950))
FT                   /codon_start=1
FT                   /gene="4732495E13Rik"
FT                   /locus_tag="mCG_13159"
FT                   /product="RIKEN cDNA 4732495E13, isoform CRA_c"
FT                   /note="gene_id=mCG13159.2 transcript_id=mCT14027.2
FT                   protein_id=mCP10055.2 isoform=CRA_c"
FT                   /protein_id="EDL04654.1"
FT                   /translation="MTVRGAALAPDPASPTTTTASPSVSATPEGSPTAMEHPVFLMTTA
FT                   AQAISGFFVWTALLITCHQIYMHLRCYSRPNEQRHIVRILFIVPIYAFDSWLSLLFFTN
FT                   DQYYVYFGTVRDCYEAFVIYNFLSLCYEYLGGESAIMSEIRGKAIESSCMYGTCCLWGK
FT                   TYSIGFLRFCKQATLQFCVVKPLMAVSTVILQAFGKYRDGDFDVTSGYLYVTIIYNISV
FT                   SLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKINSA
FT                   RVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRCAPMKSISSSL
FT                   KETMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGTHSLSRSHSLSGARDNEKTL
FT                   LLSSDDEF"
FT   assembly_gap    427698..427717
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    431547..437154
FT                   /estimated_length=5608
FT                   /gap_type="unknown"
FT   assembly_gap    459809..459828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(464540..>488668)
FT                   /gene="Csnk1e"
FT                   /locus_tag="mCG_13148"
FT                   /note="gene_id=mCG13148.3"
FT   mRNA            complement(join(464540..465868,466586..466649,
FT                   467265..467404,467499..467691,471525..471673,
FT                   472185..472355,472944..473172,476390..476538,
FT                   476718..476828,485436..485519,488590..>488668))
FT                   /gene="Csnk1e"
FT                   /locus_tag="mCG_13148"
FT                   /product="casein kinase 1, epsilon, transcript variant
FT                   mCT189722"
FT                   /note="gene_id=mCG13148.3 transcript_id=mCT189722.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(464540..465868,466586..466649,
FT                   467265..467404,467499..467691,471525..471673,
FT                   472185..472355,472944..473172,476390..476538,
FT                   476718..476828,485436..485523,488590..488665))
FT                   /gene="Csnk1e"
FT                   /locus_tag="mCG_13148"
FT                   /product="casein kinase 1, epsilon, transcript variant
FT                   mCT14016"
FT                   /note="gene_id=mCG13148.3 transcript_id=mCT14016.2 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(466617..466649,467265..467404,
FT                   467499..467691,471525..471673,472185..472355,
FT                   472944..473172,476390..476538,476718..476828,
FT                   485436..>485514))
FT                   /codon_start=1
FT                   /gene="Csnk1e"
FT                   /locus_tag="mCG_13148"
FT                   /product="casein kinase 1, epsilon, isoform CRA_b"
FT                   /note="gene_id=mCG13148.3 transcript_id=mCT189722.0
FT                   protein_id=mCP110690.0 isoform=CRA_b"
FT                   /protein_id="EDL04651.1"
FT                   /translation="SMELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKT
FT                   KHPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLK
FT                   TVLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTH
FT                   QHIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATK
FT                   RQKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQ
FT                   GFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATAN
FT                   RLRSAAEPVASTPASRIQQTGNTSPRAISRADRERKVSMRLHRGAPANVSSSDLTGRQE
FT                   VSRLAASQTSVPFDHLGK"
FT   CDS             complement(join(466617..466649,467265..467404,
FT                   467499..467691,471525..471673,472185..472355,
FT                   472944..473172,476390..476538,476718..476828,
FT                   485436..485511))
FT                   /codon_start=1
FT                   /gene="Csnk1e"
FT                   /locus_tag="mCG_13148"
FT                   /product="casein kinase 1, epsilon, isoform CRA_a"
FT                   /note="gene_id=mCG13148.3 transcript_id=mCT14016.2
FT                   protein_id=mCP10098.2 isoform=CRA_a"
FT                   /protein_id="EDL04650.1"
FT                   /translation="MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTK
FT                   HPQLHIESKFYKMMQGGVGIPSIKWCGAEGDYNVMVMELLGPSLEDLFNFCSRKFSLKT
FT                   VLLLADQMISRIEYIHSKNFIHRDVKPDNFLMGLGKKGNLVYIIDFGLAKKYRDARTHQ
FT                   HIPYRENKNLTGTARYASINTHLGIEQSRRDDLESLGYVLMYFNLGSLPWQGLKAATKR
FT                   QKYERISEKKMSTPIEVLCKGYPSEFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQG
FT                   FSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANR
FT                   LRSAAEPVASTPASRIQQTGNTSPRAISRADRERKVSMRLHRGAPANVSSSDLTGRQEV
FT                   SRLAASQTSVPFDHLGK"
FT   assembly_gap    494368..494387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    508889..509937
FT                   /estimated_length=1049
FT                   /gap_type="unknown"
FT   assembly_gap    519810..519829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<531830..553050)
FT                   /gene="Kcnj4"
FT                   /locus_tag="mCG_49555"
FT                   /note="gene_id=mCG49555.1"
FT   mRNA            complement(join(<531830..533209,553031..553050))
FT                   /gene="Kcnj4"
FT                   /locus_tag="mCG_49555"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 4"
FT                   /note="gene_id=mCG49555.1 transcript_id=mCT49738.1 created
FT                   on 18-SEP-2002"
FT   CDS             complement(531830..533167)
FT                   /codon_start=1
FT                   /gene="Kcnj4"
FT                   /locus_tag="mCG_49555"
FT                   /product="potassium inwardly-rectifying channel, subfamily
FT                   J, member 4"
FT                   /note="gene_id=mCG49555.1 transcript_id=mCT49738.1
FT                   protein_id=mCP32097.0"
FT                   /db_xref="GOA:Q8R435"
FT                   /db_xref="InterPro:IPR003273"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="MGI:MGI:104743"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R435"
FT                   /protein_id="EDL04649.1"
FT                   /translation="MHGHNRNGQAHVPRRKRRNRFVKKNGQCNVYFANLSNKSQRYMAD
FT                   IFTTCVDTRWRYMLMIFSAAFLVSWLFFGLLFWCIAFFHGDLEASPSVPAAGGPGGNGG
FT                   ASPNAPKPCIMHVNGFLGAFLFSVETQTTIGYGFRCVTEECPLAVIAVVVQSIVGCVID
FT                   SFMIGTIMAKMARPKKRAQTLLFSHHAVISVRDGKLCLMWRVGNLRKSHIVEAHVRAQL
FT                   IKPYMTQEGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESE
FT                   DFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVVFEEKSHYKVDYSRFHKTYE
FT                   VAGTPCCSARELQESKITVLPAPPPPPSAFCYENELALMSQEEEEMEEEAAAAAAVAAG
FT                   LGLEAGSKEEAGIIRMLEFGSHLDLERMQAATLPLDNISYRRESAI"
FT   assembly_gap    540860..540879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    561369..561388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            564369..575381
FT                   /gene="Kdelr3"
FT                   /locus_tag="mCG_13118"
FT                   /note="gene_id=mCG13118.2"
FT   mRNA            join(564369..564560,570730..570830,572723..572881,
FT                   573586..573838,574991..575381)
FT                   /gene="Kdelr3"
FT                   /locus_tag="mCG_13118"
FT                   /product="KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum
FT                   protein retention receptor 3"
FT                   /note="gene_id=mCG13118.2 transcript_id=mCT13958.2 created
FT                   on 23-AUG-2002"
FT   CDS             join(564470..564560,570730..570830,572723..572881,
FT                   573586..573838,574991..575031)
FT                   /codon_start=1
FT                   /gene="Kdelr3"
FT                   /locus_tag="mCG_13118"
FT                   /product="KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum
FT                   protein retention receptor 3"
FT                   /note="gene_id=mCG13118.2 transcript_id=mCT13958.2
FT                   protein_id=mCP10068.2"
FT                   /protein_id="EDL04648.1"
FT                   /translation="MNVFRILGDLSHLLAMILLLVKIWRSKSCAGISGKSQILFALVFT
FT                   TRYLDLFSNFISIYNTVMKVVFLLCAYVTVYMIYWKFRKTFDIENDTFRLEFLLVPVTG
FT                   LSFLVNYSYTPMEVLWTFSIYLESVAILPQLFMISKTGEAETITTHYLFFLGLYRLLYL
FT                   ANWIRRYQTENFYDQISVVSGVVQTIFYCDFFYLYVTKVLKGKKLSLPVPV"
FT   gene            complement(575626..594727)
FT                   /gene="Ddx17"
FT                   /locus_tag="mCG_13126"
FT                   /note="gene_id=mCG13126.3"
FT   mRNA            complement(join(575626..577505,577656..578549,
FT                   579703..579945,583992..584051,585032..585093,
FT                   585470..585580,586594..586766,586853..587013,
FT                   587354..587495,588447..588512,589068..589201,
FT                   590454..590553,591666..591816,594152..594727))
FT                   /gene="Ddx17"
FT                   /locus_tag="mCG_13126"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 17,
FT                   transcript variant mCT13967"
FT                   /note="gene_id=mCG13126.3 transcript_id=mCT13967.3 created
FT                   on 23-APR-2004"
FT   mRNA            complement(join(575626..577505,577656..578549,
FT                   579703..580174))
FT                   /gene="Ddx17"
FT                   /locus_tag="mCG_13126"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 17,
FT                   transcript variant mCT194295"
FT                   /note="gene_id=mCG13126.3 transcript_id=mCT194295.0 created
FT                   on 23-APR-2004"
FT   assembly_gap    577506..577655
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   CDS             complement(join(578044..578549,579703..579945,
FT                   583992..584051,585032..585093,585470..585580,
FT                   586594..586766,586853..587013,587354..587495,
FT                   588447..588512,589068..589201,590454..590553,
FT                   591666..591816,594152..594201))
FT                   /codon_start=1
FT                   /gene="Ddx17"
FT                   /locus_tag="mCG_13126"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 17,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13126.3 transcript_id=mCT13967.3
FT                   protein_id=mCP10043.3 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U741"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1914290"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U741"
FT                   /protein_id="EDL04645.1"
FT                   /translation="MRGGGFGDRDRDRDRGGFGARGGSGLPPKKFGNPGERLRKKKWDL
FT                   SELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVM
FT                   DVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERG
FT                   DGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIAT
FT                   PGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP
FT                   KEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKEN
FT                   KTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA
FT                   SRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVL
FT                   EEANQAINPKLMQLVDHRGGGGGGGKGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDG
FT                   GRRDSTSYRDRSETDRASYANGSGYGSPNSAFGAQAGQYTYAQGTYGAAAYGTSGYTAQ
FT                   EYAAGTYGASSTASAGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQ
FT                   TAYQYPPPPPPPPPSRK"
FT   CDS             complement(join(578044..578549,579703..580009))
FT                   /codon_start=1
FT                   /gene="Ddx17"
FT                   /locus_tag="mCG_13126"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 17,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG13126.3 transcript_id=mCT194295.0
FT                   protein_id=mCP115324.0 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1914290"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K392"
FT                   /protein_id="EDL04647.1"
FT                   /translation="MSLPSLSLPHQPTQCLLIDVEDVEDVKFVINYDYPNSSEDYVHRI
FT                   GRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGKGG
FT                   RSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSTSYRDRSETDRASYANGSGYGSP
FT                   NSAFGAQAGQYTYAQGTYGAAAYGTSGYTAQEYAAGTYGASSTASAGRSSQSSSQQFSG
FT                   IGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK"
FT   mRNA            complement(join(582698..584051,585032..585093,
FT                   585470..585580,586594..586766,586853..587013,
FT                   587354..587495,588447..588512,589068..589201,
FT                   590454..590553,591666..591816,594152..594727))
FT                   /gene="Ddx17"
FT                   /locus_tag="mCG_13126"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 17,
FT                   transcript variant mCT172902"
FT                   /note="gene_id=mCG13126.3 transcript_id=mCT172902.1 created
FT                   on 23-APR-2004"
FT   CDS             complement(join(583978..584051,585032..585093,
FT                   585470..585580,586594..586766,586853..587013,
FT                   587354..587495,588447..588512,589068..589201,
FT                   590454..590553,591666..591816,594152..594201))
FT                   /codon_start=1
FT                   /gene="Ddx17"
FT                   /locus_tag="mCG_13126"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 17,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13126.3 transcript_id=mCT172902.1
FT                   protein_id=mCP95821.1 isoform=CRA_b"
FT                   /protein_id="EDL04646.1"
FT                   /translation="MRGGGFGDRDRDRDRGGFGARGGSGLPPKKFGNPGERLRKKKWDL
FT                   SELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVM
FT                   DVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERG
FT                   DGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIAT
FT                   PGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWP
FT                   KEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKEN
FT                   KTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVA
FT                   SRGLGLYR"
FT   assembly_gap    599959..599978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(609358..>654266)
FT                   /gene="Dmc1h"
FT                   /locus_tag="mCG_13155"
FT                   /note="gene_id=mCG13155.2"
FT   mRNA            complement(join(609358..610440,616509..616625,
FT                   632208..632268,632751..632865,632987..633060,
FT                   633558..633649,637935..638007,640784..640825,
FT                   642310..642362,645431..645513,649206..649352,
FT                   650677..650721,651561..651644,654128..654250))
FT                   /gene="Dmc1h"
FT                   /locus_tag="mCG_13155"
FT                   /product="disrupted meiotic cDNA 1 homolog, transcript
FT                   variant mCT14023"
FT                   /note="gene_id=mCG13155.2 transcript_id=mCT14023.1 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(609467..610440,616509..616625,
FT                   632208..632268,632751..632865,632987..633060,
FT                   640784..640825,642310..642362,645431..645513,
FT                   649206..649352,650677..650721,651561..651644,
FT                   654128..>654266))
FT                   /gene="Dmc1h"
FT                   /locus_tag="mCG_13155"
FT                   /product="disrupted meiotic cDNA 1 homolog, transcript
FT                   variant mCT189762"
FT                   /note="gene_id=mCG13155.2 transcript_id=mCT189762.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(610371..610440,616509..616625,
FT                   632208..632268,632751..632865,632987..633060,
FT                   640784..640825,642310..642362,645431..645513,
FT                   649206..649352,650677..650721,651561..>651638))
FT                   /codon_start=1
FT                   /gene="Dmc1h"
FT                   /locus_tag="mCG_13155"
FT                   /product="disrupted meiotic cDNA 1 homolog, isoform CRA_b"
FT                   /note="gene_id=mCG13155.2 transcript_id=mCT189762.0
FT                   protein_id=mCP110743.0 isoform=CRA_b"
FT                   /protein_id="EDL04644.1"
FT                   /translation="LFYCRSPFNMKEDQVVQEESGFQDDEESLFQDIDLLQKHGINMAD
FT                   IKKLKSVGICTIKGIQMTTRRALCNVKGLSEAKVEKIKEAANKLIEPGFLTAFQYSERR
FT                   KMVFHITTGSQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCGEHQMELLDYVAAK
FT                   FHEEAGIFKLLIIDSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTN
FT                   QMTADPGATMTFQADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEAT
FT                   FAITAGGIGDAKE"
FT   CDS             complement(join(610371..610440,616509..616625,
FT                   632208..632268,632751..632865,632987..633060,
FT                   633558..633649,637935..638007,640784..640825,
FT                   642310..642362,645431..645513,649206..649352,
FT                   650677..650721,651561..651611))
FT                   /codon_start=1
FT                   /gene="Dmc1h"
FT                   /locus_tag="mCG_13155"
FT                   /product="disrupted meiotic cDNA 1 homolog, isoform CRA_a"
FT                   /note="gene_id=mCG13155.2 transcript_id=mCT14023.1
FT                   protein_id=mCP10025.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q14AN8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011940"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="MGI:MGI:105393"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AN8"
FT                   /protein_id="EDL04643.1"
FT                   /translation="MKEDQVVQEESGFQDDEESLFQDIDLLQKHGINMADIKKLKSVGI
FT                   CTIKGIQMTTRRALCNVKGLSEAKVEKIKEAANKLIEPGFLTAFQYSERRKMVFHITTG
FT                   SQEFDKLLGGGIESMAITEAFGEFRTGKTQLSHTLCVTAQLPGTGGYSGGKIIFIDTEN
FT                   TFRPDRLRDIADRFNVDHEAVLDNVLYARAYTSEHQMELLDYVAAKFHEEAGIFKLLII
FT                   DSIMALFRVDFSGRGELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQ
FT                   ADPKKPIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIGDAKE
FT                   "
FT   assembly_gap    634836..634855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    636034..636053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    644930..645049
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    655980..656122
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    660799..660818
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(661306..707612)
FT                   /locus_tag="mCG_128902"
FT                   /note="gene_id=mCG128902.0"
FT   mRNA            complement(join(661306..661621,664407..664535,
FT                   666743..666880,669754..669911,672511..672663,
FT                   675291..675385,679103..679196,683141..683223,
FT                   685757..685864,686092..686215,689079..689183,
FT                   689719..689820,691191..691337,692369..692448,
FT                   693033..693102,697770..697852,698671..698894,
FT                   707496..707612))
FT                   /locus_tag="mCG_128902"
FT                   /product="mCG128902"
FT                   /note="gene_id=mCG128902.0 transcript_id=mCT130207.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(join(661549..661621,664407..664535,
FT                   666743..666880,669754..669911,672511..672663,
FT                   675291..675385,679103..679196,683141..683223,
FT                   685757..685864,686092..686215,689079..689183,
FT                   689719..689820,691191..691337,692369..692448,
FT                   693033..693102,697770..697852,698671..698794))
FT                   /codon_start=1
FT                   /locus_tag="mCG_128902"
FT                   /product="mCG128902"
FT                   /note="gene_id=mCG128902.0 transcript_id=mCT130207.1
FT                   protein_id=mCP83644.1"
FT                   /protein_id="EDL04642.1"
FT                   /translation="MDIINVNALPIIPLDERLVVSANVRTVLEDALRKRMQGSPPTCII
FT                   GSMSQVNQRIMEVELGSSLMISTLAIEDYELEKKSLREKTHGSPGDKVKKQKEEPPISC
FT                   QGSELRNARVLPTKRKTADKNLLAELHEHPPFDEMKPNKLPNGVDFCDMVGNVIRSEKN
FT                   PLSGKSYCSDRELEKFLCSPFLAAMWLDSFWWLFHERYQPDKEIQKKLFDRIARNYASL
FT                   LFKMCRSHYEEALLKRLSSLLSKAMYTSFCCCFPQSWFNTHEFKSEICNTMNLWVSGMY
FT                   PCLQSYNNWDYSELDPERFRQEELMLQSSRLLKAREFTLFTCKKSSIQQIEQKHTKFHN
FT                   LVGLLKASHSKVMKEKELSNKTTEESYRCRGMKDQNIPTLLSRKATKQVKQISHVRACM
FT                   DTFVKTSHPACKSPELTSNQFNLYGRSPLMTYFFLNYSQLQLTGQDLLVSRREKTEICT
FT                   DSAMTYADIIQLVTKNMEIRKKKLRQLDQMHENEWNCFNNYLTELQENFERELEIINKK
FT                   EREKRKDKNRVVSSTSLFESSGKKSKGNKQRETAFLSRKKKKEVEERPKGFYSPFSFQN
FT                   SMDVDNNSLGLKSPYRIKSPSSEGSSSISTIKQDMLFQLSPSSME"
FT   assembly_gap    694273..694486
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   gene            708004..716454
FT                   /gene="Pgea1"
FT                   /locus_tag="mCG_13149"
FT                   /note="gene_id=mCG13149.1"
FT   mRNA            join(708004..708108,710184..710337,714434..714539,
FT                   714619..714737,715776..716454)
FT                   /gene="Pgea1"
FT                   /locus_tag="mCG_13149"
FT                   /product="PKD2 interactor, golgi and endoplasmic reticulum
FT                   associated 1"
FT                   /note="gene_id=mCG13149.1 transcript_id=mCT14017.2 created
FT                   on 28-AUG-2002"
FT   CDS             join(710260..710337,714434..714539,714619..714737,
FT                   715776..715856)
FT                   /codon_start=1
FT                   /gene="Pgea1"
FT                   /locus_tag="mCG_13149"
FT                   /product="PKD2 interactor, golgi and endoplasmic reticulum
FT                   associated 1"
FT                   /note="gene_id=mCG13149.1 transcript_id=mCT14017.2
FT                   protein_id=mCP10110.1"
FT                   /protein_id="EDL04641.1"
FT                   /translation="MPLFGSIFSPKKTPPRKSASLSNLHSLDRSTRELELGLDYGTPTM
FT                   NLAGQSLKFENGQWVADSVISGGVDRRETQRLRKRNQQLEEENNLLRLKVDILLDMLSE
FT                   TTAESHLKDKELDELKVTNRRRK"
FT   gene            719667..722176
FT                   /gene="Tomm22"
FT                   /locus_tag="mCG_13145"
FT                   /note="gene_id=mCG13145.1"
FT   mRNA            join(719667..719806,719971..720089,720487..720604,
FT                   720814..722176)
FT                   /gene="Tomm22"
FT                   /locus_tag="mCG_13145"
FT                   /product="translocase of outer mitochondrial membrane 22
FT                   homolog (yeast)"
FT                   /note="gene_id=mCG13145.1 transcript_id=mCT14013.1 created
FT                   on 28-AUG-2002"
FT   CDS             join(719690..719806,719971..720089,720487..720604,
FT                   720814..720888)
FT                   /codon_start=1
FT                   /gene="Tomm22"
FT                   /locus_tag="mCG_13145"
FT                   /product="translocase of outer mitochondrial membrane 22
FT                   homolog (yeast)"
FT                   /note="gene_id=mCG13145.1 transcript_id=mCT14013.1
FT                   protein_id=mCP10094.2"
FT                   /protein_id="EDL04640.1"
FT                   /translation="MAAAVAAAGAGEPLSPEELLPKAEAEKAEEELEEDDDDELDETLS
FT                   ERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETE
FT                   KLQMEQQQQLQQRQILLGPNTGLSGGMPGALPPLPGKM"
FT   gene            complement(722855..736492)
FT                   /gene="Josd1"
FT                   /locus_tag="mCG_13128"
FT                   /note="gene_id=mCG13128.1"
FT   mRNA            complement(join(722855..724784,725702..725896,
FT                   726004..726132,735347..736223,736268..736492))
FT                   /gene="Josd1"
FT                   /locus_tag="mCG_13128"
FT                   /product="Josephin domain containing 1"
FT                   /note="gene_id=mCG13128.1 transcript_id=mCT13968.2 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(724685..724784,725702..725896,
FT                   726004..726132,735347..735531))
FT                   /codon_start=1
FT                   /gene="Josd1"
FT                   /locus_tag="mCG_13128"
FT                   /product="Josephin domain containing 1"
FT                   /note="gene_id=mCG13128.1 transcript_id=mCT13968.2
FT                   protein_id=mCP10066.1"
FT                   /protein_id="EDL04639.1"
FT                   /translation="MSCVPWKGDKAKAESSDLPQAAPPQIYHEKQRRELCALHALNNVF
FT                   QDSNAFTRETLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKR
FT                   RDVGVIALTNVMGFIMNLPSSLCWGPLKLPLKRQHWICVREVGGAYYNLDSKLKMPEWI
FT                   GGESELRKFLKYHLRGKNCELLLVVPEEVEAHQSWRADV"
FT   assembly_gap    736227..736246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            739490..763119
FT                   /gene="Gtpbp1"
FT                   /locus_tag="mCG_13156"
FT                   /note="gene_id=mCG13156.2"
FT   mRNA            join(739490..739721,742779..742890,749373..749553,
FT                   750076..750424,754478..754601,755746..755860,
FT                   758229..758373,758468..758650,759365..759500,
FT                   759977..760155,761435..761635,762417..763119)
FT                   /gene="Gtpbp1"
FT                   /locus_tag="mCG_13156"
FT                   /product="GTP binding protein 1"
FT                   /note="gene_id=mCG13156.2 transcript_id=mCT14024.2 created
FT                   on 23-AUG-2002"
FT   CDS             join(739530..739721,742779..742890,749373..749553,
FT                   750076..750424,754478..754601,755746..755860,
FT                   758229..758373,758468..758650,759365..759500,
FT                   759977..760155,761435..761635,762417..762506)
FT                   /codon_start=1
FT                   /gene="Gtpbp1"
FT                   /locus_tag="mCG_13156"
FT                   /product="GTP binding protein 1"
FT                   /note="gene_id=mCG13156.2 transcript_id=mCT14024.2
FT                   protein_id=mCP10044.2"
FT                   /protein_id="EDL04638.1"
FT                   /translation="MAAERSRSPVDSPVPASMFAPEPSSPGAARAAAAAARLHGGFDSD
FT                   CSEDGEALNGEPELDLTSKLVLVSPTSEQYDSLLRQMWERMDEGCGETIYVIGQGSDGT
FT                   EYGLSEADMEASYATVKSMAEQIEADVILLRERQEAGGRVRDYLVRKRVGDNDFLEVRV
FT                   AVVGNVDAGKSTLLGVLTHGELDNGRGFARQKLFRHKHEIESGRTSSVGNDILGFDSEG
FT                   NVVNKPDSHGGSLEWTKICEKSSKVITFIDLAGHEKYLKTTVFGMTGHLPDFCMLMVGS
FT                   NAGIVGMTKEHLGLALALNVPVFVVVTKIDMCPANILQETLKLLQRLLKSPGCRKIPVL
FT                   VQSKDDVIVTASNFSSERMCPIFQISNVTGENLDLLKMFLNLLSPRTSYREEEPAEFQI
FT                   DDTYSVPGVGTVVSGTTLRGLIKLNDTLLLGPDPLGNFLSIAVKSIHRKRMPVKEVRGG
FT                   QTASFALKKIKRSSIRKGMVMVSPRLNPQASWEFEAEILVLHHPTTISPRYQAMVHCGS
FT                   IRQTATILSMDKDCLRTGDKATVHFRFIKTPEYLHIDQRLVFREGRTKAVGTITKLLQT
FT                   TNNSPMNSKPQQIKMQSTKKGPLSKREEGGPCGVPAAGGPPTGDEASSLGTAQAASTSG
FT                   LQPQPKPSSGGRRRGGQRHKVKSGACVTPASGC"
FT   gene            complement(766524..784700)
FT                   /gene="Unc84b"
FT                   /locus_tag="mCG_128891"
FT                   /note="gene_id=mCG128891.1"
FT   mRNA            complement(join(766524..766720,771537..771580,
FT                   771985..772062,772594..772848,776308..776435,
FT                   778046..778125,779238..779331,780686..780826,
FT                   780986..781176,781887..782047,784506..784672))
FT                   /gene="Unc84b"
FT                   /locus_tag="mCG_128891"
FT                   /product="unc-84 homolog B (C. elegans), transcript variant
FT                   mCT179826"
FT                   /note="gene_id=mCG128891.1 transcript_id=mCT179826.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(766666..766720,771537..771580,
FT                   771985..772062,772594..772848,776308..776435,
FT                   778046..778125,779238..779331,780686..780826,
FT                   780986..781176,781887..782011))
FT                   /codon_start=1
FT                   /gene="Unc84b"
FT                   /locus_tag="mCG_128891"
FT                   /product="unc-84 homolog B (C. elegans), isoform CRA_b"
FT                   /note="gene_id=mCG128891.1 transcript_id=mCT179826.0
FT                   protein_id=mCP102748.0 isoform=CRA_b"
FT                   /protein_id="EDL04636.1"
FT                   /translation="MSRRSQRLTRYSQDDNDGGSSSSGASSVAGSQGTVFKDSPLRTLK
FT                   RKSSNMKHLSPAPQLGPSSDSHTSYYSESVVRESYIGSPRAVSLARSALLDDHLHSEPY
FT                   WSGDLRGRRRRGTGGSESSKANGLTAESKASEDFFGSSSGYSSEDDLAGRLFGLLYWWI
FT                   GTTWYRLTTAASLLDVFVLTRSRHFSLNLKSFLWFLLLLLLLTGLTYGAWHFYPLGLQT
FT                   LQPAVVSWWAAKESRKQPEVWESRDASQHFQAEQRVLSRVHSLERRLEALAADFSSNWQ
FT                   KEAIRLERLELRQGAAGHGGGSSLSHEDALSLLEGLVSRREATLKEDLRRDTVAHIQEE
FT                   LATLRAEHHQDSEDLFKKIVQASQESEARVQQLKTEWKSSMEGAKRSCKAARLVFG"
FT   assembly_gap    766949..766994
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   mRNA            complement(join(766996..768067,769049..769141,
FT                   769298..769465,769558..769673,770023..770107,
FT                   770370..770591,770920..771085,771537..771580,
FT                   771985..772062,772594..772848,776308..776435,
FT                   778046..778119,779238..779331,779645..779740,
FT                   780686..780826,780986..781176,781887..782047,
FT                   784506..784700))
FT                   /gene="Unc84b"
FT                   /locus_tag="mCG_128891"
FT                   /product="unc-84 homolog B (C. elegans), transcript variant
FT                   mCT130196"
FT                   /note="gene_id=mCG128891.1 transcript_id=mCT130196.1
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(767954..768067,769049..769141,
FT                   769298..769465,769558..769673,770023..770107,
FT                   770370..770591,770920..771085,771537..771580,
FT                   771985..772062,772594..772848,776308..776435,
FT                   778046..778119,779238..779331,779645..779740,
FT                   780686..780826,780986..781176,781887..782011))
FT                   /codon_start=1
FT                   /gene="Unc84b"
FT                   /locus_tag="mCG_128891"
FT                   /product="unc-84 homolog B (C. elegans), isoform CRA_a"
FT                   /note="gene_id=mCG128891.1 transcript_id=mCT130196.1
FT                   protein_id=mCP83588.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BJS4"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="InterPro:IPR030272"
FT                   /db_xref="MGI:MGI:2443011"
FT                   /db_xref="PDB:5ED8"
FT                   /db_xref="PDB:5ED9"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BJS4"
FT                   /protein_id="EDL04635.1"
FT                   /translation="MSRRSQRLTRYSQDDNDGGSSSSGASSVAGSQGTVFKDSPLRTLK
FT                   RKSSNMKHLSPAPQLGPSSDSHTSYYSESVVRESYIGSPRAVSLARSALLDDHLHSEPY
FT                   WSGDLRGRRRRGTGGSESSKANGLTAESKASEDFFGSSSGYSSEDDLAGYTDSDQHSSG
FT                   SRLRSAASRAGSFVWTLVTFPGRLFGLLYWWIGTTWYRLTTAASLLDVFVLTRHFSLNL
FT                   KSFLWFLLLLLLLTGLTYGAWHFYPLGLQTLQPAVVSWWAAKESRKQPEVWESRDASQH
FT                   FQAEQRVLSRVHSLERRLEALAADFSSNWQKEAIRLERLELRQGAAGHGGGSSLSHEDA
FT                   LSLLEGLVSRREATLKEDLRRDTVAHIQEELATLRAEHHQDSEDLFKKIVQASQESEAR
FT                   VQQLKTEWKSMTQEAFQESSVKELGRLEAQLASLRQELAALTLKQNSVADEVGLLPQKI
FT                   QAARADVESQFPDWIRQFLLGDRGARSGLLQRDEMHAQLQELENKILTKMAEMQGKSAR
FT                   EAAASLGQILQKEGIVGVTEEQVHRIVKQALQRYSEDRIGMVDYALESGGASVISTRCS
FT                   ETYETKTALLSLFGIPLWYHSQSPRVILQPDVHPGNCWAFQGPQGFAVVRLSARIRPTA
FT                   VTLEHVPKALSPNSTISSAPKDFAIFGFDEDLQQEGTLLGTFAYDQDGEPIQTFYFQAS
FT                   KMATYQVVELRILTNWGHPEYTCIYRFRVHGEPAH"
FT   mRNA            complement(join(772117..772848,776308..776419,
FT                   779240..779331,779645..779740,780686..780826,
FT                   780986..781176,781887..782047,784506..784672))
FT                   /gene="Unc84b"
FT                   /locus_tag="mCG_128891"
FT                   /product="unc-84 homolog B (C. elegans), transcript variant
FT                   mCT179827"
FT                   /note="gene_id=mCG128891.1 transcript_id=mCT179827.0
FT                   created on 04-FEB-2003"
FT   CDS             complement(join(772844..772848,776308..776419,
FT                   779240..779331,779645..779740,780686..780826,
FT                   780986..781176,781887..782011))
FT                   /codon_start=1
FT                   /gene="Unc84b"
FT                   /locus_tag="mCG_128891"
FT                   /product="unc-84 homolog B (C. elegans), isoform CRA_c"
FT                   /note="gene_id=mCG128891.1 transcript_id=mCT179827.0
FT                   protein_id=mCP102749.0 isoform=CRA_c"
FT                   /protein_id="EDL04637.1"
FT                   /translation="MSRRSQRLTRYSQDDNDGGSSSSGASSVAGSQGTVFKDSPLRTLK
FT                   RKSSNMKHLSPAPQLGPSSDSHTSYYSESVVRESYIGSPRAVSLARSALLDDHLHSEPY
FT                   WSGDLRGRRRRGTGGSESSKANGLTAESKASEDFFGSSSGYSSEDDLAGYTDSDQHSSG
FT                   SRLRSAASRAGSFVWTLVTFPGRLFGLLYWWIGTTWYRLTTAASLLDVFVLTPLRAADI
FT                   ATRCGLLVGSKREQEAARGVGIQRRLPALPG"
FT   assembly_gap    784709..784728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(803611..808014)
FT                   /gene="Dnalc4"
FT                   /locus_tag="mCG_11515"
FT                   /note="gene_id=mCG11515.2"
FT   mRNA            complement(join(803611..804682,805667..805750,
FT                   806973..807178,807944..808014))
FT                   /gene="Dnalc4"
FT                   /locus_tag="mCG_11515"
FT                   /product="dynein, axonemal, light chain 4, transcript
FT                   variant mCT12096"
FT                   /note="gene_id=mCG11515.2 transcript_id=mCT12096.2 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(803626..804204,804584..804682,
FT                   805667..805750,806973..807178,807944..808010))
FT                   /gene="Dnalc4"
FT                   /locus_tag="mCG_11515"
FT                   /product="dynein, axonemal, light chain 4, transcript
FT                   variant mCT172391"
FT                   /note="gene_id=mCG11515.2 transcript_id=mCT172391.0 created
FT                   on 23-AUG-2002"
FT   mRNA            complement(join(803668..804682,806973..807182))
FT                   /gene="Dnalc4"
FT                   /locus_tag="mCG_11515"
FT                   /product="dynein, axonemal, light chain 4, transcript
FT                   variant mCT172390"
FT                   /note="gene_id=mCG11515.2 transcript_id=mCT172390.0 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(804037..804204,804584..804682,
FT                   805667..805750,806973..807041))
FT                   /codon_start=1
FT                   /gene="Dnalc4"
FT                   /locus_tag="mCG_11515"
FT                   /product="dynein, axonemal, light chain 4, isoform CRA_c"
FT                   /note="gene_id=mCG11515.2 transcript_id=mCT172391.0
FT                   protein_id=mCP95309.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q8CDT8"
FT                   /db_xref="InterPro:IPR001372"
FT                   /db_xref="MGI:MGI:1859217"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CDT8"
FT                   /protein_id="EDL04634.1"
FT                   /translation="MGETEGKKEEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEK
FT                   FSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEPQSPSAPRTAGKYLLPLLLV
FT                   AMWNQPETPLMRHRARLSFSLGKEFPLPFPSLTRD"
FT   CDS             complement(join(804518..804682,806973..807041))
FT                   /codon_start=1
FT                   /gene="Dnalc4"
FT                   /locus_tag="mCG_11515"
FT                   /product="dynein, axonemal, light chain 4, isoform CRA_b"
FT                   /note="gene_id=mCG11515.2 transcript_id=mCT172390.0
FT                   protein_id=mCP95310.0 isoform=CRA_b"
FT                   /protein_id="EDL04633.1"
FT                   /translation="MGETEGKKEEADYKRLQTFPLVRSAAKMIKETMDKKFGSSWHVVI
FT                   GEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS"
FT   CDS             complement(join(804518..804682,805667..805750,
FT                   806973..807041))
FT                   /codon_start=1
FT                   /gene="Dnalc4"
FT                   /locus_tag="mCG_11515"
FT                   /product="dynein, axonemal, light chain 4, isoform CRA_a"
FT                   /note="gene_id=mCG11515.2 transcript_id=mCT12096.2
FT                   protein_id=mCP10038.1 isoform=CRA_a"
FT                   /protein_id="EDL04632.1"
FT                   /translation="MGETEGKKEEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEK
FT                   FSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKC
FT                   S"
FT   assembly_gap    825065..825696
FT                   /estimated_length=632
FT                   /gap_type="unknown"
FT   gene            complement(831992..847248)
FT                   /locus_tag="mCG_123838"
FT                   /note="gene_id=mCG123838.0"
FT   mRNA            complement(join(831992..832502,832852..833031,
FT                   835205..835452,836851..837070,846532..847248))
FT                   /locus_tag="mCG_123838"
FT                   /product="mCG123838, transcript variant mCT125074"
FT                   /note="gene_id=mCG123838.0 transcript_id=mCT125074.0
FT                   created on 23-AUG-2002"
FT   mRNA            complement(join(832185..832502,832852..833031,
FT                   835205..835452,836851..837070,846532..846901,
FT                   847126..>847196))
FT                   /locus_tag="mCG_123838"
FT                   /product="mCG123838, transcript variant mCT189649"
FT                   /note="gene_id=mCG123838.0 transcript_id=mCT189649.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(832278..832502,832852..833031,
FT                   835205..835452,836851..837070,846532..846901,
FT                   847126..>847136))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123838"
FT                   /product="mCG123838, isoform CRA_a"
FT                   /note="gene_id=mCG123838.0 transcript_id=mCT189649.0
FT                   protein_id=mCP110643.0 isoform=CRA_a"
FT                   /protein_id="EDL04630.1"
FT                   /translation="SSWPVFPPPPVPLLSRFLCTPLAAACPSGAEQGDAAGERAELLLL
FT                   QSTAEQLRQTALQQEARIRADRDTIRELTGKLGRCESGLPRGLQDAGPRRDTMADGAWD
FT                   SPALLLELEDAVRALRDRIERIEQELPARGNLSSAPAPAMPTALHSKMDELEGQLLAKV
FT                   LALEKERAALSHGSHQQRQEVEKELNALQGRVAELEHGSSAYSPPDAFKVSIPIRNNYM
FT                   YARVRKALPELYAFTACMWLRSRSGGSGQGTPFSYSVPGQANEIVLLEAGLEPMELLIN
FT                   DKVAQLPLSLKDSNWHHICISWTTRDGLWSAYQDGELRGSGENLAAWHPIKPHGILILG
FT                   QEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGMANCTGPLMGNVLPWEDKLVEA
FT                   FGGAKKAAFDVCKGRAKA"
FT   CDS             complement(join(832278..832502,832852..833031,
FT                   835205..835452,836851..837070,846532..847107))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123838"
FT                   /product="mCG123838, isoform CRA_b"
FT                   /note="gene_id=mCG123838.0 transcript_id=mCT125074.0
FT                   protein_id=mCP83056.1 isoform=CRA_b"
FT                   /protein_id="EDL04631.1"
FT                   /translation="MLAFLGAVICIIASVPLAASPARALPGGTDNASAASAAGGSGPQR
FT                   SLSALHSAGGSAGPSVLPGEPAASVFPPPPVPLLSRFLCTPLAAACPSGAEQGDAAGER
FT                   AELLLLQSTAEQLRQTALQQEARIRADRDTIRELTGKLGRCESGLPRGLQDAGPRRDTM
FT                   ADGAWDSPALLLELEDAVRALRDRIERIEQELPARGNLSSAPAPAMPTALHSKMDELEG
FT                   QLLAKVLALEKERAALSHGSHQQRQEVEKELNALQGRVAELEHGSSAYSPPDAFKVSIP
FT                   IRNNYMYARVRKALPELYAFTACMWLRSRSGGSGQGTPFSYSVPGQANEIVLLEAGLEP
FT                   MELLINDKVAQLPLSLKDSNWHHICISWTTRDGLWSAYQDGELRGSGENLAAWHPIKPH
FT                   GILILGQEQDTLGGRFDATQAFVGDIAQFNLWDHALTPAQVLGMANCTGPLMGNVLPWE
FT                   DKLVEAFGGAKKAAFDVCKGRAKA"
FT   assembly_gap    855327..855529
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   gene            complement(868705..876854)
FT                   /locus_tag="mCG_11530"
FT                   /note="gene_id=mCG11530.3"
FT   mRNA            complement(join(868705..871529,876126..876192,
FT                   876316..876381,876529..876572,876757..>876852))
FT                   /locus_tag="mCG_11530"
FT                   /product="mCG11530, transcript variant mCT189682"
FT                   /note="gene_id=mCG11530.3 transcript_id=mCT189682.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(868722..871583,876126..876192,
FT                   876316..876381,876529..876572,876757..876854))
FT                   /locus_tag="mCG_11530"
FT                   /product="mCG11530, transcript variant mCT12111"
FT                   /note="gene_id=mCG11530.3 transcript_id=mCT12111.2 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(870585..871529,876126..876192,
FT                   876316..876381,876529..876572,876757..>876852))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11530"
FT                   /product="mCG11530, isoform CRA_b"
FT                   /note="gene_id=mCG11530.3 transcript_id=mCT189682.0
FT                   protein_id=mCP110640.0 isoform=CRA_b"
FT                   /protein_id="EDL04629.1"
FT                   /translation="YGLWVPLSKMELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWA
FT                   IKYSTWEPEENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKPSASASSPKLHSS
FT                   AAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRKVKPREPKRN
FT                   RIILNLKVIDKGPGGGSTAQGTGALARPKVPSRNRVIGKSKKFSESMLRTQIRHMKFGT
FT                   FALYKPPPAPLAPSTAGKADVASSGPGLLLATPAAAPFDAHSSSSSGCPSPTLQSSDPD
FT                   DAPPKLLPETLSRSVPNWRESEVLDLSIPPEAAATGQRVPPDVTGAADQALHTALEPTG
FT                   AGSSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCSPEDFEKVAAGVAGATGGGG
FT                   GTGPSK"
FT   CDS             complement(join(870585..871583,876126..876192,
FT                   876316..876381,876529..876572,876757..876825))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11530"
FT                   /product="mCG11530, isoform CRA_a"
FT                   /note="gene_id=mCG11530.3 transcript_id=mCT12111.2
FT                   protein_id=mCP10100.2 isoform=CRA_a"
FT                   /protein_id="EDL04628.1"
FT                   /translation="MELSAVGERVFAAESIIKRRIRKGRIEYLVKWKGWAIKYSTWEPE
FT                   ENILDSRLIAAFEQKERERELYGPKKRGPKPKTFLLKARAQAEALRISDVHFSVKPSAS
FT                   ASSPKLHSSAAVHRLKKDIRRCHRMSRRPLPRPDPQGGSPGLRPPISPFSETVRIINRK
FT                   VKPREPKRNRIILNLKVIDKGPGGGSTAQGTGALARPKVPSRNRVIGKSKKFSESMLRT
FT                   QIRHMKFGTFALYKPPPAPLAPSTAGKADVASSGPGLLLATPAAAPFDAHSSSSSGCPS
FT                   PTLQSSDPDDAPPKLLPETLSRSVPNWRESEVLDLSIPPEAAATGQRVPPDVTGAADQA
FT                   LHTALEPTGAGSSEPEAGDWRPEMSPCSNVVVTDVTSNLLTVTIKEFCSPEDFEKVAAG
FT                   VAGATGGGGGTGPSK"
FT   assembly_gap    879387..879406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    883698..883733
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    899307..900695
FT                   /estimated_length=1389
FT                   /gap_type="unknown"
FT   assembly_gap    902240..902259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            905863..906484
FT                   /locus_tag="mCG_7057"
FT                   /note="gene_id=mCG7057.2"
FT   mRNA            905863..906484
FT                   /locus_tag="mCG_7057"
FT                   /product="mCG7057"
FT                   /note="gene_id=mCG7057.2 transcript_id=mCT5678.2 created on
FT                   18-SEP-2002"
FT   CDS             905976..906338
FT                   /codon_start=1
FT                   /locus_tag="mCG_7057"
FT                   /product="mCG7057"
FT                   /note="gene_id=mCG7057.2 transcript_id=mCT5678.2
FT                   protein_id=mCP1645.2"
FT                   /protein_id="EDL04627.1"
FT                   /translation="MMNGRPGHEPLKFLPDEARSLPPPKLNDPRLVYMGLLGYCTGLMD
FT                   NMLRMRPVMRAGLHRQLLFVTSFVFAGYFYLKRQNYLYAVKDHDMFGYIKLHPEDFPEK
FT                   EKKTYAEILEPFHPVR"
FT   assembly_gap    909694..909713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    921319..921348
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            complement(932635..933788)
FT                   /locus_tag="mCG_123850"
FT                   /note="gene_id=mCG123850.1"
FT   mRNA            complement(932635..933788)
FT                   /locus_tag="mCG_123850"
FT                   /product="mCG123850"
FT                   /note="gene_id=mCG123850.1 transcript_id=mCT125086.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(932936..933166)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123850"
FT                   /product="mCG123850"
FT                   /note="gene_id=mCG123850.1 transcript_id=mCT125086.1
FT                   protein_id=mCP83093.1"
FT                   /protein_id="EDL04626.1"
FT                   /translation="MGCLLKCLGWNFNRSVSLETTALFKGHSVCPREIGRFLADPFPYL
FT                   LCVWFSEKLLNTPTVVMPFCILHARCPLPGI"
FT   gene            933876..949735
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /note="gene_id=mCG11517.3"
FT   mRNA            join(933876..934030,939063..939339,939479..939593,
FT                   940391..940489,946737..946893,947626..947887,
FT                   948135..948247,948602..949058)
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /product="apolipoprotein B editing complex 3, transcript
FT                   variant mCT172392"
FT                   /note="gene_id=mCG11517.3 transcript_id=mCT172392.0 created
FT                   on 23-AUG-2002"
FT   mRNA            join(934641..934784,937419..937566,939063..939339,
FT                   939479..939593,940391..940489,946737..946893,
FT                   947626..947887,948135..948247,948602..949204)
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /product="apolipoprotein B editing complex 3, transcript
FT                   variant mCT12100"
FT                   /note="gene_id=mCG11517.3 transcript_id=mCT12100.1 created
FT                   on 23-AUG-2002"
FT   mRNA            join(<934662..934784,937419..937566,939063..939339,
FT                   939479..939593,946737..946893,947626..947887,
FT                   948135..948247,948602..949212)
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /product="apolipoprotein B editing complex 3, transcript
FT                   variant mCT189760"
FT                   /note="gene_id=mCG11517.3 transcript_id=mCT189760.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<934663..934784,937419..937566,939063..939339,
FT                   939479..939593,940391..940489,946737..946893,
FT                   947626..947887,948135..949735)
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /product="apolipoprotein B editing complex 3, transcript
FT                   variant mCT189761"
FT                   /note="gene_id=mCG11517.3 transcript_id=mCT189761.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<934663..934784,937419..937566,939063..939339,
FT                   939479..939593,946737..946893,947626..947887,
FT                   948135..948247,948602..948667)
FT                   /codon_start=1
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /product="apolipoprotein B editing complex 3, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG11517.3 transcript_id=mCT189760.0
FT                   protein_id=mCP110740.0 isoform=CRA_c"
FT                   /protein_id="EDL04624.1"
FT                   /translation="HFWGSSIACSQKMQPQRMGPRAGMGPFCLGCSHRKCYSPIRNLIS
FT                   QETFKFHFKNLRYAIDRKDTFLCYEVTRKDCDSPVSLHHGVFKNKDNIHAEICFLYWFH
FT                   DKVLKVLSPREEFKITWYMSWSPCFECAEQVLRFLATHHNLSLDIFSSRLYNIRDPENQ
FT                   QNLCRLVQEGAQVAAMDLYEFKKCWKKFVDNGGRRFRPWKKLLTNFRYQDSKLQEILRR
FT                   VHLLSEEEFYSQFYNQRVKHLCYYHGMKPYLCYQLEQFNGQAPLKGCLLSEKGKQHAEI
FT                   LFLDKIRSMELSQVTITCYLTWSPCPNCAWQLAAFKRDRPDLILHIYTSRLYFHWKRPF
FT                   QKGLCSLWQSGILVDVMDLPQFTDCWTNFVNPKRPFWPWKGLEIISRRTQRRLHRIKES
FT                   WGLQDLVNDFGNLQLGPPMS"
FT   CDS             join(<934663..934784,937419..937566,939063..939339,
FT                   939479..939593,940391..940489,946737..946893,
FT                   947626..947887,948135..948283)
FT                   /codon_start=1
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /product="apolipoprotein B editing complex 3, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG11517.3 transcript_id=mCT189761.0
FT                   protein_id=mCP110741.0 isoform=CRA_d"
FT                   /protein_id="EDL04625.1"
FT                   /translation="HFWGSSIACSQKMQPQRMGPRAGMGPFCLGCSHRKCYSPIRNLIS
FT                   QETFKFHFKNLRYAIDRKDTFLCYEVTRKDCDSPVSLHHGVFKNKDNIHAEICFLYWFH
FT                   DKVLKVLSPREEFKITWYMSWSPCFECAEQVLRFLATHHNLSLDIFSSRLYNIRDPENQ
FT                   QNLCRLVQEGAQVAAMDLYEFKKCWKKFVDNGGRRFRPWKKLLTNFRYQDSKLQEILRP
FT                   CYIPVPSSSSSTLSNICLTKGLPETRFCVEGRRVHLLSEEEFYSQFYNQRVKHLCYYHG
FT                   MKPYLCYQLEQFNGQAPLKGCLLSEKGKQHAEILFLDKIRSMELSQVTITCYLTWSPCP
FT                   NCAWQLAAFKRDRPDLILHIYTSRLYFHWKRPFQKGLCSLWQSGILVDVMDLPQFTDCW
FT                   TNFVNPKRPFWPWKGLEIISRRTQRRLHRIKEVRTTLLQGPAS"
FT   CDS             join(934699..934784,937419..937566,939063..939339,
FT                   939479..939593,940391..940489,946737..946893,
FT                   947626..947887,948135..948247,948602..948667)
FT                   /codon_start=1
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /product="apolipoprotein B editing complex 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11517.3 transcript_id=mCT12100.1
FT                   protein_id=mCP10049.2 isoform=CRA_a"
FT                   /protein_id="EDL04622.1"
FT                   /translation="MQPQRMGPRAGMGPFCLGCSHRKCYSPIRNLISQETFKFHFKNLR
FT                   YAIDRKDTFLCYEVTRKDCDSPVSLHHGVFKNKDNIHAEICFLYWFHDKVLKVLSPREE
FT                   FKITWYMSWSPCFECAEQVLRFLATHHNLSLDIFSSRLYNIRDPENQQNLCRLVQEGAQ
FT                   VAAMDLYEFKKCWKKFVDNGGRRFRPWKKLLTNFRYQDSKLQEILRPCYIPVPSSSSST
FT                   LSNICLTKGLPETRFCVEGRRVHLLSEEEFYSQFYNQRVKHLCYYHGMKPYLCYQLEQF
FT                   NGQAPLKGCLLSEKGKQHAEILFLDKIRSMELSQVTITCYLTWSPCPNCAWQLAAFKRD
FT                   RPDLILHIYTSRLYFHWKRPFQKGLCSLWQSGILVDVMDLPQFTDCWTNFVNPKRPFWP
FT                   WKGLEIISRRTQRRLHRIKESWGLQDLVNDFGNLQLGPPMS"
FT   assembly_gap    939019..939038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(939159..939339,939479..939593,940391..940489,
FT                   946737..946893,947626..947887,948135..948247,
FT                   948602..948667)
FT                   /codon_start=1
FT                   /gene="Apobec3"
FT                   /locus_tag="mCG_11517"
FT                   /product="apolipoprotein B editing complex 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11517.3 transcript_id=mCT172392.0
FT                   protein_id=mCP95311.0 isoform=CRA_b"
FT                   /protein_id="EDL04623.1"
FT                   /translation="MSWSPCFECAEQVLRFLATHHNLSLDIFSSRLYNIRDPENQQNLC
FT                   RLVQEGAQVAAMDLYEFKKCWKKFVDNGGRRFRPWKKLLTNFRYQDSKLQEILRPCYIP
FT                   VPSSSSSTLSNICLTKGLPETRFCVEGRRVHLLSEEEFYSQFYNQRVKHLCYYHGMKPY
FT                   LCYQLEQFNGQAPLKGCLLSEKGKQHAEILFLDKIRSMELSQVTITCYLTWSPCPNCAW
FT                   QLAAFKRDRPDLILHIYTSRLYFHWKRPFQKGLCSLWQSGILVDVMDLPQFTDCWTNFV
FT                   NPKRPFWPWKGLEIISRRTQRRLHRIKESWGLQDLVNDFGNLQLGPPMS"
FT   assembly_gap    950867..950886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            952849..957871
FT                   /locus_tag="mCG_123851"
FT                   /note="gene_id=mCG123851.1"
FT   mRNA            join(952849..952867,956540..957871)
FT                   /locus_tag="mCG_123851"
FT                   /product="mCG123851"
FT                   /note="gene_id=mCG123851.1 transcript_id=mCT125087.1
FT                   created on 18-SEP-2002"
FT   CDS             956804..957082
FT                   /codon_start=1
FT                   /locus_tag="mCG_123851"
FT                   /product="mCG123851"
FT                   /note="gene_id=mCG123851.1 transcript_id=mCT125087.1
FT                   protein_id=mCP83096.1"
FT                   /db_xref="MGI:MGI:1933111"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UZ34"
FT                   /protein_id="EDL04621.1"
FT                   /translation="MGHLFAESWRLWALCGVELSRAVDTIPPEALLTSPLILAVDGHTQ
FT                   GSSAGVKSCLYSRAGQAIERTKQCMLSALPVSSLSGVQSPCKCASAS"
FT   gene            complement(957006..>974163)
FT                   /gene="Cbx7"
FT                   /locus_tag="mCG_11514"
FT                   /note="gene_id=mCG11514.2"
FT   mRNA            complement(join(957006..960063,960340..960691,
FT                   962964..963030,964883..964948,972033..972076,
FT                   973843..974030))
FT                   /gene="Cbx7"
FT                   /locus_tag="mCG_11514"
FT                   /product="chromobox homolog 7, transcript variant mCT12095"
FT                   /note="gene_id=mCG11514.2 transcript_id=mCT12095.1 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(957393..963030,964883..964948,
FT                   972033..972076,973843..>974163))
FT                   /gene="Cbx7"
FT                   /locus_tag="mCG_11514"
FT                   /product="chromobox homolog 7, transcript variant
FT                   mCT189750"
FT                   /note="gene_id=mCG11514.2 transcript_id=mCT189750.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(957967..959637,959864..960063,
FT                   960340..960412,962964..963030,964883..964948,
FT                   972033..972076,973843..973998))
FT                   /gene="Cbx7"
FT                   /locus_tag="mCG_11514"
FT                   /product="chromobox homolog 7, transcript variant
FT                   mCT172887"
FT                   /note="gene_id=mCG11514.2 transcript_id=mCT172887.0 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(959906..960063,960340..960412,
FT                   962964..963030,964883..964948,972033..972076,
FT                   973843..973911))
FT                   /codon_start=1
FT                   /gene="Cbx7"
FT                   /locus_tag="mCG_11514"
FT                   /product="chromobox homolog 7, isoform CRA_b"
FT                   /note="gene_id=mCG11514.2 transcript_id=mCT172887.0
FT                   protein_id=mCP95806.0 isoform=CRA_b"
FT                   /protein_id="EDL04619.1"
FT                   /translation="MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPE
FT                   EHILDPRLVMAYEEKEERDRASGYRKRGPKPRRLLLQESAAPDVVQTPGDWEPMEQAPE
FT                   EEAEADLTNGPPPWTPTLPSSEVTVTDITANSVTVTFREAQAAEGFFRDRNEKL"
FT   CDS             complement(join(959906..960063,960340..960691,
FT                   962964..963030,964883..964948,972033..972076,
FT                   973843..973911))
FT                   /codon_start=1
FT                   /gene="Cbx7"
FT                   /locus_tag="mCG_11514"
FT                   /product="chromobox homolog 7, isoform CRA_a"
FT                   /note="gene_id=mCG11514.2 transcript_id=mCT12095.1
FT                   protein_id=mCP10047.2 isoform=CRA_a"
FT                   /protein_id="EDL04618.1"
FT                   /translation="MELSAIGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPE
FT                   EHILDPRLVMAYEEKEERDRASGYRKRGPKPRRLLLQRLYSMDLRSSHKAKGNEKLCFS
FT                   LARPLRSGSPMGVVKAGVAELVEKGPLVPTLPFPLRKARKAHKYLRLSHKKFPPRGPHL
FT                   ESHSHRRELSLQESAAPDVVQTPGDWEPMEQAPEEEAEADLTNGPPPWTPTLPSSEVTV
FT                   TDITANSVTVTFREAQAAEGFFRDRNEKL"
FT   CDS             complement(join(962709..963030,964883..964948,
FT                   972033..972076,973843..>974016))
FT                   /codon_start=1
FT                   /gene="Cbx7"
FT                   /locus_tag="mCG_11514"
FT                   /product="chromobox homolog 7, isoform CRA_c"
FT                   /note="gene_id=mCG11514.2 transcript_id=mCT189750.0
FT                   protein_id=mCP110684.0 isoform=CRA_c"
FT                   /protein_id="EDL04620.1"
FT                   /translation="RGPRRPEHRAQPPRPRSSTPGPARSGPGPTRPPPRMELSAIGEQV
FT                   FAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRASGY
FT                   RKRGPKPRRLLLQVTTASEPSASPCPTLPCPHPLHVHWPLGPLSHPTQHPRVLGSETLS
FT                   GYISIEGILQRPHVELEPGKGTLVGLRVDRQPTSESLK"
FT   assembly_gap    978075..978094
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    983744..983763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    986787..986806
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1006769..1006788
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1019999..1022271
FT                   /estimated_length=2273
FT                   /gap_type="unknown"
FT   assembly_gap    1024580..1024892
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    1029812..1033260
FT                   /estimated_length=3449
FT                   /gap_type="unknown"
FT   assembly_gap    1034369..1034511
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    1038152..1038246
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    1039537..1041538
FT                   /estimated_length=2002
FT                   /gap_type="unknown"
FT   gene            complement(1042051..1060444)
FT                   /gene="Pdgfb"
FT                   /locus_tag="mCG_11519"
FT                   /note="gene_id=mCG11519.1"
FT   mRNA            complement(join(1042051..1042728,1043027..1043175,
FT                   1045803..1045947,1047162..1047367,1048805..1048894,
FT                   1050949..1051045,1059403..1060444))
FT                   /gene="Pdgfb"
FT                   /locus_tag="mCG_11519"
FT                   /product="platelet derived growth factor, B polypeptide"
FT                   /note="gene_id=mCG11519.1 transcript_id=mCT12101.1 created
FT                   on 23-AUG-2002"
FT   CDS             complement(join(1043051..1043175,1045803..1045947,
FT                   1047162..1047367,1048805..1048894,1050949..1051045,
FT                   1059403..1059465))
FT                   /codon_start=1
FT                   /gene="Pdgfb"
FT                   /locus_tag="mCG_11519"
FT                   /product="platelet derived growth factor, B polypeptide"
FT                   /note="gene_id=mCG11519.1 transcript_id=mCT12101.1
FT                   protein_id=mCP10059.1"
FT                   /db_xref="GOA:Q549C6"
FT                   /db_xref="InterPro:IPR000072"
FT                   /db_xref="InterPro:IPR006782"
FT                   /db_xref="InterPro:IPR015583"
FT                   /db_xref="InterPro:IPR023581"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:97528"
FT                   /db_xref="UniProtKB/TrEMBL:Q549C6"
FT                   /protein_id="EDL04617.1"
FT                   /translation="MNRCWALFLPLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQ
FT                   RLLHRDSVDEDGAELDLNMTRAHSGVELESSSRGRRSLGSLAAAEPAVIAECKTRTEVF
FT                   QISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKP
FT                   IFKKATVTLEDHLACKCETIVTPRPVTRSPGTSREQRAKTPQARVTIRTVRIRRPPKGK
FT                   HRKFKHTHDKAALKETLGA"
FT   assembly_gap    1072957..1072976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1074202..1078915
FT                   /estimated_length=4714
FT                   /gap_type="unknown"
FT   assembly_gap    1084927..1085307
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    1086980..1087085
FT                   /estimated_length=106
FT                   /gap_type="unknown"
FT   assembly_gap    1101506..1101525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1116759..1122304)
FT                   /locus_tag="mCG_11520"
FT                   /note="gene_id=mCG11520.2"
FT   mRNA            complement(join(1116759..1116857,1116952..1117071,
FT                   1117296..1117391,1117672..1117773,1118655..1118815,
FT                   1119310..1119496,1119846..1119981,1120565..1120733,
FT                   1121340..1121532,1122274..1122303))
FT                   /locus_tag="mCG_11520"
FT                   /product="mCG11520, transcript variant mCT12102"
FT                   /note="gene_id=mCG11520.2 transcript_id=mCT12102.1 created
FT                   on 26-SEP-2002"
FT   mRNA            complement(join(1116774..1116857,1116952..1117071,
FT                   1117296..1117316,1119467..1119496,1119846..1119981,
FT                   1120565..1120733,1121340..1121532,1122274..1122304))
FT                   /locus_tag="mCG_11520"
FT                   /product="mCG11520, transcript variant mCT174044"
FT                   /note="gene_id=mCG11520.2 transcript_id=mCT174044.0 created
FT                   on 26-SEP-2002"
FT   CDS             complement(join(1116813..1116857,1116952..1117071,
FT                   1117296..1117316,1119467..1119496,1119846..1119981,
FT                   1120565..1120733,1121340..1121532,1122274..1122276))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11520"
FT                   /product="mCG11520, isoform CRA_a"
FT                   /note="gene_id=mCG11520.2 transcript_id=mCT174044.0
FT                   protein_id=mCP96963.0 isoform=CRA_a"
FT                   /protein_id="EDL04615.1"
FT                   /translation="MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTA
FT                   FLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKT
FT                   VFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRII
FT                   AHTQMRLLPLRQKKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKA
FT                   FMGPLKKDRIAKEEGA"
FT   CDS             complement(join(1116813..1116857,1116952..1117071,
FT                   1117296..1117391,1117672..1117773,1118655..1118815,
FT                   1119310..1119496,1119846..1119981,1120565..1120733,
FT                   1121340..1121532,1122274..1122276))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11520"
FT                   /product="mCG11520, isoform CRA_b"
FT                   /note="gene_id=mCG11520.2 transcript_id=mCT12102.1
FT                   protein_id=mCP10072.1 isoform=CRA_b"
FT                   /db_xref="GOA:P27659"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="MGI:MGI:1351605"
FT                   /db_xref="UniProtKB/Swiss-Prot:P27659"
FT                   /protein_id="EDL04616.1"
FT                   /translation="MSHRKFSAPRHGSLGFLPRKRSSRHRGKVKSFPKDDASKPVHLTA
FT                   FLGYKAGMTHIVREVDRPGSKVNKKEVVEAVTIVETPPMVVVGIVGYVETPRGLRTFKT
FT                   VFAEHISDECKRRFYKNWHKSKKKAFTKYCKKWQDDTGKKQLEKDFNSMKKYCQVIRII
FT                   AHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGV
FT                   TKGKGYKGVTSRWHTKKLPRKTHRGLRKVACIGAWHPARVAFSVARAGQKGYHHRTEIN
FT                   KKIYKIGQGYLIKDGKLIKNNASTDYDLSDKSINPLGGFVHYGEVTNDFIMLKGCVVGT
FT                   KKRVLTLRKSLLVQTKRRALEKIDLKFIDTTSKFGHGRFQTMEEKKAFMGPLKKDRIAK
FT                   EEGA"
FT   assembly_gap    1123789..1125162
FT                   /estimated_length=1374
FT                   /gap_type="unknown"
FT   gene            1130189..1155532
FT                   /gene="Syngr1"
FT                   /locus_tag="mCG_11522"
FT                   /note="gene_id=mCG11522.2"
FT   mRNA            join(1130189..1130329,1149280..1149517,1150437..1150582,
FT                   1151999..1153386)
FT                   /gene="Syngr1"
FT                   /locus_tag="mCG_11522"
FT                   /product="synaptogyrin 1, transcript variant mCT12099"
FT                   /note="gene_id=mCG11522.2 transcript_id=mCT12099.1 created
FT                   on 23-AUG-2002"
FT   mRNA            join(1130193..1130329,1149280..1149517,1150437..1150582,
FT                   1154900..1155532)
FT                   /gene="Syngr1"
FT                   /locus_tag="mCG_11522"
FT                   /product="synaptogyrin 1, transcript variant mCT172393"
FT                   /note="gene_id=mCG11522.2 transcript_id=mCT172393.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(1130231..1130329,1149280..1149517,1150437..1150582,
FT                   1154900..1155007)
FT                   /codon_start=1
FT                   /gene="Syngr1"
FT                   /locus_tag="mCG_11522"
FT                   /product="synaptogyrin 1, isoform CRA_b"
FT                   /note="gene_id=mCG11522.2 transcript_id=mCT172393.0
FT                   protein_id=mCP95312.0 isoform=CRA_b"
FT                   /protein_id="EDL04614.1"
FT                   /translation="MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWVFSIVVFGSIVN
FT                   EGYLNNPEEEEEFCIYNRNPNACSYGVTVGVLAFLTCLLYLALDVYFPQISSVKDRKKA
FT                   VLSDIGVSAFWAFFWFVGFCFLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWGL
FT                   LSPPPPHGGDGDRLPCPCPSILAPLPSTLLPPR"
FT   CDS             join(1130231..1130329,1149280..1149517,1150437..1150582,
FT                   1151999..1152091)
FT                   /codon_start=1
FT                   /gene="Syngr1"
FT                   /locus_tag="mCG_11522"
FT                   /product="synaptogyrin 1, isoform CRA_a"
FT                   /note="gene_id=mCG11522.2 transcript_id=mCT12099.1
FT                   protein_id=mCP10081.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U6D7"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="InterPro:IPR016579"
FT                   /db_xref="MGI:MGI:1328323"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U6D7"
FT                   /protein_id="EDL04613.1"
FT                   /translation="MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWVFSIVVFGSIVN
FT                   EGYLNNPEEEEEFCIYNRNPNACSYGVTVGVLAFLTCLLYLALDVYFPQISSVKDRKKA
FT                   VLSDIGVSAFWAFFWFVGFCFLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSL
FT                   TAALAVRRFKELTFQEEYNTLFPASAQP"
FT   assembly_gap    1171839..1171858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1173107..1173126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1173324..1201841
FT                   /gene="Map3k7ip1"
FT                   /locus_tag="mCG_11531"
FT                   /note="gene_id=mCG11531.1"
FT   mRNA            join(<1173324..1173349,1188319..1188455,1188779..1188932,
FT                   1189874..1189960,1190519..1190657,1192779..1192892,
FT                   1193746..1193857,1195871..1196015,1197717..1197939,
FT                   1198864..1199020,1200187..1201841)
FT                   /gene="Map3k7ip1"
FT                   /locus_tag="mCG_11531"
FT                   /product="mitogen-activated protein kinase kinase kinase 7
FT                   interacting protein 1"
FT                   /note="gene_id=mCG11531.1 transcript_id=mCT12112.1 created
FT                   on 28-AUG-2002"
FT   CDS             join(<1173326..1173349,1188319..1188455,1188779..1188932,
FT                   1189874..1189960,1190519..1190657,1192779..1192892,
FT                   1193746..1193857,1195871..1196015,1197717..1197939,
FT                   1198864..1199020,1200187..1200394)
FT                   /codon_start=1
FT                   /gene="Map3k7ip1"
FT                   /locus_tag="mCG_11531"
FT                   /product="mitogen-activated protein kinase kinase kinase 7
FT                   interacting protein 1"
FT                   /note="gene_id=mCG11531.1 transcript_id=mCT12112.1
FT                   protein_id=mCP10034.1"
FT                   /protein_id="EDL04612.1"
FT                   /translation="QRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHP
FT                   PEDNWLKFRSENNCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNTEHTEADVRRVLL
FT                   QAFDVVERSFLESIDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKALEREISGGA
FT                   MAVVAVLLNSKLYVANVGTNRALLCKSTVDGLQVTQLNMDHTTENEDELFRLSQLGLDA
FT                   GKIKQMGVICGQESTRRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGF
FT                   LVLMSEGLYKALEAAHGPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFA
FT                   SGGERAKFCPRHEDMTLLVRNFGYPLGEMSQPTPTPAPGGRVYPVSVPYSSAQSTSKTS
FT                   VTLSLVMPSQGQMVNGSHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFR
FT                   SRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVMTAP"
FT   assembly_gap    1181584..1181603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1190795..1190814
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1202125..1202170
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1213624..1214617
FT                   /estimated_length=994
FT                   /gap_type="unknown"
FT   assembly_gap    1217406..1217425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1248765..1248784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <1252574..>1254190
FT                   /locus_tag="mCG_11524"
FT                   /note="gene_id=mCG11524.0"
FT   mRNA            <1252574..>1254190
FT                   /locus_tag="mCG_11524"
FT                   /product="mCG11524"
FT                   /note="gene_id=mCG11524.0 transcript_id=mCT12105.0 created
FT                   on 23-AUG-2002"
FT   CDS             1252574..1254190
FT                   /codon_start=1
FT                   /locus_tag="mCG_11524"
FT                   /product="mCG11524"
FT                   /note="gene_id=mCG11524.0 transcript_id=mCT12105.0
FT                   protein_id=mCP10083.0"
FT                   /protein_id="EDL04611.1"
FT                   /translation="MKMRRYKLFLMFCMAGLCLISFLHFFKTLSYVTFPRELASLSPNL
FT                   VSSFFWNNAPVTPQASPEPGGPDLLRTPLYSHSPLLQPLSPSKATEELHRVDFVLPEDT
FT                   TEYFVRTKAGGVCFKPGTRMLEKPSPGRTEEKPEVSEGSSARGPARRPMRHVLSTRERL
FT                   GSRGTRRKWVECVCLPGWHGPSCGVPTVVQYSNLPTKERLVPREVPRRVINAININHEF
FT                   DLLDVRFHELGDVVDAFVVCESNFTAYGEPRPLKFREMLTNGTFEYIRHKVLYVFLDHF
FT                   PPGGRQDGWIADDYLRTFLTQDGVSRLRNLRPDDVFIIDDADEIPARDGVLFLKLYDGW
FT                   TEPFAFHMRKSLYGFFWKQPGTLEVVSGCTMDMLQAVYGLDGIRLRRRQYYTMPNFRQY
FT                   ENRTGHILVQWSLGSPLHFAGWHCSWCFTPEGIYFKLVSAQNGDFPRWGDYEDKRDLNY
FT                   IRSLIRTGGWFDGTQQEYPPADPSEHMYAPKYLLKNYDQFRYLLENPYREPKSTVEGGR
FT                   RNQGSDGRPSAVRGKLDTVEG"
FT   gene            complement(1256635..1257128)
FT                   /locus_tag="mCG_1027633"
FT                   /note="gene_id=mCG1027633.1"
FT   mRNA            complement(1256635..1257128)
FT                   /locus_tag="mCG_1027633"
FT                   /product="mCG1027633"
FT                   /note="gene_id=mCG1027633.1 transcript_id=mCT145337.1
FT                   created on 04-OCT-2002"
FT   CDS             complement(1256836..1257027)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027633"
FT                   /product="mCG1027633"
FT                   /note="gene_id=mCG1027633.1 transcript_id=mCT145337.1
FT                   protein_id=mCP83249.1"
FT                   /protein_id="EDL04610.1"
FT                   /translation="MYILIFIYKKNNTIIIIIIGVLKLHISQGPSFYLGESYLPTLNLT
FT                   FVSKASTSLSLLTTVTPG"
FT   assembly_gap    1257829..1258033
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   gene            complement(1270710..1271402)
FT                   /pseudo
FT                   /locus_tag="mCG_49606"
FT                   /note="gene_id=mCG49606.2"
FT   mRNA            complement(1270710..1271402)
FT                   /pseudo
FT                   /locus_tag="mCG_49606"
FT                   /note="gene_id=mCG49606.2 transcript_id=mCT49789.2 created
FT                   on 04-OCT-2002"
FT   gene            1275256..1293036
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /note="gene_id=mCG11525.2"
FT   mRNA            join(1275256..1275336,1276956..1277304,1287377..1287527,
FT                   1288510..1288687,1288963..1289139,1289964..1293036)
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /product="Smith-Magenis syndrome chromosome region,
FT                   candidate 7-like (human), transcript variant mCT179825"
FT                   /note="gene_id=mCG11525.2 transcript_id=mCT179825.0 created
FT                   on 04-FEB-2003"
FT   mRNA            join(1275260..1275700,1276956..1277304,1282214..1282296,
FT                   1287377..1287527,1288510..1288687,1288877..1289139,
FT                   1289964..1293036)
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /product="Smith-Magenis syndrome chromosome region,
FT                   candidate 7-like (human), transcript variant mCT12106"
FT                   /note="gene_id=mCG11525.2 transcript_id=mCT12106.2 created
FT                   on 04-FEB-2003"
FT   mRNA            join(1275262..1275336,1275824..1275922,1276956..1277304,
FT                   1287377..1287527,1288510..1288687,1288877..1289139,
FT                   1289964..1292161)
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /product="Smith-Magenis syndrome chromosome region,
FT                   candidate 7-like (human), transcript variant mCT179824"
FT                   /note="gene_id=mCG11525.2 transcript_id=mCT179824.0 created
FT                   on 04-FEB-2003"
FT   mRNA            join(<1275262..1275336,1276956..1277304,1287377..1287527,
FT                   1288510..1288687,1288877..1289139,1289964..1292161)
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /product="Smith-Magenis syndrome chromosome region,
FT                   candidate 7-like (human), transcript variant mCT189655"
FT                   /note="gene_id=mCG11525.2 transcript_id=mCT189655.0 created
FT                   on 08-MAR-2004"
FT   assembly_gap    1279005..1279024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1280286..1280305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<1287381..1287527,1288510..1288687,1288877..1289139,
FT                   1289964..1290770)
FT                   /codon_start=1
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /product="Smith-Magenis syndrome chromosome region,
FT                   candidate 7-like (human), isoform CRA_b"
FT                   /note="gene_id=mCG11525.2 transcript_id=mCT189655.0
FT                   protein_id=mCP110639.0 isoform=CRA_b"
FT                   /protein_id="EDL04608.1"
FT                   /translation="AMAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATL
FT                   AVKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNKDMKAGLSRSLQTLPTDSS
FT                   AFDTDTFCPPRPKPLARRGQVDLKKSRLRMSLQEKLLSYYRNRAAIPAGEQARAKQAAV
FT                   DICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGE
FT                   DTIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIG
FT                   SLLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRL
FT                   SLRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEAD
FT                   WSPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEP
FT                   EVLLQT"
FT   CDS             join(1287384..1287527,1288510..1288687,1288877..1289139,
FT                   1289964..1290770)
FT                   /codon_start=1
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /product="Smith-Magenis syndrome chromosome region,
FT                   candidate 7-like (human), isoform CRA_a"
FT                   /note="gene_id=mCG11525.2 transcript_id=mCT12106.2
FT                   protein_id=mCP10027.3 isoform=CRA_a"
FT                   /db_xref="GOA:B2RPW2"
FT                   /db_xref="InterPro:IPR024810"
FT                   /db_xref="MGI:MGI:2146020"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPW2"
FT                   /protein_id="EDL04606.1"
FT                   /translation="MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLA
FT                   VKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNKDMKAGLSRSLQTLPTDSSA
FT                   FDTDTFCPPRPKPLARRGQVDLKKSRLRMSLQEKLLSYYRNRAAIPAGEQARAKQAAVD
FT                   ICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGED
FT                   TIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGS
FT                   LLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLS
FT                   LRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADW
FT                   SPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPE
FT                   VLLQT"
FT   CDS             join(1287384..1287527,1288510..1288687,1288877..1289139,
FT                   1289964..1290770)
FT                   /codon_start=1
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /product="Smith-Magenis syndrome chromosome region,
FT                   candidate 7-like (human), isoform CRA_a"
FT                   /note="gene_id=mCG11525.2 transcript_id=mCT179824.0
FT                   protein_id=mCP102746.0 isoform=CRA_a"
FT                   /db_xref="GOA:B2RPW2"
FT                   /db_xref="InterPro:IPR024810"
FT                   /db_xref="MGI:MGI:2146020"
FT                   /db_xref="UniProtKB/TrEMBL:B2RPW2"
FT                   /protein_id="EDL04607.1"
FT                   /translation="MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLA
FT                   VKRMYDRAISAPTSPTRLSHSGKRSWEEPNWMGSPRLLNKDMKAGLSRSLQTLPTDSSA
FT                   FDTDTFCPPRPKPLARRGQVDLKKSRLRMSLQEKLLSYYRNRAAIPAGEQARAKQAAVD
FT                   ICAELRSFLRAKLPDMPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGED
FT                   TIMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGS
FT                   LLDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLS
FT                   LRPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADW
FT                   SPDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPE
FT                   VLLQT"
FT   CDS             join(1289089..1289139,1289964..1290770)
FT                   /codon_start=1
FT                   /gene="Smcr7l"
FT                   /locus_tag="mCG_11525"
FT                   /product="Smith-Magenis syndrome chromosome region,
FT                   candidate 7-like (human), isoform CRA_c"
FT                   /note="gene_id=mCG11525.2 transcript_id=mCT179825.0
FT                   protein_id=mCP102747.0 isoform=CRA_c"
FT                   /protein_id="EDL04609.1"
FT                   /translation="MPLRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDT
FT                   IMNVPGFFLVRRENPEYFPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSL
FT                   LDYVIRPAPPPEALTLEVQYEKDKHLVIDFLPSVTLGDTVLVARPHRLAQYDNLWRLSL
FT                   RPAETARLRALDQADSGCRSLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWS
FT                   PDMLADRFLQALRGLISYLEAGVLPSALNPKVNLFAELTPQEIDELGYTLYCSLSEPEV
FT                   LLQT"
FT   assembly_gap    1293037..1293158
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            1295927..1298247
FT                   /gene="Atf4"
FT                   /locus_tag="mCG_11526"
FT                   /note="gene_id=mCG11526.1"
FT   mRNA            join(1295927..1296428,1296950..1297264,1297377..1298247)
FT                   /gene="Atf4"
FT                   /locus_tag="mCG_11526"
FT                   /product="activating transcription factor 4, transcript
FT                   variant mCT12107"
FT                   /note="gene_id=mCG11526.1 transcript_id=mCT12107.2 created
FT                   on 23-AUG-2002"
FT   mRNA            join(1295928..1296027,1296311..1296428,1296950..1297264,
FT                   1297377..1298234)
FT                   /gene="Atf4"
FT                   /locus_tag="mCG_11526"
FT                   /product="activating transcription factor 4, transcript
FT                   variant mCT172394"
FT                   /note="gene_id=mCG11526.1 transcript_id=mCT172394.0 created
FT                   on 23-AUG-2002"
FT   CDS             join(1297042..1297264,1297377..1298203)
FT                   /codon_start=1
FT                   /gene="Atf4"
FT                   /locus_tag="mCG_11526"
FT                   /product="activating transcription factor 4, isoform CRA_a"
FT                   /note="gene_id=mCG11526.1 transcript_id=mCT12107.2
FT                   protein_id=mCP10085.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q06507"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR029811"
FT                   /db_xref="MGI:MGI:88096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06507"
FT                   /protein_id="EDL04604.1"
FT                   /translation="MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLK
FT                   PHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDL
FT                   ETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFP
FT                   CSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICM
FT                   SPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLK
FT                   KMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR
FT                   KARGKKRVP"
FT   CDS             join(1297042..1297264,1297377..1298203)
FT                   /codon_start=1
FT                   /gene="Atf4"
FT                   /locus_tag="mCG_11526"
FT                   /product="activating transcription factor 4, isoform CRA_a"
FT                   /note="gene_id=mCG11526.1 transcript_id=mCT172394.0
FT                   protein_id=mCP95313.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q06507"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="InterPro:IPR029811"
FT                   /db_xref="MGI:MGI:88096"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q06507"
FT                   /protein_id="EDL04605.1"
FT                   /translation="MTEMSFLNSEVLAGDLMSPFDQSGLGAEESLGLLDDYLEVAKHLK
FT                   PHGFSSDKAGSSEWPAMDDGLASASDTGKEDAFSGTDWMLEKMDLKEFDFDALFRMDDL
FT                   ETMPDELLTTLDDTCDLFAPLVQETNKEPPQTVNPIGHLPESLIKVDQVAPFTFLQPFP
FT                   CSPGVLSSTPEHSFSLELGSEVDISEGDRKPDSAAYITLIPPCVKEEDTPSDNDSGICM
FT                   SPESYLGSPQHSPSTSRAPPDNLPSPGGSRGSPRPKPYDPPGVSLTAKVKTEKLDKKLK
FT                   KMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKEKADSLAKEIQYLKDLIEEVR
FT                   KARGKKRVP"
FT   gene            complement(1301380..1305038)
FT                   /gene="Rps19bp1"
FT                   /locus_tag="mCG_11529"
FT                   /note="gene_id=mCG11529.2"
FT   mRNA            complement(join(1301380..1301888,1302055..1302152,
FT                   1304432..1304567,1304723..1304857,1304967..1305038))
FT                   /gene="Rps19bp1"
FT                   /locus_tag="mCG_11529"
FT                   /product="ribosomal protein S19 binding protein 1,
FT                   transcript variant mCT172888"
FT                   /note="gene_id=mCG11529.2 transcript_id=mCT172888.0 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(1301381..1301888,1302055..1302152,
FT                   1304723..1304857,1304967..1305036))
FT                   /gene="Rps19bp1"
FT                   /locus_tag="mCG_11529"
FT                   /product="ribosomal protein S19 binding protein 1,
FT                   transcript variant mCT12110"
FT                   /note="gene_id=mCG11529.2 transcript_id=mCT12110.1 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(1301745..1301888,1302055..1302152,
FT                   1304723..1304857,1304967..1305018))
FT                   /codon_start=1
FT                   /gene="Rps19bp1"
FT                   /locus_tag="mCG_11529"
FT                   /product="ribosomal protein S19 binding protein 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11529.2 transcript_id=mCT12110.1
FT                   protein_id=mCP10074.1 isoform=CRA_a"
FT                   /protein_id="EDL04602.1"
FT                   /translation="MSAALVRRGLELLAASEAPRAVPGQVQASGTPAKRTRRARAKASQ
FT                   ALKLRNSAKGKAPKSALAEYQKRQCRDHLKANLKFMTSMRSTVPESVTQQILQQNQGRK
FT                   ACDRLVAKTKNKKKKKKAEGTVFTEEDFQKFQREYFGS"
FT   CDS             complement(join(1304530..1304567,1304723..1304857,
FT                   1304967..1305018))
FT                   /codon_start=1
FT                   /gene="Rps19bp1"
FT                   /locus_tag="mCG_11529"
FT                   /product="ribosomal protein S19 binding protein 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11529.2 transcript_id=mCT172888.0
FT                   protein_id=mCP95807.0 isoform=CRA_b"
FT                   /protein_id="EDL04603.1"
FT                   /translation="MSAALVRRGLELLAASEAPRAVPGQVQASGTPAKRTRRARAKASQ
FT                   ALKLRNSAKGKAPKSALGLPLSAMWQLTG"
FT   assembly_gap    1308187..1308790
FT                   /estimated_length=604
FT                   /gap_type="unknown"
FT   assembly_gap    1311758..1311811
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    1327911..1328178
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   gene            <1338958..>1436931
FT                   /locus_tag="mCG_123843"
FT                   /note="gene_id=mCG123843.0"
FT   mRNA            join(<1338958..1338966,1339026..1339265,1361577..1361624,
FT                   1362341..1362474,1377570..1377667,1389366..1389525,
FT                   1396476..1396791,1397119..1397211,1399777..1400089,
FT                   1402836..1403206,1409641..1409792,1410562..1410747,
FT                   1411024..1411141,1411288..1411443,1411736..1411829,
FT                   1412466..1412668,1413158..1413631,1413917..1414017,
FT                   1415831..1416040,1416481..1416607,1416793..1416918,
FT                   1418005..1418094,1419387..1419579,1420231..1420382,
FT                   1421621..1421730,1422307..1422440,1423206..1423276,
FT                   1428991..1429069,1429626..1429747,1430274..1430666,
FT                   1430929..1431075,1432052..1432174,1432832..1432997,
FT                   1434934..1435130,1436290..>1436931)
FT                   /locus_tag="mCG_123843"
FT                   /product="mCG123843"
FT                   /note="gene_id=mCG123843.0 transcript_id=mCT125079.0
FT                   created on 09-SEP-2002"
FT   CDS             join(1338958..1338966,1339026..1339265,1361577..1361624,
FT                   1362341..1362474,1377570..1377667,1389366..1389525,
FT                   1396476..1396791,1397119..1397211,1399777..1400089,
FT                   1402836..1403206,1409641..1409792,1410562..1410747,
FT                   1411024..1411141,1411288..1411443,1411736..1411829,
FT                   1412466..1412668,1413158..1413631,1413917..1414017,
FT                   1415831..1416040,1416481..1416607,1416793..1416918,
FT                   1418005..1418094,1419387..1419579,1420231..1420382,
FT                   1421621..1421730,1422307..1422440,1423206..1423276,
FT                   1428991..1429069,1429626..1429747,1430274..1430666,
FT                   1430929..1431075,1432052..1432174,1432832..1432997,
FT                   1434934..1435130,1436290..1436931)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123843"
FT                   /product="mCG123843"
FT                   /note="gene_id=mCG123843.0 transcript_id=mCT125079.0
FT                   protein_id=mCP83120.0"
FT                   /protein_id="EDL04601.1"
FT                   /translation="MREGSLLHADMADSNLPPSSSAAPDPEPGITEQPGPRSPPPSPPG
FT                   LEEPLDGTNPDVPHPDLAPVAFFCLRQTTSPRNWCIKMPCDDMECLSDRCKILQVFDDF
FT                   IFIFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
FT                   RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRC
FT                   FLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKD
FT                   DMYDFGAGRQDLNASGLCVNWNRYYNVCRTGNANPHKGAINFDNIGYAWIVIFQVITLE
FT                   GWVEIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQR
FT                   QRYLSSSTVASYAEPGDCYEEIFQYVCHILRKAKRRALGLYQALQNRRQATGPGTPAPA
FT                   KPGPHAKEPSHCKLCPRHSPLDTTPHTLVQPISAILASDPSSCPRCQHEAGRRPSGLGS
FT                   TDSGQEGSGSGGSAEAEANGDGPQSSEDGVSSGLGKEEEQEDGAARLCGDVWRETRAKL
FT                   RGIVDSKYFNRGIMMAILPEELTNILEICNVVFTSMFALEMILKLAAFGLFDYLRNPYN
FT                   IFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLMKTMDNVAT
FT                   FCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDW
FT                   NVVLYNGMASTTPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYSDEDQSS
FT                   SNLEELDKLPEGLDSSRDLKLCPIPMTPNGHLDPSLPLGGHLGPAGAMGAAPRLSLQPD
FT                   PVLVALESRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSGTWASRRSSWNSLKHKPPS
FT                   AEHESLLSGERGGSCVRACEGAREDAPPRAAPLHAPHTHHAHHGPHLAHRHRHHRRTLS
FT                   LDTRDSVDLAELVPVVGAHSRAAWRAAGQAPGHEDCNGRMPNIAKDVFTKMDDRRDRGE
FT                   DEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENKLDPNPTPQVVSLGLYFGE
FT                   QAYLRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPG
FT                   LKLVVETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCV
FT                   AANYRWVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPVTNHNPWMLL
FT                   YFISFLLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLP
FT                   YYATYCPTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFT
FT                   TVFVLEAVLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRI
FT                   MRVLRIARVLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLV
FT                   CNDENPCEGMSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQF
FT                   VSPLYFVSFVLTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAEIELEMAHGLGPGPG
FT                   PCPCPCPCPCPCPCPCPRMPTSSPGAPGRGSGGAGVGGDTESHLCRHCYSPAQETLWLD
FT                   SVSLIIKDSLEGELTIIDNLSGSIFHHYSSPAGCDKCHHDKQEVQLAETEAFSLNSDRS
FT                   SSVLLGDDLSLEDPTACPQGPKESKGELEPPEPMQAGDLDECFFPFAGEPVSAGPESLL
FT                   CEMGAIPFNPVQSWLKHESNQAPPSPFSPDGSSPLLQMPAEFFHPAVSASQKGQEPGMS
FT                   SGTLPKIALQGSWASLRSPSVNCTLLRQATVSDTSLDASPSSSAGSLQTTLEDSLTLSD
FT                   SPRRALGPPVQVPGPRASLSPATRRRLSLRGRGLFSLRGLRAHQRSHSSGGSTSPGCTY
FT                   HDSMDPSDEEGRGGAGGGGAGSEHSETLSSLSLTSLFCLPPTLPPPGLTPARKFSSTSS
FT                   LAAGPGRPGATVSVRGLARSPSWAADRSKDPPGQAQLASGFGSSAPEPQPPPGESTDAA
FT                   SKRKR"
FT   assembly_gap    1341042..1341493
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    1348928..1349239
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    1350340..1350586
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    1352655..1353105
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    1354896..1354915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1355805..1356026
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    1361523..1361542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1400778..1400797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1401885..1402202
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    1414046..1415517
FT                   /estimated_length=1472
FT                   /gap_type="unknown"
FT   assembly_gap    1417268..1417287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1435853..1435872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1449026..1449136
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    1461959..1461978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1473413..1473688
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    1496019..1496076
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            1517809..1519763
FT                   /pseudo
FT                   /locus_tag="mCG_11518"
FT                   /note="gene_id=mCG11518.1"
FT   mRNA            1517809..1519763
FT                   /pseudo
FT                   /locus_tag="mCG_11518"
FT                   /note="gene_id=mCG11518.1 transcript_id=mCT12098.1 created
FT                   on 09-SEP-2002"
FT   assembly_gap    1531117..1531136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1536951..1537186
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   gene            complement(<1576374..1607015)
FT                   /locus_tag="mCG_52767"
FT                   /note="gene_id=mCG52767.1"
FT   mRNA            complement(join(<1576374..1576612,1601854..1602350,
FT                   1606917..1607015))
FT                   /locus_tag="mCG_52767"
FT                   /product="mCG52767"
FT                   /note="gene_id=mCG52767.1 transcript_id=mCT52950.1 created
FT                   on 09-SEP-2002"
FT   CDS             complement(join(<1576374..1576612,1601854..1602202))
FT                   /codon_start=1
FT                   /locus_tag="mCG_52767"
FT                   /product="mCG52767"
FT                   /note="gene_id=mCG52767.1 transcript_id=mCT52950.1
FT                   protein_id=mCP32095.2"
FT                   /protein_id="EDL04600.1"
FT                   /translation="MSFRRQVKNFVKNYSDAEKKVREATSNDPWGPSSSLMLAISDMTF
FT                   NAASLSEIMHMLWQRLSDHGKNWRHVYKSLALMDYLIKNGSRKVIQYCREGVCNLQMLK
FT                   DFQHIDEAGKDQGHYIRERSKQVITLLMDEQLLHKEREVATWTRQRTSYSMSFPSRLSA
FT                   TGTSPTVCTSVLIPESLTSEKKHSQDCKKTAGL"
FT   gene            1614452..1693185
FT                   /gene="Grap2"
FT                   /locus_tag="mCG_11528"
FT                   /note="gene_id=mCG11528.2"
FT   mRNA            join(1614452..1614599,1666709..1667025,1677604..1677695,
FT                   1681747..1681866,1686934..1687099,1689425..1689640,
FT                   1691140..1691256,1691705..1693185)
FT                   /gene="Grap2"
FT                   /locus_tag="mCG_11528"
FT                   /product="GRB2-related adaptor protein 2, transcript
FT                   variant mCT182205"
FT                   /note="gene_id=mCG11528.2 transcript_id=mCT182205.0 created
FT                   on 27-MAY-2003"
FT   mRNA            join(1614452..1614599,1666709..1666800,1677604..1677695,
FT                   1681747..1681866,1686934..1687099,1689425..1689640,
FT                   1691140..1691256,1691705..1693185)
FT                   /gene="Grap2"
FT                   /locus_tag="mCG_11528"
FT                   /product="GRB2-related adaptor protein 2, transcript
FT                   variant mCT12109"
FT                   /note="gene_id=mCG11528.2 transcript_id=mCT12109.2 created
FT                   on 27-MAY-2003"
FT   assembly_gap    1618113..1618132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1620618..1620828
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    1623417..1623436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1624625..1624644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1628270..1628289
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1633200..1633338
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    1638636..1639288
FT                   /estimated_length=653
FT                   /gap_type="unknown"
FT   assembly_gap    1651709..1651728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1652837..1652856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1654889..1655125
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    1658274..1658703
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   CDS             join(1666723..1666800,1677604..1677695,1681747..1681866,
FT                   1686934..1687099,1689425..1689640,1691140..1691256,
FT                   1691705..1691884)
FT                   /codon_start=1
FT                   /gene="Grap2"
FT                   /locus_tag="mCG_11528"
FT                   /product="GRB2-related adaptor protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG11528.2 transcript_id=mCT12109.2
FT                   protein_id=mCP10097.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U0E8"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001452"
FT                   /db_xref="InterPro:IPR035646"
FT                   /db_xref="MGI:MGI:1333842"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U0E8"
FT                   /protein_id="EDL04599.1"
FT                   /translation="MEATAKFDFMASGEDELSFRTGDILKILSNQEEWLKAELGSQEGY
FT                   VPKNFIDIEFPEWFHEGLSRHQAENLLMGKDIGFFIIRASQSSPGDFSISVRHEDDVQH
FT                   FKVMRDTKGNYFLWTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRS
FT                   QGGPHPSGTVGEEIRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHF
FT                   HQDRRGGSLDINDGHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDE
FT                   LGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMMR"
FT   assembly_gap    1667028..1667469
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    1670774..1670793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1675152..1675171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1678081..1679005
FT                   /estimated_length=925
FT                   /gap_type="unknown"
FT   CDS             join(1681793..1681866,1686934..1687099,1689425..1689640,
FT                   1691140..1691256,1691705..1691884)
FT                   /codon_start=1
FT                   /gene="Grap2"
FT                   /locus_tag="mCG_11528"
FT                   /product="GRB2-related adaptor protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG11528.2 transcript_id=mCT182205.0
FT                   protein_id=mCP105106.0 isoform=CRA_a"
FT                   /protein_id="EDL04598.1"
FT                   /translation="MGKDIGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDTKGNYFL
FT                   WTEKFPSLNKLVDYYRTTSISKQKQVFLRDGTQDQGHRGNSLDRRSQGGPHPSGTVGEE
FT                   IRPSVNRKLSDHLPLGPQQFHPHQQPSPQFTPGPQPPQQQRYLQHFHQDRRGGSLDIND
FT                   GHCGLGSEVNATLMHRRHTDPVQLQAAGRVRWARALYDFEALEEDELGFRSGEVVEVLD
FT                   SSNPSWWTGRLHNKLGLFPANYVAPMMR"
FT   gene            1715135..1743681
FT                   /gene="AW544981"
FT                   /locus_tag="mCG_11523"
FT                   /note="gene_id=mCG11523.2"
FT   mRNA            join(1715135..1715649,1733186..1733353,1733802..1733923,
FT                   1735180..1735865,1742216..1743681)
FT                   /gene="AW544981"
FT                   /locus_tag="mCG_11523"
FT                   /product="expressed sequence AW544981"
FT                   /note="gene_id=mCG11523.2 transcript_id=mCT12104.2 created
FT                   on 09-SEP-2002"
FT   CDS             join(1715179..1715649,1733186..1733353,1733802..1733923,
FT                   1735180..1735865,1742216..1742256)
FT                   /codon_start=1
FT                   /gene="AW544981"
FT                   /locus_tag="mCG_11523"
FT                   /product="expressed sequence AW544981"
FT                   /note="gene_id=mCG11523.2 transcript_id=mCT12104.2
FT                   protein_id=mCP10106.2"
FT                   /db_xref="InterPro:IPR012461"
FT                   /db_xref="MGI:MGI:2146227"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J033"
FT                   /protein_id="EDL04595.1"
FT                   /translation="MAESQLSCLDEAHVNERVTEAHAAFYYCERRRAALEALLGGGEQA
FT                   YRELVKKERLRDFLSSQERQALCAAWSPYEEAVSSTRAKAKAKAKVPAQPTESLAYWPD
FT                   RSDTEVPPLDLGWTDTNFYRGVSRVTLFTHPPKEEKAPHLKQVVRQMIQQAQKVIAVVM
FT                   DLFTDGDIFQDIVDAACKRRVPVYIILDEGGVKYFLEMCQGLELADFRIRNIRVRSVTG
FT                   IGFYMPMGKIKGTLSSKFLMVDGDKVATGSFSFTWSSSYVDRNLLLLLTGQNMEPFDIE
FT                   FRELYAISEEVNLHQHLGLAGRIGLNYSSTVARKLINPKYALVAGTRRPPGEMMRWAAR
FT                   QQREAGGNVEGQEEGSGGGESARRLESFLNDLVTVEQILPTVEPISPRLQRPTNGRPVS
FT                   HAHTDAKHRSREALPQNGKGEAANGEATPAKEGKRFSSRLFSRRVKRPAVPSSMASSPS
FT                   TETFADVEFPLGKRHNEGSNANISGKGITKASNCVIS"
FT   assembly_gap    1719668..1719687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1739810..1740869)
FT                   /locus_tag="mCG_123854"
FT                   /note="gene_id=mCG123854.0"
FT   mRNA            complement(join(1739810..1739882,1739971..1740310,
FT                   1740833..1740869))
FT                   /locus_tag="mCG_123854"
FT                   /product="mCG123854"
FT                   /note="gene_id=mCG123854.0 transcript_id=mCT125090.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(join(1739827..1739882,1739971..1740049))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123854"
FT                   /product="mCG123854"
FT                   /note="gene_id=mCG123854.0 transcript_id=mCT125090.0
FT                   protein_id=mCP83116.1"
FT                   /protein_id="EDL04597.1"
FT                   /translation="MRGMQAGEQEDWEYHSLGHMDDSQLEGRHILYLEHSSSGVHVSI"
FT   gene            complement(1742977..>1743594)
FT                   /locus_tag="mCG_141058"
FT                   /note="gene_id=mCG141058.0"
FT   mRNA            complement(join(1742977..1743004,1743202..>1743594))
FT                   /locus_tag="mCG_141058"
FT                   /product="mCG141058"
FT                   /note="gene_id=mCG141058.0 transcript_id=mCT172881.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(1743217..>1743594)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141058"
FT                   /product="mCG141058"
FT                   /note="gene_id=mCG141058.0 transcript_id=mCT172881.0
FT                   protein_id=mCP95800.0"
FT                   /protein_id="EDL04596.1"
FT                   /translation="TEAIHYFPSPSPPAGRPDTGTGRHVLPTVVHNASSLPLTGCLCRC
FT                   PCPSLVLVVPKVFSERKERRSWLGGLEGLHCGLLPLCHSACSGGLTRVYSRRCLCHTHS
FT                   PSAWTGHCKGRWLLVLELKPT"
FT   assembly_gap    1748703..1748991
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   gene            1754505..1973722
FT                   /gene="Tnrc6b"
FT                   /locus_tag="mCG_145767"
FT                   /note="gene_id=mCG145767.0"
FT   mRNA            join(1754505..1754934,1791198..1791265,1803332..1803422,
FT                   1828565..1828632,1902394..1902481,1908098..1908119,
FT                   1920021..1920365,1922570..1924909,1926626..1926805,
FT                   1927910..1928085,1930662..1930736,1931533..1931578,
FT                   1932722..1932858,1938032..1938157,1945584..1945715,
FT                   1945988..1946086,1946220..1946412,1956934..1957071,
FT                   1960314..1960490,1961582..1961728,1962142..1962237,
FT                   1967088..1967312,1967716..1967786,1971249..1971388,
FT                   1972732..1973722)
FT                   /gene="Tnrc6b"
FT                   /locus_tag="mCG_145767"
FT                   /product="trinucleotide repeat containing 6b, transcript
FT                   variant mCT185830"
FT                   /note="gene_id=mCG145767.0 transcript_id=mCT185830.0
FT                   created on 16-JUN-2003"
FT   assembly_gap    1754973..1755295
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    1776678..1776918
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    1784504..1785076
FT                   /estimated_length=573
FT                   /gap_type="unknown"
FT   CDS             join(1803378..1803422,1828565..1828632,1902394..1902481,
FT                   1908098..1908119,1920021..1920365,1922570..1924909,
FT                   1926626..1926805,1927910..1928085,1930662..1930736,
FT                   1931533..1931578,1932722..1932858,1938032..1938157,
FT                   1945584..1945715,1945988..1946086,1946220..1946412,
FT                   1956934..1957071,1960314..1960490,1961582..1961728,
FT                   1962142..1962237,1967088..1967312,1967716..1967786,
FT                   1971249..1971388,1972732..1973119)
FT                   /codon_start=1
FT                   /gene="Tnrc6b"
FT                   /locus_tag="mCG_145767"
FT                   /product="trinucleotide repeat containing 6b, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG145767.0 transcript_id=mCT185830.0
FT                   protein_id=mCP107089.0 isoform=CRA_a"
FT                   /protein_id="EDL04593.1"
FT                   /translation="MQTNEGEVEEESSSQVEQEDFVMEGHGKTPPPGEESKQEKEQERE
FT                   EQLMEDKKRKKEDKKKKEATQKVTEQKTKVPEVTKPSLSQPTAASPIGSSPSPPVNGGN
FT                   NAKRVAVPNGQPPSAARYMPREVPPRFRCQQDHKVLLKRGQPPPPSCMLLGGGAGPPPC
FT                   TAPGANPNNNAQVTGALLQSESGTAPESTLGGAAASNYANSTWGPGASSNSGASPNPIH
FT                   IWDKVIVDGSDMEEWPCIASKDTESSSENTTDNNSASNPGSEKSSLPGSTTSNKGKGSQ
FT                   CQAASSGNECNLGVWKSDPKAKSVQPPNSTSDSNNGLGNWRSTSGQDRIGPGSGFSNFN
FT                   PNSNPSAWPALVQEGTSRKGALETESSSSSAQVSTVGQASREQQSKMENAGVNFVVSGR
FT                   EQAQIHNTDGPKNGNTNSLNLSSPNPMENKGMPFGMGLGNTSRSTDAPSQSTGDRKTGS
FT                   VGSWGAARGPSGTDTVSGQSNSGNNGNNGKDREDSWKGASVPKPTGSKSDSWDNNNRST
FT                   GGSWNFGPQDNNDNKWGEGNKMTSGVSQGEWKQPTGSDELKIGEWSGPNQPNSSTGAWD
FT                   NQKGHPLPENQGNAQAPCWGRSSSSAGSEVGGQSTGSNHKAGSSDSHNSGRRSYRPTHP
FT                   DCQAVLQTLLSRTDLDPRVLSNTGWGQTQIKQDTVWDIEEVPRPEGKSDKGTEGWESAA
FT                   TQTKNSGGWGDAPSQSNQMKSGWGELSASTEWKDPKSTGGWNDYKNNNSSNWGGGRADE
FT                   KTPSSWNESSCKDQGWGGGRQPNQGWTSGKNGWGEEVDQVKNNNWESSANKPVSGWGEG
FT                   GQNEIGTWGNGGNTNLASKGGWEDCKRSPAWNETGRQPNSWNKQHQQQQQPPPPQPEAS
FT                   GSWGGPPPPPQGNVRPSNSNWSSGPQPTTPKDDEPSGWEEPSPQSISRKMDIDDGTSAW
FT                   GDPNSYNYKNVNLWDKNSQGGPAPREPNLPTPMTGKSASDTHFFFAVWSKSTPPAPDNG
FT                   TSAWGEPNESSPGWGEMDDAGASTTGWGNTPANAPNAMKPNSKSMQDGWGESDGPVTGA
FT                   RHPSWEEEDDGGVWNTAGSQGSTSSHNSASWGQGGKKQMKCSLKGGNNDSWMNPLAKQF
FT                   SNMGLLSQTEDNPSSKMDLSVDKKFDVDKRTMNLGDFNDIMRKDRPGFRPPNSKDLGTT
FT                   DSGPYFEKGGSHGLFGNSTAQSRGLHTPVQPLSSSPGLRAQVPPQFISPQVSASMLKQF
FT                   PNSGLNPGLFNVGPQLSPQQIAMLSQLPQIPQFQLACQLLLQQQQQQQQLLQNQRKISQ
FT                   AVRQQQEQQLARMVSALQQQQQQQQQQQRQPSMKHSPSHPVGPKPHLDNMVPNALNVGL
FT                   PDLPTKGPIPGYGSGFSSGGMDYGMVGGKEAGTESRFKQWTSMMEGLPSVATQEATMHK
FT                   NGAIVAPGKTRGGSPYNQFDIIPGDTLGGHTGPAGDSWLPAKSPPTNKIGSKSSNASWP
FT                   PEFQPGVPWKGIQNIDPESDPYVTPGSVLGGTTTSPIVDTDHQLLRDNTTGSNSSLNTS
FT                   LPSPGAWPYSASDNSFTNVHSTSAKFPDYKSTWSPDPIGHNPTHLSNKMWKNHISSRNT
FT                   TPLTRPPPGLTNPKPASPWSSTAPRSVRGWGTQDSRIASASTWSDGGSVRPSYWLVLHN
FT                   LTPQIDGSTLRTICMQHGPLLTFHLNLTQGTALIRYSTKQEAAKAQTALHMCVLGNTTI
FT                   LAEFATEDEVSRFLAQAQPPTPAATPSAPATGWQSLETSQNQADPVGPALNLFGGSTGL
FT                   GQWSSSAGGSSGADLAGTSLWGPPNYSSSLWGVPTVEDPHRMGSPAPLLPGDLLGGGSD
FT                   SI"
FT   assembly_gap    1826281..1826300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1834041..1834369
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   mRNA            join(1842562..1842725,1902394..1902481,1908098..1908119,
FT                   1920021..1920365,1922570..1925191)
FT                   /gene="Tnrc6b"
FT                   /locus_tag="mCG_145767"
FT                   /product="trinucleotide repeat containing 6b, transcript
FT                   variant mCT185831"
FT                   /note="gene_id=mCG145767.0 transcript_id=mCT185831.0
FT                   created on 16-JUN-2003"
FT   CDS             join(1842721..1842725,1902394..1902481,1908098..1908119,
FT                   1920021..1920365,1922570..1924941)
FT                   /codon_start=1
FT                   /gene="Tnrc6b"
FT                   /locus_tag="mCG_145767"
FT                   /product="trinucleotide repeat containing 6b, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG145767.0 transcript_id=mCT185831.0
FT                   protein_id=mCP107088.0 isoform=CRA_b"
FT                   /protein_id="EDL04594.1"
FT                   /translation="MREKEQEREEQLMEDKKRKKEDKKKKEATQKVTEQKTKVPEVTKP
FT                   SLSQPTAASPIGSSPSPPVNGGNNAKRVAVPNGQPPSAARYMPREVPPRFRCQQDHKVL
FT                   LKRGQPPPPSCMLLGGGAGPPPCTAPGANPNNNAQVTGALLQSESGTAPESTLGGAAAS
FT                   NYANSTWGPGASSNSGASPNPIHIWDKVIVDGSDMEEWPCIASKDTESSSENTTDNNSA
FT                   SNPGSEKSSLPGSTTSNKGKGSQCQAASSGNECNLGVWKSDPKAKSVQPPNSTSDSNNG
FT                   LGNWRSTSGQDRIGPGSGFSNFNPNSNPSAWPALVQEGTSRKGALETESSSSSAQVSTV
FT                   GQASREQQSKMENAGVNFVVSGREQAQIHNTDGPKNGNTNSLNLSSPNPMENKGMPFGM
FT                   GLGNTSRSTDAPSQSTGDRKTGSVGSWGAARGPSGTDTVSGQSNSGNNGNNGKDREDSW
FT                   KGASVPKPTGSKSDSWDNNNRSTGGSWNFGPQDNNDNKWGEGNKMTSGVSQGEWKQPTG
FT                   SDELKIGEWSGPNQPNSSTGAWDNQKGHPLPENQGNAQAPCWGRSSSSAGSEVGGQSTG
FT                   SNHKAGSSDSHNSGRRSYRPTHPDCQAVLQTLLSRTDLDPRVLSNTGWGQTQIKQDTVW
FT                   DIEEVPRPEGKSDKGTEGWESAATQTKNSGGWGDAPSQSNQMKSGWGELSASTEWKDPK
FT                   STGGWNDYKNNNSSNWGGGRADEKTPSSWNESSCKDQGWGGGRQPNQGWTSGKNGWGEE
FT                   VDQVKNNNWESSANKPVSGWGEGGQNEIGTWGNGGNTNLASKGGWEDCKRSPAWNETGR
FT                   QPNSWNKQHQQQQQPPPPQPEASGSWGGPPPPPQGNVRPSNSNWSSGPQPTTPKDDEPS
FT                   GWEEPSPQSISRKMDIDDGTSAWGDPNSYNYKNVNLWDKNSQGGPAPREPNLPTPMTGK
FT                   SASGRYQLFSHRS"
FT   assembly_gap    1860524..1860563
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    1968342..1968396
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    1972466..1972568
FT                   /estimated_length=103
FT                   /gap_type="unknown"
FT   assembly_gap    1974056..1974835
FT                   /estimated_length=780
FT                   /gap_type="unknown"
FT   gene            1992398..2012969
FT                   /gene="Adsl"
FT                   /locus_tag="mCG_11489"
FT                   /note="gene_id=mCG11489.2"
FT   mRNA            join(1992398..1992584,1996087..1996290,1999510..1999554,
FT                   2000103..2000182,2004285..2004456,2005246..2005292,
FT                   2006587..2006677,2007550..2007619,2007770..2007917,
FT                   2009782..2009872,2010802..2010891,2011279..2011455,
FT                   2012352..2012969)
FT                   /gene="Adsl"
FT                   /locus_tag="mCG_11489"
FT                   /product="adenylosuccinate lyase"
FT                   /note="gene_id=mCG11489.2 transcript_id=mCT11529.2 created
FT                   on 23-AUG-2002"
FT   CDS             join(1992432..1992584,1996087..1996290,1999510..1999554,
FT                   2000103..2000182,2004285..2004456,2005246..2005292,
FT                   2006587..2006677,2007550..2007619,2007770..2007917,
FT                   2009782..2009872,2010802..2010891,2011279..2011455,
FT                   2012352..2012438)
FT                   /codon_start=1
FT                   /gene="Adsl"
FT                   /locus_tag="mCG_11489"
FT                   /product="adenylosuccinate lyase"
FT                   /note="gene_id=mCG11489.2 transcript_id=mCT11529.2
FT                   protein_id=mCP10076.1"
FT                   /db_xref="GOA:P54822"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="MGI:MGI:103202"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54822"
FT                   /protein_id="EDL04592.1"
FT                   /translation="MAASGDPGSAESYRSPLAARYASREMCFLFSDRYKFQTWRQLWLW
FT                   LAEAEQTLGLPITDEQIQEMKSNLNNIDFQMAAEEEKRLRHDVMAHVHTFGHCCPKAAG
FT                   IIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKDRADLPTLGFTHFQPA
FT                   QLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDHQKVEQL
FT                   DKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEP
FT                   FEKQQIGSSAMPYKRNPMRSERCCSLARHLMALTMDPLQTASVQWFERTLDDSANRRIC
FT                   LAEAFLTADTILNTLQNISEGLVVYPKVIERRIRQELPFMATENIIMAMVKAGGSRQDC
FT                   HEKIRVLSQQAAAVVKQEGGDNDLIERIRADAYFSPIHSQLEHLLDPSSFTGRAPQQVH
FT                   RFLEEEVRPLLKPYGNEMAVKAELCL"
FT   gene            2021491..2055813
FT                   /gene="Rutbc3"
FT                   /locus_tag="mCG_11493"
FT                   /note="gene_id=mCG11493.1"
FT   mRNA            join(2021491..2021560,2046092..2046187,2046883..2046968,
FT                   2047327..2047393,2049930..2050135,2050229..2050336,
FT                   2050970..2051113,2051374..2051569,2051812..2051957,
FT                   2052207..2052431,2052747..2052801,2052930..2053057,
FT                   2053157..2053312,2053464..2053518,2053752..2053801,
FT                   2053933..2054085,2054240..2054310,2054384..2054432,
FT                   2054509..2054594,2054761..2054883,2055009..2055045,
FT                   2055179..2055813)
FT                   /gene="Rutbc3"
FT                   /locus_tag="mCG_11493"
FT                   /product="RUN and TBC1 domain containing 3, transcript
FT                   variant mCT11533"
FT                   /note="gene_id=mCG11493.1 transcript_id=mCT11533.2 created
FT                   on 23-AUG-2002"
FT   mRNA            join(<2021500..2021560,2046092..2046187,2046883..2046968,
FT                   2047327..2047393,2049930..2050135,2050229..2050336,
FT                   2050970..2051113,2051374..2051569,2051812..2051957,
FT                   2052207..2052431,2052747..2052801,2052930..2053057,
FT                   2053157..2053312,2053464..2053518,2053752..2053801,
FT                   2053933..2054085,2054240..2054310,2054384..2054432,
FT                   2054509..2054594,2054761..2054883,2054985..2055045,
FT                   2055179..2055593)
FT                   /gene="Rutbc3"
FT                   /locus_tag="mCG_11493"
FT                   /product="RUN and TBC1 domain containing 3, transcript
FT                   variant mCT189662"
FT                   /note="gene_id=mCG11493.1 transcript_id=mCT189662.0 created
FT                   on 08-MAR-2004"
FT   assembly_gap    2027829..2028016
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    2034961..2035031
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    2044550..2044569
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<2046133..2046187,2046883..2046968,2047327..2047393,
FT                   2049930..2050135,2050229..2050336,2050970..2051113,
FT                   2051374..2051569,2051812..2051957,2052207..2052431,
FT                   2052747..2052801,2052930..2053057,2053157..2053312,
FT                   2053464..2053518,2053752..2053801,2053933..2054085,
FT                   2054240..2054310,2054384..2054432,2054509..2054594,
FT                   2054761..2054883,2054985..2055045,2055179..2055259)
FT                   /codon_start=1
FT                   /gene="Rutbc3"
FT                   /locus_tag="mCG_11493"
FT                   /product="RUN and TBC1 domain containing 3, isoform CRA_b"
FT                   /note="gene_id=mCG11493.1 transcript_id=mCT189662.0
FT                   protein_id=mCP110638.0 isoform=CRA_b"
FT                   /protein_id="EDL04591.1"
FT                   /translation="PLVPRPMKSCRRPQHMMSGNHTPSASGPFSALTPSIWPQEILAKY
FT                   SQKEESSEQPELCYDEFGFRVDKEGSEPGCSQMTGSPLVEDPPQRLRWQAHLEFTHNHD
FT                   VGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKKNSELSYREIIKN
FT                   SSNDETIAAKQIEKDLLRTMPSNACFANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGM
FT                   VAACLLLFLEEEDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKL
FT                   LQEHDIELSLITLHWFLTAFASVVHIRLLLRIWDLFFYEGSLVLFQTTLGMLRLKEEEL
FT                   IQSENSASIFNTLSDIPAQMDDAELLLGEAMRLAGSLTDVAVETQRRKHLAYLIADQGQ
FT                   TLGTGTTTNLSQVVRRRTQRRKSGITSLLFGEDDLEALKAKNIKQTELVADLREAILRV
FT                   ARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACLRSHRRRAKALLDFERHDDDELGF
FT                   RKNDIITIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLV
FT                   RGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFDSVYSRLVLCKTYRL
FT                   DEDGKVLTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSL
FT                   PTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELPARREEEKQPLKEGVQDM
FT                   LVKHHLFSWDIDG"
FT   CDS             join(2046151..2046187,2046883..2046968,2047327..2047393,
FT                   2049930..2050135,2050229..2050336,2050970..2051113,
FT                   2051374..2051569,2051812..2051957,2052207..2052431,
FT                   2052747..2052801,2052930..2053057,2053157..2053312,
FT                   2053464..2053518,2053752..2053801,2053933..2054085,
FT                   2054240..2054310,2054384..2054432,2054509..2054594,
FT                   2054761..2054883,2055009..2055045,2055179..2055259)
FT                   /codon_start=1
FT                   /gene="Rutbc3"
FT                   /locus_tag="mCG_11493"
FT                   /product="RUN and TBC1 domain containing 3, isoform CRA_a"
FT                   /note="gene_id=mCG11493.1 transcript_id=mCT11533.2
FT                   protein_id=mCP10041.2 isoform=CRA_a"
FT                   /protein_id="EDL04590.1"
FT                   /translation="MKSCRRPQHMMSGNHTPSASGPFSALTPSIWPQEILAKYSQKEES
FT                   SEQPELCYDEFGFRVDKEGSEPGCSQMTGSPLVEDPPQRLRWQAHLEFTHNHDVGDLTW
FT                   DKIAVSLPRSEKLRSLVLAGIPHGMRPQLWMRLSGALQKKKNSELSYREIIKNSSNDET
FT                   IAAKQIEKDLLRTMPSNACFANVNSIGVPRLRRVLRALAWLYPEIGYCQGTGMVAACLL
FT                   LFLEEEDAFWMMCAIIEDLLPASYFSTTLLGVQTDQRVLRHLIVQYLPRLDKLLQEHDI
FT                   ELSLITLHWFLTAFASVVHIRLLLRIWDLFFYEGSLVLFQTTLGMLRLKEEELIQSENS
FT                   ASIFNTLSDIPAQMDDAELLLGEAMRLAGSLTDVAVETQRRKHLAYLIADQGQTLGTGT
FT                   TTNLSQVVRRRTQRRKSGITSLLFGEDDLEALKAKNIKQTELVADLREAILRVARHFQC
FT                   TDPKNCSVELTPDYSMESHQRDHENYVACLRSHRRRAKALLDFERHDDDELGFRKNDII
FT                   TIISQKDEHCWVGELNGLRGWFPAKFVEVLDERSKEYSIAGDDSVTEGVTDLVRGTLCP
FT                   ALKALFEHGLKKPSLLGGACHPWLFIEEAAGREVERDFDSVYSRLVLCKTYRLDEDGKV
FT                   LTPEELLYRAVQSVNVTHDAAHAQMDVKLRSLICVGLNEQVLHLWLEVLCSSLPTVEKW
FT                   YQPWSFLRSPGWVQIKCELRLSQDWELPARREEEKQPLKEGVQDMLVKHHLFSWDIDG"
FT   gene            complement(2055807..>2231395)
FT                   /gene="Mkl1"
FT                   /locus_tag="mCG_8802"
FT                   /note="gene_id=mCG8802.1"
FT   mRNA            complement(join(2055807..2057333,2058880..2058940,
FT                   2059290..2059442,2059762..2060757,2061482..2061650,
FT                   2061745..2062010,2063696..2063845,2064284..2064459,
FT                   2065928..2066089,2067047..2067122,2073968..2074023,
FT                   2090965..2091030,2163475..2163736,2231378..>2231395))
FT                   /gene="Mkl1"
FT                   /locus_tag="mCG_8802"
FT                   /product="MKL (megakaryoblastic leukemia)/myocardin-like 1"
FT                   /note="gene_id=mCG8802.1 transcript_id=mCT9245.2 created on
FT                   06-SEP-2002"
FT   CDS             complement(join(2056816..2057333,2058880..2058940,
FT                   2059290..2059442,2059762..2060757,2061482..2061650,
FT                   2061745..2062010,2063696..2063845,2064284..2064459,
FT                   2065928..2066089,2067047..2067122,2073968..2074023,
FT                   2090965..2091030,2163475..2163736,2231378..>2231395))
FT                   /codon_start=1
FT                   /gene="Mkl1"
FT                   /locus_tag="mCG_8802"
FT                   /product="MKL (megakaryoblastic leukemia)/myocardin-like 1"
FT                   /note="gene_id=mCG8802.1 transcript_id=mCT9245.2
FT                   protein_id=mCP13120.2"
FT                   /protein_id="EDL04588.1"
FT                   /translation="QEANEAVTITKAKVDFSSVVCLPPSVIAVNGLDGGGAGENDDEPV
FT                   LLSLSAAPSPQSEAVANELQELSLQPELTLGLHPGRNPNLPPLSERKNVLQLKLQQRRT
FT                   REELVSQGIMPPLKSPAAFHEQRRSLERARTEDYLKRKIRSRPERAELVRMHILEETSA
FT                   EPSLQAKQLKLKRARLADDLNEKIAQRPGPMELVEKNILPVESSLKEAIIVGQVNYPKV
FT                   ADSSSFDEDSSDALSPEQPASHESQGSVPSPLESRVSDPLPSATSISPTQVLSQLPMAP
FT                   DPGETLFLAEQPPLPPAPLLPPSLANGSIVPTAKPAPTLIKQSQPKSASEKSQRSKKAK
FT                   ELKPKVKKLKYHQYIPPDQKQDKGAPAMDSSYAKILQQQQLFLQLQILNQQQQQQQQQH
FT                   YNYQAILPAPPKPSAETPGSSAPTPSRSLSTSSSPSSGTPGPSGLARQSSTALAAKPGA
FT                   LPANLDDMKVAELKQELKLRSLPVSGTKTELIERLRAYQDQVSPAPGAPKAPATTSVLS
FT                   KAGEVVVAFPAALLSTGSALVTAGLAPAEMVVATVTSNGMVKFGSTGSTPPVSPTPSER
FT                   SLLSTGDENSTPGDAFGEMVTSPLTQLTLQASPLQIVKEEGARAASCCLSPGARAELEG
FT                   LDKDQMLQEKDKQIEELTRMLQQKQQLVELLRLQLEQQKRAQQPAPASSPVKRESGFSS
FT                   CQLSCQPQGSAHAFGSGLVVPTTNHGDTQAPAPESPPVVVKQEAGPPEPDLAPSSQLLL
FT                   GSQGTSFLKRVSPPTLVTDSTGTHLILTVTNKSADGPGLPAGSPQQPLSQPGSPAPGPP
FT                   AQMDLEHPPQPPFATPTSLLKKEPPGYEETVTQQPKQQENGSSSQHMDDLFDILIQSGE
FT                   ISADFKEPPSLPGKEKSPPAAAAYGPPLTPQPSPLSELPQAAPPPGSPTLPGRLEDFLE
FT                   SSTGLPLLTSGHEGPEPLSLIDDLHSQMLSSSAILDHPPSPMDTSELHFAPEPSSGMGL
FT                   DLAVGHLDSMDWLELSSGGPVLSLAPLSTAAPSLFSMDFLDGHDLQLHWDSCL"
FT   assembly_gap    2069397..2069416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2070840..2070859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2071905..2071924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2073216..2073235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2075470..2076804
FT                   /estimated_length=1335
FT                   /gap_type="unknown"
FT   assembly_gap    2087082..2087101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2093711..2093730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2106233..2106257
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    2120307..2121818
FT                   /estimated_length=1512
FT                   /gap_type="unknown"
FT   gene            complement(2141055..>2145591)
FT                   /locus_tag="mCG_146058"
FT                   /note="gene_id=mCG146058.0"
FT   mRNA            complement(join(2141055..2142547,2143054..2143169,
FT                   2143389..>2145591))
FT                   /locus_tag="mCG_146058"
FT                   /product="mCG146058"
FT                   /note="gene_id=mCG146058.0 transcript_id=mCT186161.0
FT                   created on 14-JUL-2003"
FT   assembly_gap    2143031..2143050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(2144558..>2145079)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146058"
FT                   /product="mCG146058"
FT                   /note="gene_id=mCG146058.0 transcript_id=mCT186161.0
FT                   protein_id=mCP107771.0"
FT                   /protein_id="EDL04589.1"
FT                   /translation="LVSSYFKHIHMSRFCVGEKLWWFVLFLESGAISLSMVVFYSICLP
FT                   GNDIILVCVCVCVCARLRERQTDRERWGRKSDTYLFICMEAKVGSGCLPFLLSTLFVCV
FT                   FVCLFFNFGDKISYCPGAHSYRWSESLWGFSCLCLPITWIIVTALTGLGSKGVHACMAN
FT                   ILSSQPPQSN"
FT   assembly_gap    2193762..2193781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2231620..2231665
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            2231768..2233571
FT                   /gene="4930483J18Rik"
FT                   /locus_tag="mCG_125846"
FT                   /note="gene_id=mCG125846.0"
FT   mRNA            join(2231768..2231921,2232733..2233571)
FT                   /gene="4930483J18Rik"
FT                   /locus_tag="mCG_125846"
FT                   /product="RIKEN cDNA 4930483J18"
FT                   /note="gene_id=mCG125846.0 transcript_id=mCT127109.0
FT                   created on 22-AUG-2002"
FT   CDS             2233084..2233239
FT                   /codon_start=1
FT                   /gene="4930483J18Rik"
FT                   /locus_tag="mCG_125846"
FT                   /product="RIKEN cDNA 4930483J18"
FT                   /note="gene_id=mCG125846.0 transcript_id=mCT127109.0
FT                   protein_id=mCP83547.1"
FT                   /protein_id="EDL04587.1"
FT                   /translation="MQEHLQSTSPVLRGSCKIAVLLQGQSCWTQGKRKKVLWRTESPVW
FT                   EQGLTL"
FT   assembly_gap    2241475..2241494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2249383..2249853)
FT                   /pseudo
FT                   /locus_tag="mCG_1027574"
FT                   /note="gene_id=mCG1027574.1"
FT   mRNA            complement(2249383..2249853)
FT                   /pseudo
FT                   /locus_tag="mCG_1027574"
FT                   /note="gene_id=mCG1027574.1 transcript_id=mCT145278.1
FT                   created on 04-OCT-2002"
FT   assembly_gap    2252127..2252957
FT                   /estimated_length=831
FT                   /gap_type="unknown"
FT   assembly_gap    2255626..2255772
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    2256568..2256587
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <2276324..2278863
FT                   /gene="Mchr1"
FT                   /locus_tag="mCG_8797"
FT                   /note="gene_id=mCG8797.0"
FT   mRNA            join(<2276324..2276556,2277822..2278863)
FT                   /gene="Mchr1"
FT                   /locus_tag="mCG_8797"
FT                   /product="melanin-concentrating hormone receptor 1"
FT                   /note="gene_id=mCG8797.0 transcript_id=mCT9240.1 created on
FT                   06-SEP-2002"
FT   CDS             join(<2276346..2276556,2277822..2278801)
FT                   /codon_start=1
FT                   /gene="Mchr1"
FT                   /locus_tag="mCG_8797"
FT                   /product="melanin-concentrating hormone receptor 1"
FT                   /note="gene_id=mCG8797.0 transcript_id=mCT9240.1
FT                   protein_id=mCP13097.0"
FT                   /protein_id="EDL04586.1"
FT                   /translation="RKTLFWTAGLKLRTRRWRALEAAAACVGGRALHSREQATCTGCMD
FT                   LQASLLSTGPNASNISDGQDNFTLAGPPPRTRSVSYINIIMPSVFGTICLLGIVGNSTV
FT                   IFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
FT                   AMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVW
FT                   LYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSS
FT                   VAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAI
FT                   SLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT"
FT   gene            complement(2283353..2292395)
FT                   /locus_tag="mCG_1027791"
FT                   /note="gene_id=mCG1027791.1"
FT   mRNA            complement(join(2283353..2284110,2288220..2288465))
FT                   /locus_tag="mCG_1027791"
FT                   /product="mCG1027791, transcript variant mCT145495"
FT                   /note="gene_id=mCG1027791.1 transcript_id=mCT145495.0
FT                   created on 29-AUG-2002"
FT   mRNA            complement(join(2283399..2284110,2292245..2292395))
FT                   /locus_tag="mCG_1027791"
FT                   /product="mCG1027791, transcript variant mCT172880"
FT                   /note="gene_id=mCG1027791.1 transcript_id=mCT172880.0
FT                   created on 29-AUG-2002"
FT   CDS             complement(2283826..2283978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027791"
FT                   /product="mCG1027791, isoform CRA_a"
FT                   /note="gene_id=mCG1027791.1 transcript_id=mCT145495.0
FT                   protein_id=mCP83090.1 isoform=CRA_a"
FT                   /protein_id="EDL04584.1"
FT                   /translation="MKTEPMKMCSTSLIMRQQRPIRTNLNRFHLREGEEKEDEKGQSRY
FT                   KGIEN"
FT   CDS             complement(2283826..2283978)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027791"
FT                   /product="mCG1027791, isoform CRA_a"
FT                   /note="gene_id=mCG1027791.1 transcript_id=mCT172880.0
FT                   protein_id=mCP95799.0 isoform=CRA_a"
FT                   /protein_id="EDL04585.1"
FT                   /translation="MKTEPMKMCSTSLIMRQQRPIRTNLNRFHLREGEEKEDEKGQSRY
FT                   KGIEN"
FT   assembly_gap    2287140..2287159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2300101..2300164
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    2308533..2308674
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    2318997..2319016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2324334..2324542
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    2347893..2347912
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2349587..2349606
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2350916..2350935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2360501..2402322)
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /note="gene_id=mCG8798.2"
FT   mRNA            complement(join(2360501..2361369,2365194..2365276,
FT                   2368625..2368720,2368801..2368946,2370634..2370750,
FT                   2379520..2379671,2381558..2381624,2385685..2385745,
FT                   2386490..2386550,2402148..2402262))
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, transcript
FT                   variant mCT172939"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT172939.0 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(2360501..2361369,2365194..2365276,
FT                   2368625..2368720,2370634..2370750,2379520..2379671,
FT                   2381558..2381624,2385685..2385745,2402148..2402252))
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, transcript
FT                   variant mCT172940"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT172940.0 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(2360501..2361369,2365194..2365276,
FT                   2368625..2368720,2368801..2368946,2370634..2370750,
FT                   2379520..2379671,2381558..2381624,2384890..2384976,
FT                   2385685..2385745,2402148..2402252))
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, transcript
FT                   variant mCT172938"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT172938.0 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(2360512..2361369,2365194..2365276,
FT                   2368625..2368720,2368801..2368946,2370634..2370750,
FT                   2379520..2379671,2385685..2385745,2402148..2402275))
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, transcript
FT                   variant mCT172937"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT172937.0 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(2360513..2361369,2365194..2365276,
FT                   2368625..2368720,2368801..2368946,2370634..2370750,
FT                   2379520..2379671,2381558..2381624,2385685..2385745,
FT                   2402148..2402322))
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, transcript
FT                   variant mCT9241"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT9241.2 created on
FT                   28-AUG-2002"
FT   CDS             complement(join(2361222..2361369,2365194..2365276,
FT                   2368625..2368720,2368801..2368946,2370634..2370750,
FT                   2379520..2379671,2381558..2381624,2385685..2385745,
FT                   2402148..2402201))
FT                   /codon_start=1
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, isoform CRA_e"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT9241.2
FT                   protein_id=mCP13115.2 isoform=CRA_e"
FT                   /protein_id="EDL04582.1"
FT                   /translation="MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKS
FT                   KTTHAVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKAVWVKGQRSSTGKD
FT                   LVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIIPTNYKGIIDAFHQIIRDEGIL
FT                   ALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAIAKAIATTVTYP
FT                   MQTVQSILRFGRHRLNPENRTLGSLRNVLSLLHQRVKRFGIMGLYKGLEAKLLQTVLTA
FT                   ALMFLVYEKLTAATFTVMGLKSTHKH"
FT   CDS             complement(join(2361222..2361369,2365194..2365276,
FT                   2368625..2368720,2368801..2368946,2370634..2370750,
FT                   2379520..2379671,2381558..2381624,2385685..2385730))
FT                   /codon_start=1
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, isoform CRA_c"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT172939.0
FT                   protein_id=mCP95858.0 isoform=CRA_c"
FT                   /protein_id="EDL04580.1"
FT                   /translation="MTVFFPLDTARLRLQVDEKRKSKTTHAVLLEIIKEEGLLAPYRGW
FT                   FPVISSLCCSNFVYFYTFNSLKAVWVKGQRSSTGKDLVVGFVAGVVNVLLTTPLWVVNT
FT                   RLKLQGAKFRNEDIIPTNYKGIIDAFHQIIRDEGILALWNGTFPSLLLVFNPAIQFMFY
FT                   EGLKRQLLKKRMKLSSLDVFIIGAIAKAIATTVTYPMQTVQSILRFGRHRLNPENRTLG
FT                   SLRNVLSLLHQRVKRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKST
FT                   HKH"
FT   CDS             complement(join(2361222..2361369,2365194..2365276,
FT                   2368625..2368720,2368801..2368946,2370634..2370750,
FT                   2379520..2379671,2381558..2381624,2384890..2384950))
FT                   /codon_start=1
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, isoform CRA_b"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT172938.0
FT                   protein_id=mCP95859.0 isoform=CRA_b"
FT                   /protein_id="EDL04579.1"
FT                   /translation="MYSLCFRVIDFQTRTMYCMMVDEKRKSKTTHAVLLEIIKEEGLLA
FT                   PYRGWFPVISSLCCSNFVYFYTFNSLKAVWVKGQRSSTGKDLVVGFVAGVVNVLLTTPL
FT                   WVVNTRLKLQGAKFRNEDIIPTNYKGIIDAFHQIIRDEGILALWNGTFPSLLLVFNPAI
FT                   QFMFYEGLKRQLLKKRMKLSSLDVFIIGAIAKAIATTVTYPMQTVQSILRFGRHRLNPE
FT                   NRTLGSLRNVLSLLHQRVKRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVM
FT                   GLKSTHKH"
FT   CDS             complement(join(2361222..2361369,2365194..2365276,
FT                   2368625..2368720,2368801..2368848))
FT                   /codon_start=1
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, isoform CRA_a"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT172937.0
FT                   protein_id=mCP95856.0 isoform=CRA_a"
FT                   /protein_id="EDL04578.1"
FT                   /translation="MFYEGLKRQLLKKRMKLSSLDVFIIGAIAKAIATTVTYPMQTVQS
FT                   ILRFGRHRLNPENRTLGSLRNVLSLLHQRVKRFGIMGLYKGLEAKLLQTVLTAALMFLV
FT                   YEKLTAATFTVMGLKSTHKH"
FT   CDS             complement(join(2365263..2365276,2368625..2368720,
FT                   2370634..2370750,2379520..2379671,2381558..2381624,
FT                   2385685..2385745,2402148..2402201))
FT                   /codon_start=1
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, isoform CRA_f"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT172940.0
FT                   protein_id=mCP95857.0 isoform=CRA_f"
FT                   /protein_id="EDL04583.1"
FT                   /translation="MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKS
FT                   KTTHAVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKAVWVKGQRSSTGKD
FT                   LVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIIPTNYKGIIALFSGCVHHWRNS
FT                   QSDCHHSHLSHADGTVNSEVWTS"
FT   mRNA            complement(join(<2368654..2368720,2368801..2368946,
FT                   2370634..2370747,2379520..2379671,2381558..2381624,
FT                   2385685..2385745,2402148..>2402286))
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, transcript
FT                   variant mCT189767"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT189767.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<2368654..2368720,2368801..2368946,
FT                   2370634..2370747,2379520..2379671,2381558..2381624,
FT                   2385685..2385745,2402148..>2402258))
FT                   /codon_start=1
FT                   /gene="Slc25a17"
FT                   /locus_tag="mCG_8798"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   peroxisomal membrane protein), member 17, isoform CRA_d"
FT                   /note="gene_id=mCG8798.2 transcript_id=mCT189767.0
FT                   protein_id=mCP110766.0 isoform=CRA_d"
FT                   /protein_id="EDL04581.1"
FT                   /translation="DGPFTNPHTLRRLSEKCGTMASVLSYESLVHAVAGAVGSVTAMTV
FT                   FFPLDTARLRLQVDEKRKSKTTHAVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYT
FT                   FNSLKAVWVKGQRSSTGKDLVVGFVAVVNVLLTTPLWVVNTRLKLQGAKFRNEDIIPTN
FT                   YKGIIDAFHQIIRDEGILALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLD
FT                   VFIIGAIAKAIATTVTY"
FT   assembly_gap    2400796..2400832
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(2405140..2441429)
FT                   /gene="St13"
FT                   /locus_tag="mCG_8795"
FT                   /note="gene_id=mCG8795.2"
FT   mRNA            complement(join(2405140..2407049,2407818..2407960,
FT                   2410865..2410913,2412929..2413045,2416275..2416377,
FT                   2419159..2419269,2419387..2419471,2424418..2424484,
FT                   2429768..2429838,2431089..2431161,2433703..2433760,
FT                   2440923..2441429))
FT                   /gene="St13"
FT                   /locus_tag="mCG_8795"
FT                   /product="suppression of tumorigenicity 13"
FT                   /note="gene_id=mCG8795.2 transcript_id=mCT9239.2 created on
FT                   22-AUG-2002"
FT   CDS             complement(join(2406921..2407049,2407818..2407960,
FT                   2410865..2410913,2412929..2413045,2416275..2416377,
FT                   2419159..2419269,2419387..2419471,2424418..2424484,
FT                   2429768..2429838,2431089..2431161,2433703..2433760,
FT                   2440923..2441032))
FT                   /codon_start=1
FT                   /gene="St13"
FT                   /locus_tag="mCG_8795"
FT                   /product="suppression of tumorigenicity 13"
FT                   /note="gene_id=mCG8795.2 transcript_id=mCT9239.2
FT                   protein_id=mCP13106.1"
FT                   /protein_id="EDL04577.1"
FT                   /translation="MDPRKVSELRAFVKMCRQDPSVLHTEEMRFLREWVESMGGKVPPA
FT                   THKAKSEENTKEEKRDKTTEENIKTEELSSEESDLEIDNEGVIEPDTDAPQEMGDENAE
FT                   ITEEMMDEANEKKGAAIEALNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKP
FT                   NAAIRDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLALACKLDYDEDASAMLRE
FT                   VQPRAQKIAEHRRKYERKREEREIKERIERVKKAREEHERAQREEEARRQSGSQYGSFP
FT                   GGFPGGMPGNFPGGMPGMGGAMPGMAGMAGMPGLNEILSDPEVLAAMQDPEVMVAFQDV
FT                   AQNPSNMSKYQSNPKVMNLISKLSAKFGGQS"
FT   assembly_gap    2421870..2421889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2441588..2494676
FT                   /gene="E430012M05Rik"
FT                   /locus_tag="mCG_8794"
FT                   /note="gene_id=mCG8794.2"
FT   mRNA            join(2441588..2441725,2455870..2455986,2468702..2469109,
FT                   2472116..2472318,2478141..2478203,2479494..2479607,
FT                   2483785..2483870,2489725..2489902,2492307..2492427,
FT                   2494271..2494656)
FT                   /gene="E430012M05Rik"
FT                   /locus_tag="mCG_8794"
FT                   /product="RIKEN cDNA E430012M05, transcript variant
FT                   mCT9238"
FT                   /note="gene_id=mCG8794.2 transcript_id=mCT9238.2 created on
FT                   06-SEP-2002"
FT   mRNA            join(2441662..2441725,2455870..2455986,2457272..2457419,
FT                   2468702..2469109,2472116..2472318,2478141..2478203,
FT                   2479494..2479607,2483785..2483870,2489725..2489902,
FT                   2492307..2492427,2494271..2494676)
FT                   /gene="E430012M05Rik"
FT                   /locus_tag="mCG_8794"
FT                   /product="RIKEN cDNA E430012M05, transcript variant
FT                   mCT172936"
FT                   /note="gene_id=mCG8794.2 transcript_id=mCT172936.0 created
FT                   on 06-SEP-2002"
FT   CDS             join(2441662..2441725,2455870..2455986,2468702..2469109,
FT                   2472116..2472318,2478141..2478203,2479494..2479607,
FT                   2483785..2483870,2489725..2489902,2492307..2492427,
FT                   2494271..2494437)
FT                   /codon_start=1
FT                   /gene="E430012M05Rik"
FT                   /locus_tag="mCG_8794"
FT                   /product="RIKEN cDNA E430012M05, isoform CRA_b"
FT                   /note="gene_id=mCG8794.2 transcript_id=mCT9238.2
FT                   protein_id=mCP13090.2 isoform=CRA_b"
FT                   /db_xref="GOA:B7ZMP1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="MGI:MGI:2445217"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7ZMP1"
FT                   /protein_id="EDL04574.1"
FT                   /translation="MPSLLSTPKLAPVLARLRGLSGCMSCLQRRYSLQPAPVKKIPNRY
FT                   LGQPSPVTHPHLLRPGEVTPGLSQVEYALRRHKLMALVHKEAQGHSGTDHTVVVLSNPT
FT                   YYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSFSGKQLPSHKAMLFVPRRDPGRELW
FT                   DGPRSGTDGAIALTGVDEAYPLEEFQHLLPKLRAETNMVWYDWMKPSHAQLHSDYMQPL
FT                   TEAKARSKNKVRSVQQLIQRLRLVKSPSEIKRMQIAGKLTSEAFIETMFASKAPIDEAF
FT                   LYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYV
FT                   SDITRTWPVNGRFTAPQAELYEAVLEIQRACLTLCSPGTSLENIYSMMLTLIGQKLKDL
FT                   GITKTSKESAFKAARKYCPHHVGHYLGMDVHDTPDMPRSLPLQPGMVITVEPGIYIPED
FT                   DRDAPEKFRGLGVRIEDDVVVTQDSPLILSADCPKEMNDIEQICSRTS"
FT   mRNA            join(<2441662..2441725,2455870..2455986,2468702..2469109,
FT                   2472116..2472318,2478141..2478203,2479494..2479607,
FT                   2483785..2483870,2492307..>2492412)
FT                   /gene="E430012M05Rik"
FT                   /locus_tag="mCG_8794"
FT                   /product="RIKEN cDNA E430012M05, transcript variant
FT                   mCT189763"
FT                   /note="gene_id=mCG8794.2 transcript_id=mCT189763.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(2441662..2441725,2455870..2455986,2468702..2469109,
FT                   2472116..2472318,2478141..2478203,2479494..2479607,
FT                   2483785..2483870,2492307..2492412)
FT                   /codon_start=1
FT                   /gene="E430012M05Rik"
FT                   /locus_tag="mCG_8794"
FT                   /product="RIKEN cDNA E430012M05, isoform CRA_a"
FT                   /note="gene_id=mCG8794.2 transcript_id=mCT189763.0
FT                   protein_id=mCP110765.0 isoform=CRA_a"
FT                   /db_xref="GOA:B7ZMP1"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR028980"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="MGI:MGI:2445217"
FT                   /db_xref="UniProtKB/Swiss-Prot:B7ZMP1"
FT                   /protein_id="EDL04573.1"
FT                   /translation="MPSLLSTPKLAPVLARLRGLSGCMSCLQRRYSLQPAPVKKIPNRY
FT                   LGQPSPVTHPHLLRPGEVTPGLSQVEYALRRHKLMALVHKEAQGHSGTDHTVVVLSNPT
FT                   YYMSNDIPYTFHQDNNFLYLCGFQEPDSILVLQSFSGKQLPSHKAMLFVPRRDPGRELW
FT                   DGPRSGTDGAIALTGVDEAYPLEEFQHLLPKLRAETNMVWYDWMKPSHAQLHSDYMQPL
FT                   TEAKARSKNKVRSVQQLIQRLRLVKSPSEIKRMQIAGKLTSEAFIETMFASKAPIDEAF
FT                   LYAKFEFECRARGADILAYPPVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYV
FT                   SDITRTWPVNGRLLENTALIMLAITSGWMSMTLQTCLGHSLCSLEW"
FT   gene            complement(2448366..2449711)
FT                   /gene="Dnajb7"
FT                   /locus_tag="mCG_8799"
FT                   /note="gene_id=mCG8799.1"
FT   mRNA            complement(2448366..2449711)
FT                   /gene="Dnajb7"
FT                   /locus_tag="mCG_8799"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 7"
FT                   /note="gene_id=mCG8799.1 transcript_id=mCT9242.1 created on
FT                   22-AUG-2002"
FT   CDS             complement(2448634..2449572)
FT                   /codon_start=1
FT                   /gene="Dnajb7"
FT                   /locus_tag="mCG_8799"
FT                   /product="DnaJ (Hsp40) homolog, subfamily B, member 7"
FT                   /note="gene_id=mCG8799.1 transcript_id=mCT9242.1
FT                   protein_id=mCP13104.1"
FT                   /protein_id="EDL04576.1"
FT                   /translation="MVDYYEVLGVQRYASPEDIKRAYRKVALKWHPDKNPENKEEAERK
FT                   FKEVAEAYEVLSNVEKRDIYDKYGKEGLDGRGASHLDDEREYRFTFRKADDVFKEIFGE
FT                   RDPFSFHLFEDSLEGLLNSSRSPSGSRGRGAGSHVSRAYDHPALSGLSSYDTGYSSYVS
FT                   LGHEGLTSFSSLALDDSGMGNYIPITPSGKVINGRNINTKKAFENRQEREAEDDSELIS
FT                   FLVNSVANEEHFTDKCNWRRQSFNNYSPNSYSSSNTTQYTLVDNNEQGTSWVTNKKEPS
FT                   IFSAGFKEGGRRKKKKHKEGQKKKKSNKRNH"
FT   assembly_gap    2456309..2456381
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   CDS             join(2468758..2469109,2472116..2472318,2478141..2478203,
FT                   2479494..2479607,2483785..2483870,2489725..2489902,
FT                   2492307..2492427,2494271..2494437)
FT                   /codon_start=1
FT                   /gene="E430012M05Rik"
FT                   /locus_tag="mCG_8794"
FT                   /product="RIKEN cDNA E430012M05, isoform CRA_c"
FT                   /note="gene_id=mCG8794.2 transcript_id=mCT172936.0
FT                   protein_id=mCP95855.0 isoform=CRA_c"
FT                   /protein_id="EDL04575.1"
FT                   /translation="MALVHKEAQGHSGTDHTVVVLSNPTYYMSNDIPYTFHQDNNFLYL
FT                   CGFQEPDSILVLQSFSGKQLPSHKAMLFVPRRDPGRELWDGPRSGTDGAIALTGVDEAY
FT                   PLEEFQHLLPKLRAETNMVWYDWMKPSHAQLHSDYMQPLTEAKARSKNKVRSVQQLIQR
FT                   LRLVKSPSEIKRMQIAGKLTSEAFIETMFASKAPIDEAFLYAKFEFECRARGADILAYP
FT                   PVVAGGNRSNTLHYVKNNQLIKDGEMVLLDGGCESSCYVSDITRTWPVNGRFTAPQAEL
FT                   YEAVLEIQRACLTLCSPGTSLENIYSMMLTLIGQKLKDLGITKTSKESAFKAARKYCPH
FT                   HVGHYLGMDVHDTPDMPRSLPLQPGMVITVEPGIYIPEDDRDAPEKFRGLGVRIEDDVV
FT                   VTQDSPLILSADCPKEMNDIEQICSRTS"
FT   assembly_gap    2481469..2481620
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    2500305..2502582
FT                   /estimated_length=2278
FT                   /gap_type="unknown"
FT   gene            2507600..2517463
FT                   /gene="Rbx1"
FT                   /locus_tag="mCG_8803"
FT                   /note="gene_id=mCG8803.2"
FT   mRNA            join(2507600..2507707,2509412..2509490,2515483..2515568,
FT                   2516726..2517463)
FT                   /gene="Rbx1"
FT                   /locus_tag="mCG_8803"
FT                   /product="ring-box 1, transcript variant mCT172422"
FT                   /note="gene_id=mCG8803.2 transcript_id=mCT172422.0 created
FT                   on 22-AUG-2002"
FT   mRNA            join(2507613..2507707,2509412..2509490,2512592..2512662,
FT                   2515483..2515568,2516726..2517463)
FT                   /gene="Rbx1"
FT                   /locus_tag="mCG_8803"
FT                   /product="ring-box 1, transcript variant mCT9246"
FT                   /note="gene_id=mCG8803.2 transcript_id=mCT9246.1 created on
FT                   22-AUG-2002"
FT   CDS             join(2507630..2507707,2509412..2509490,2515483..2515568,
FT                   2516726..2516806)
FT                   /codon_start=1
FT                   /gene="Rbx1"
FT                   /locus_tag="mCG_8803"
FT                   /product="ring-box 1, isoform CRA_a"
FT                   /note="gene_id=mCG8803.2 transcript_id=mCT172422.0
FT                   protein_id=mCP95341.0 isoform=CRA_a"
FT                   /protein_id="EDL04571.1"
FT                   /translation="MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAIC
FT                   RNHIMDLSCFSFPLHLSMAQNEAGVSVGQQRVGVPEVWALGKTFPQGVPICYSSSDFLL
FT                   IIH"
FT   CDS             join(2507630..2507707,2509412..2509490,2512592..2512662,
FT                   2515483..2515568,2516726..2516738)
FT                   /codon_start=1
FT                   /gene="Rbx1"
FT                   /locus_tag="mCG_8803"
FT                   /product="ring-box 1, isoform CRA_b"
FT                   /note="gene_id=mCG8803.2 transcript_id=mCT9246.1
FT                   protein_id=mCP13105.1 isoform=CRA_b"
FT                   /protein_id="EDL04572.1"
FT                   /translation="MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAIC
FT                   RNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQ
FT                   KYGH"
FT   assembly_gap    2509724..2509894
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    2511477..2511496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2527596..2528031)
FT                   /pseudo
FT                   /locus_tag="mCG_1027628"
FT                   /note="gene_id=mCG1027628.1"
FT   mRNA            complement(join(2527596..2527815,2527838..2528031))
FT                   /pseudo
FT                   /locus_tag="mCG_1027628"
FT                   /note="gene_id=mCG1027628.1 transcript_id=mCT145332.1
FT                   created on 04-OCT-2002"
FT   gene            complement(2540734..2541230)
FT                   /pseudo
FT                   /locus_tag="mCG_8783"
FT                   /note="gene_id=mCG8783.2"
FT   mRNA            complement(2540734..2541230)
FT                   /pseudo
FT                   /locus_tag="mCG_8783"
FT                   /note="gene_id=mCG8783.2 transcript_id=mCT9226.2 created on
FT                   04-OCT-2002"
FT   assembly_gap    2544580..2544599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2551700..2552000
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    2557321..2557500
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    2568984..2569206
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    2574206..2574225
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2583617..2583636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2589971..2589990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2602142..2602299
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    2604559..2604578
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2609785..2610015
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    2611973..2611992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2614010..2614029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2619106..2619125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2627027..2627149
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   gene            2627676..2693869
FT                   /gene="Ep300"
FT                   /locus_tag="mCG_8792"
FT                   /note="gene_id=mCG8792.2"
FT   mRNA            join(2627676..2628252,2642580..2643217,2649869..2650045,
FT                   2652027..2652288,2654842..2655087,2657704..2657797,
FT                   2658398..2658535,2661735..2661852,2662797..2662971,
FT                   2665183..2665260,2666260..2666369,2668073..2668210,
FT                   2668838..2669269,2670471..2670650,2670771..2670915,
FT                   2672179..2672297,2673790..2674029,2674600..2674688,
FT                   2676177..2676257,2678351..2678407,2678939..2679016,
FT                   2681174..2681241,2681935..2682085,2682189..2682335,
FT                   2683454..2683619,2685211..2685375,2687059..2687220,
FT                   2690523..2690804,2690986..2693869)
FT                   /gene="Ep300"
FT                   /locus_tag="mCG_8792"
FT                   /product="E1A binding protein p300"
FT                   /note="gene_id=mCG8792.2 transcript_id=mCT9233.2 created on
FT                   06-SEP-2002"
FT   CDS             join(2628159..2628252,2642580..2643217,2649869..2650045,
FT                   2652027..2652288,2654842..2655087,2657704..2657797,
FT                   2658398..2658535,2661735..2661852,2662797..2662971,
FT                   2665183..2665260,2666260..2666369,2668073..2668210,
FT                   2668838..2669269,2670471..2670650,2670771..2670915,
FT                   2672179..2672297,2673790..2674029,2674600..2674688,
FT                   2676177..2676257,2678351..2678407,2678939..2679016,
FT                   2681174..2681241,2681935..2682085,2682189..2682335,
FT                   2683454..2683619,2685211..2685375,2687059..2687220,
FT                   2690523..2690804,2690986..2693166)
FT                   /codon_start=1
FT                   /gene="Ep300"
FT                   /locus_tag="mCG_8792"
FT                   /product="E1A binding protein p300"
FT                   /note="gene_id=mCG8792.2 transcript_id=mCT9233.2
FT                   protein_id=mCP13121.2"
FT                   /protein_id="EDL04570.1"
FT                   /translation="MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPD
FT                   ELINSTELGLTNGGDISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQAM
FT                   ASQAQQNSPGLSLINSMVKSPMAQTGLTSPNMGIGSSGPNQGPTQSPAGMMNSPVNQPA
FT                   MGMNTGMNAGMNPGMLAAGNGQGIMPNQVMNGSIGAGRGRPNMQYPNAGMGNAGSLLTE
FT                   PLQQGSPQMGGQPGLRGPQPLKMGMMNNPSPYGSPYTQNSGQQIGASGLGLQIQTKTVL
FT                   PNNLSPFAMDKKAVPGGGMPSMGQQPTPSVQQPGLVTPVAAGMGSGAHTADPEKRKLIQ
FT                   QQLVLLLHAHKCQRREQANGEVRQCNLPHCRTMKNVLNHMTHCQSGKSCQAILTGAPVG
FT                   LGNPSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQIPPQPQVQAKNQQSQP
FT                   SGQSPQGMRSVNNMSASPMGVNGGVGVQTPNLLSDSMLHSTINSQNPMMSENAGVASLG
FT                   PLPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAALKDRRMENLVAYAR
FT                   KVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLPNAPGMGPVPMNTG
FT                   SNMGQQPTGMTTNGPVPDPSMIRGSVPNHMMPRMTPQPGLNQFGQMNMPQPPIGPRQPS
FT                   PLQHHGQLAQSGSLNPPMGYGPRMQQASGQNQFLSQTQFTSQGMNVTNMPLAPSSGQAP
FT                   VSQAQMSSSSCPVNSPIMPPGSQGSHIHCPTLPQQAHQNSPSPVPSRTPTPHHTPPSIG
FT                   NQPPPATAIPTPVPTPPAIPPGPQPPSLHPSSRQTPTPPTHLPPQVQPSLPAAPSADQS
FT                   QQQPRSQQSTAVSVPTPTAPLLPPQPSTPLSQPAVSIEGQVSNPPSTSSTEVNSQTIPE
FT                   KQPSQEVKMESKMEVDKPEPADAQPEDTKEAKGEDVKVEPTEMEERGPELKTDGKEEEE
FT                   QPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPVDPQLLGIP
FT                   DYFDIVKSPMDLSTIKRKLDTGQYQEPWQYIDDIWLMFNNAWLYNRKTSRVYKYCSKLS
FT                   EVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYHFCEKCF
FT                   NEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICVLHHEI
FT                   IWPSGFVCDGCLKKTARTRKENKLSAKRLPSTRLGTFLENRVNDFLRRQNHPESGEVTV
FT                   RVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQEYG
FT                   SDCPPPNQRYTTGHIWACPPSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERI
FT                   VHDYKDILKQATEDRLTSAKELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNEST
FT                   DVTKGDSKNAKKKNNKKTSKNKSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFV
FT                   IRLIACPAPNSLPPIVDPDPLIPCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLV
FT                   ELHTQSQDRFVYTCNECKHHVETRWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDE
FT                   SNNQQAAATQSPGDSRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRK
FT                   TNGGCPICKQLIALCCYHAKHCQENKCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMA
FT                   SMQRTGVAGQQQGLPSPTPATPTTPTGQQPATPQTPQPQPTSQPQPTPPNNMTPYLPRT
FT                   QTTGPVSQGKAPGQVTPPTPPQTAQAPLPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQ
FT                   RPIQHQMPQMSPMAPMGMNPPPMARGPGGHLDPGIGPAGMQQQPPWAQGGMPQPQQMQS
FT                   GMPRPAMMSVAQHGQPLNMAPQPGLGQVGVSPLKPGTVSQQALQNLLRTLRSPSSPLQQ
FT                   QQVLSILHANPQLLAAFIKQRAAKYANPNPQPLPGQPGMTQGQPGLQPPTMPGQQGVHS
FT                   NPALQNMNPLQAGVQRAGLPQQQPQQQLQPPMGAMSPQAQQMNMNHNTMPSQFRDILRR
FT                   QMMQQQGAGPGIGPGMANQFQQPQGIGYPPQQQQQQRMQHHMQQMQQGNMGQMGQLPQA
FT                   LGAEAGASLQAYQQRLLQQQMGSPAQPNPMSPQQHMLPNQAQSPHLQGQQIPNSLSNQV
FT                   RSPQPVPSPRPQSQPPHSSPSPRMQPQPSPHHVSPQTSSPHPGLVAAQAANPMEQGHFA
FT                   SPDQNSMLSQLASNPGMANLHGASATDLGLSSDNADLNSNLSQSTLDIH"
FT   assembly_gap    2658541..2658846
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    2669668..2669687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2701955..2702076
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            2706087..2730823
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /note="gene_id=mCG8785.1"
FT   mRNA            join(2706087..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724658,
FT                   2725078..2725154,2725460..2725564,2726350..2726497,
FT                   2726808..2726890,2727221..2727455,2727888..2727953,
FT                   2728718..2728828,2729447..2730823)
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), transcript variant
FT                   mCT9228"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT9228.2 created on
FT                   06-SEP-2002"
FT   mRNA            join(<2706139..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724658,
FT                   2725078..2725154,2725460..2725564,2726350..2726497,
FT                   2726808..2726890,2727221..2727455,2727888..2727953,
FT                   2728718..2728828,2729499..2730815)
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), transcript variant
FT                   mCT189720"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT189720.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2706139..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724981,
FT                   2725078..2725154,2725460..2725564,2726350..2726497,
FT                   2726808..2726890,2727221..2727455,2727888..2727953,
FT                   2728718..2728828,2729447..2730796)
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), transcript variant
FT                   mCT189721"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT189721.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2706139..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724658,
FT                   2725078..2725154,2725460..2725564,2726350..2726497,
FT                   2726808..2726890,2727221..2727455,2727888..2727953,
FT                   2728718..2728828,2729499..2729641)
FT                   /codon_start=1
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT189720.0
FT                   protein_id=mCP110737.0 isoform=CRA_c"
FT                   /protein_id="EDL04567.1"
FT                   /translation="GFLHLVTVEGIEFGIMEKPRGTEEAPSSEPMEEEEEDDLDLFGGY
FT                   DSFRSYNSSAGSESSSYLEESSEAENEDREAGELPTSPLHLFSSANNRSLDGSGSEPAV
FT                   CEMCGIVGTREAFFSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLHKAAW
FT                   SAKIGAFLHAQGTGQLADGTPTGQDALVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQW
FT                   EDVMKGMKVEVLNSDAVLPSRVYWIATVIQAAGYRVLLRYEGFENDASHDFWCNLGTVD
FT                   VHPIGWCAINSKILVPPRTIHAKFTDWKSYLMKRLVGSRTLPADFHIKMVESMKYPFRQ
FT                   GMRLEVVDKTQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRV
FT                   GHGIKMSDRRCDMSHHPTFRKIYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLG
FT                   SICVATICKVLLDGYLMICVDGGPSTDGSDWFCYHASSHAIFPATFCQKNDIELTPPKG
FT                   YETQPFAWETYLEKTKSKAAPARLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRV
FT                   VHRLLSIHFDGWDNEYDQWVDCESPDIYPVGWCELTGYQLQPPVSAEPNTPQKGKDTTK
FT                   KKKKQFGKKRKRIPSAKTRPLRQGSKKPLLEDNLEALGVSEPVPDDSRPVHSCLFPLRA
FT                   SSRRGTTETSLASAWTLTEAKHGAERRPGFTAVQ"
FT   CDS             join(<2706139..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724666)
FT                   /codon_start=1
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT189721.0
FT                   protein_id=mCP110738.0 isoform=CRA_d"
FT                   /protein_id="EDL04568.1"
FT                   /translation="GFLHLVTVEGIEFGIMEKPRGTEEAPSSEPMEEEEEDDLDLFGGY
FT                   DSFRSYNSSAGSESSSYLEESSEAENEDREAGELPTSPLHLFSSANNRSLDGSGSEPAV
FT                   CEMCGIVGTREAFFSKTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLHKAAW
FT                   SAKIGAFLHAQGTGQLADGTPTGQDALVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQW
FT                   EDVMKGMKVEVLNSDAVLPSRVYWIATVIQAAGYRVLLRYEGFENDASHDFWCNLGTVD
FT                   VHPIGWCAINSKILVPPRTIHAKFTDWKSYLMKRLVGSRTLPADFHIKMVESMKYPFRQ
FT                   GMRLEVVDKTQVSRTRMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRV
FT                   GHGIKMSGQ"
FT   mRNA            join(2706169..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724658,
FT                   2725078..2725154,2725535..2725564,2726350..2726497,
FT                   2726808..2726890,2727221..2727455,2727888..2727953,
FT                   2728718..2728828,2729447..2730812)
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), transcript variant
FT                   mCT172935"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT172935.0 created
FT                   on 06-SEP-2002"
FT   mRNA            join(2706169..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724658,
FT                   2725078..2725154,2726350..2726497,2726808..2726890,
FT                   2727221..2727455,2727888..2727953,2728718..2728828,
FT                   2729447..2730812)
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), transcript variant
FT                   mCT172934"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT172934.0 created
FT                   on 06-SEP-2002"
FT   CDS             join(2706184..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724658,
FT                   2725078..2725154,2725460..2725564,2726350..2726497,
FT                   2726808..2726890,2727221..2727455,2727888..2727953,
FT                   2728718..2728828,2729447..2729559)
FT                   /codon_start=1
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), isoform CRA_e"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT9228.2
FT                   protein_id=mCP13088.2 isoform=CRA_e"
FT                   /db_xref="GOA:P59178"
FT                   /db_xref="InterPro:IPR004092"
FT                   /db_xref="InterPro:IPR012313"
FT                   /db_xref="MGI:MGI:2443584"
FT                   /db_xref="UniProtKB/Swiss-Prot:P59178"
FT                   /protein_id="EDL04569.1"
FT                   /translation="MEKPRGTEEAPSSEPMEEEEEDDLDLFGGYDSFRSYNSSAGSESS
FT                   SYLEESSEAENEDREAGELPTSPLHLFSSANNRSLDGSGSEPAVCEMCGIVGTREAFFS
FT                   KTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLHKAAWSAKIGAFLHAQGTGQ
FT                   LADGTPTGQDALVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSD
FT                   AVLPSRVYWIATVIQAAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILV
FT                   PPRTIHAKFTDWKSYLMKRLVGSRTLPADFHIKMVESMKYPFRQGMRLEVVDKTQVSRT
FT                   RMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSDRRCDMSH
FT                   HPTFRKIYCDAVPYLFKKVRAVYTEGGWFEEGMKLEAIDPLNLGSICVATICKVLLDGY
FT                   LMICVDGGPSTDGSDWFCYHASSHAIFPATFCQKNDIELTPPKGYETQPFAWETYLEKT
FT                   KSKAAPARLFNMDCPNHGFKVGMKLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDNE
FT                   YDQWVDCESPDIYPVGWCELTGYQLQPPVSAEPNTPQKGKDTTKKKKKQFGKKRKRIPS
FT                   AKTRPLRQGSKKPLLEDNLEALGVSEPVPDDIIAVCVKEEHQDISSLDRSPSPQLPLPI
FT                   ESIKQERNN"
FT   CDS             join(2706184..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724658,
FT                   2725078..2725154,2725535..2725564,2726350..2726497,
FT                   2726808..2726890,2727221..2727455,2727888..2727953,
FT                   2728718..2728828,2729447..2729559)
FT                   /codon_start=1
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT172935.0
FT                   protein_id=mCP95853.0 isoform=CRA_b"
FT                   /protein_id="EDL04566.1"
FT                   /translation="MEKPRGTEEAPSSEPMEEEEEDDLDLFGGYDSFRSYNSSAGSESS
FT                   SYLEESSEAENEDREAGELPTSPLHLFSSANNRSLDGSGSEPAVCEMCGIVGTREAFFS
FT                   KTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLHKAAWSAKIGAFLHAQGTGQ
FT                   LADGTPTGQDALVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSD
FT                   AVLPSRVYWIATVIQAAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILV
FT                   PPRTIHAKFTDWKSYLMKRLVGSRTLPADFHIKMVESMKYPFRQGMRLEVVDKTQVSRT
FT                   RMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSDRRCDMSH
FT                   HPTFRKIYCDAVPYLFKKGSICVATICKVLLDGYLMICVDGGPSTDGSDWFCYHASSHA
FT                   IFPATFCQKNDIELTPPKGYETQPFAWETYLEKTKSKAAPARLFNMDCPNHGFKVGMKL
FT                   EAVDLMEPRLICVATVKRVVHRLLSIHFDGWDNEYDQWVDCESPDIYPVGWCELTGYQL
FT                   QPPVSAEPNTPQKGKDTTKKKKKQFGKKRKRIPSAKTRPLRQGSKKPLLEDNLEALGVS
FT                   EPVPDDIIAVCVKEEHQDISSLDRSPSPQLPLPIESIKQERNN"
FT   CDS             join(2706184..2706207,2709374..2709611,2710845..2710978,
FT                   2712342..2712465,2713283..2713362,2718021..2718138,
FT                   2718764..2718898,2719331..2719419,2724427..2724658,
FT                   2725078..2725154,2726350..2726497,2726808..2726890,
FT                   2727221..2727455,2727888..2727953,2728718..2728828,
FT                   2729447..2729559)
FT                   /codon_start=1
FT                   /gene="L3mbtl2"
FT                   /locus_tag="mCG_8785"
FT                   /product="l(3)mbt-like 2 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG8785.1 transcript_id=mCT172934.0
FT                   protein_id=mCP95854.0 isoform=CRA_a"
FT                   /protein_id="EDL04565.1"
FT                   /translation="MEKPRGTEEAPSSEPMEEEEEDDLDLFGGYDSFRSYNSSAGSESS
FT                   SYLEESSEAENEDREAGELPTSPLHLFSSANNRSLDGSGSEPAVCEMCGIVGTREAFFS
FT                   KTKRFCSVSCSRSYSSNSKKASILARLQGKPPTKKAKVLHKAAWSAKIGAFLHAQGTGQ
FT                   LADGTPTGQDALVLGFDWGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSD
FT                   AVLPSRVYWIATVIQAAGYRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILV
FT                   PPRTIHAKFTDWKSYLMKRLVGSRTLPADFHIKMVESMKYPFRQGMRLEVVDKTQVSRT
FT                   RMAVVDTVIGGRLRLLYEDGDSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSDRRCDMSH
FT                   HPTFRKIYCDAVPYLFKKVLLDGYLMICVDGGPSTDGSDWFCYHASSHAIFPATFCQKN
FT                   DIELTPPKGYETQPFAWETYLEKTKSKAAPARLFNMDCPNHGFKVGMKLEAVDLMEPRL
FT                   ICVATVKRVVHRLLSIHFDGWDNEYDQWVDCESPDIYPVGWCELTGYQLQPPVSAEPNT
FT                   PQKGKDTTKKKKKQFGKKRKRIPSAKTRPLRQGSKKPLLEDNLEALGVSEPVPDDIIAV
FT                   CVKEEHQDISSLDRSPSPQLPLPIESIKQERNN"
FT   assembly_gap    2708992..2709011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2714280..2714299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2720802..2738531)
FT                   /locus_tag="mCG_8786"
FT                   /note="gene_id=mCG8786.2"
FT   mRNA            complement(join(2720802..2721262,2724504..2726459,
FT                   2734615..2734813,2735494..2735660,2736041..2737750,
FT                   2738357..2738476))
FT                   /locus_tag="mCG_8786"
FT                   /product="mCG8786, transcript variant mCT179832"
FT                   /note="gene_id=mCG8786.2 transcript_id=mCT179832.0 created
FT                   on 04-FEB-2003"
FT   mRNA            complement(join(2728710..2728909,2734615..2734813,
FT                   2735494..2735660,2736041..2737750,2738357..2738531))
FT                   /locus_tag="mCG_8786"
FT                   /product="mCG8786, transcript variant mCT9229"
FT                   /note="gene_id=mCG8786.2 transcript_id=mCT9229.2 created on
FT                   04-FEB-2003"
FT   CDS             complement(join(2734627..2734813,2735494..2735660,
FT                   2736041..2737750,2738357..2738491))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8786"
FT                   /product="mCG8786, isoform CRA_b"
FT                   /note="gene_id=mCG8786.2 transcript_id=mCT9229.2
FT                   protein_id=mCP13116.2 isoform=CRA_b"
FT                   /protein_id="EDL04564.1"
FT                   /translation="MVLLQSPAWHVAAQRCPQTCVCDNSRRHVTCRHQNLTEVPNTIPE
FT                   LTQRLDLQGNILKVLPAAAFQDLPHLTHLDLRNCQVEMVAEGAFRGLGRLLLLNLASNR
FT                   LSTLPQEALDGLGSLRRLELEGNMLEELRPGTFGALGSLTTLNLAHNALVYLPAMAFQG
FT                   LLRTRWLQLSHNALSVLAPEALAGLPALRRLSLHHNELQALPGAALSQARSLARLELGH
FT                   NPLTYTGEEDGLALPGLRELALDHGSLQALGPRAFAHCPRLHTLDLRGNQLTTLPPLQV
FT                   PGQLRRLRLQGNPLWCACHARPLLEWLVRARVRSDGACRGPRRLRGEALDTLRPSDLRC
FT                   PGDAAAGDGDGDEDEDRPAGPRAPPLRSPHGEAAWATPCPPACACVAETRHSTCDGRGL
FT                   QAVPRGFPNDTQLLDLRRNHFPSVPRAAFPGLRHLVSLHLQHCGVAELEPGALAGLDRL
FT                   LYLYLSHNQLSGLSAAALEGAPNLGYLYLEHNRFLRIPGTALRALPTLVSLHLQDNAVD
FT                   RLAPGDLAGARALRCLYLSGNHITQVSPGALGPARELEKLHLDRNRLREVPTGALEGLP
FT                   ALKELQLSGNPLRALPDGAFQPVGRSLQQLFLNSSDLEQISPRAFSGLGKGLRSLYLHK
FT                   NQLQSLPAPLGLSGLELVDLSGNPFHCDCQLLPLHRWLTGLNLRVGATCATPPSVRGQK
FT                   VKVAAPVFEACPGWTARKAKRTPTSRGSARRTPSLSRH"
FT   CDS             complement(join(2734627..2734813,2735494..2735660,
FT                   2736041..2737639))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8786"
FT                   /product="mCG8786, isoform CRA_a"
FT                   /note="gene_id=mCG8786.2 transcript_id=mCT179832.0
FT                   protein_id=mCP102754.0 isoform=CRA_a"
FT                   /protein_id="EDL04563.1"
FT                   /translation="MVAEGAFRGLGRLLLLNLASNRLSTLPQEALDGLGSLRRLELEGN
FT                   MLEELRPGTFGALGSLTTLNLAHNALVYLPAMAFQGLLRTRWLQLSHNALSVLAPEALA
FT                   GLPALRRLSLHHNELQALPGAALSQARSLARLELGHNPLTYTGEEDGLALPGLRELALD
FT                   HGSLQALGPRAFAHCPRLHTLDLRGNQLTTLPPLQVPGQLRRLRLQGNPLWCACHARPL
FT                   LEWLVRARVRSDGACRGPRRLRGEALDTLRPSDLRCPGDAAAGDGDGDEDEDRPAGPRA
FT                   PPLRSPHGEAAWATPCPPACACVAETRHSTCDGRGLQAVPRGFPNDTQLLDLRRNHFPS
FT                   VPRAAFPGLRHLVSLHLQHCGVAELEPGALAGLDRLLYLYLSHNQLSGLSAAALEGAPN
FT                   LGYLYLEHNRFLRIPGTALRALPTLVSLHLQDNAVDRLAPGDLAGARALRCLYLSGNHI
FT                   TQVSPGALGPARELEKLHLDRNRLREVPTGALEGLPALKELQLSGNPLRALPDGAFQPV
FT                   GRSLQQLFLNSSDLEQISPRAFSGLGKGLRSLYLHKNQLQSLPAPLGLSGLELVDLSGN
FT                   PFHCDCQLLPLHRWLTGLNLRVGATCATPPSVRGQKVKVAAPVFEACPGWTARKAKRTP
FT                   TSRGSARRTPSLSRH"
FT   gene            complement(2746760..>2772129)
FT                   /gene="Rangap1"
FT                   /locus_tag="mCG_8790"
FT                   /note="gene_id=mCG8790.3"
FT   mRNA            complement(join(2746760..2747765,2747960..2748081,
FT                   2748167..2748255,2748908..2749010,2751995..2752114,
FT                   2752869..2753061,2753985..2754069,2754153..2754252,
FT                   2754533..2754646,2755330..2755488,2758772..2758906,
FT                   2760948..2761127,2762812..2762871,2764104..2764231,
FT                   2766708..2766854,2771445..2771492,2771940..>2772129))
FT                   /gene="Rangap1"
FT                   /locus_tag="mCG_8790"
FT                   /product="RAN GTPase activating protein 1, transcript
FT                   variant mCT189752"
FT                   /note="gene_id=mCG8790.3 transcript_id=mCT189752.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(2746971..2747765,2747960..2748081,
FT                   2748167..2748255,2748908..2749010,2751995..2752114,
FT                   2752869..2753061,2753985..2754069,2754153..2754252,
FT                   2754533..2754646,2755330..2755488,2758772..2758906,
FT                   2760948..2761127,2762812..2762871,2764104..2764231,
FT                   2766708..2766854,2771940..2772114))
FT                   /gene="Rangap1"
FT                   /locus_tag="mCG_8790"
FT                   /product="RAN GTPase activating protein 1, transcript
FT                   variant mCT9236"
FT                   /note="gene_id=mCG8790.3 transcript_id=mCT9236.1 created on
FT                   22-AUG-2002"
FT   mRNA            complement(join(2747411..2747765,2747960..2747973,
FT                   2758774..2758906,2760948..2761127,2762812..2762871,
FT                   2764104..2764231,2766708..2766854,2771940..2772114))
FT                   /gene="Rangap1"
FT                   /locus_tag="mCG_8790"
FT                   /product="RAN GTPase activating protein 1, transcript
FT                   variant mCT172420"
FT                   /note="gene_id=mCG8790.3 transcript_id=mCT172420.0 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(2747649..2747765,2747960..2747973,
FT                   2758774..2758906,2760948..2761127,2762812..2762871,
FT                   2764104..2764231,2766708..2766819))
FT                   /codon_start=1
FT                   /gene="Rangap1"
FT                   /locus_tag="mCG_8790"
FT                   /product="RAN GTPase activating protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG8790.3 transcript_id=mCT172420.0
FT                   protein_id=mCP95339.0 isoform=CRA_a"
FT                   /protein_id="EDL04560.1"
FT                   /translation="MASEDIAKLAETLAKTQVAGGQLSFKGKGLKLNTAEDAKDVIKEI
FT                   EEFDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPPALISLG
FT                   EGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILA
FT                   AALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGICDKAQWRAGNLLLCPP
FT                   QSAADAIQHLDLKAAASCPSPCPSD"
FT   CDS             complement(join(2747696..2747765,2747960..2748081,
FT                   2748167..2748255,2748908..2749010,2751995..2752114,
FT                   2752869..2753061,2753985..2754069,2754153..2754252,
FT                   2754533..2754646,2755330..2755488,2758772..2758906,
FT                   2760948..2761127,2762812..2762871,2764104..2764231,
FT                   2766708..2766854,2771445..2771492,2771940..>2772129))
FT                   /codon_start=1
FT                   /gene="Rangap1"
FT                   /locus_tag="mCG_8790"
FT                   /product="RAN GTPase activating protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG8790.3 transcript_id=mCT189752.0
FT                   protein_id=mCP110764.0 isoform=CRA_b"
FT                   /protein_id="EDL04561.1"
FT                   /translation="QKSSSAAIIAGDRGAGGVHELNEEPRQQGEASRLVTGPGPHADSQ
FT                   AVTDARVPSPHAAVPLICGRLLTLDSSIPSLFCFVYRPAGEPATAAMASEDIAKLAETL
FT                   AKTQVAGGQLSFKGKGLKLNTAEDAKDVIKEIEEFDGLEALRLEGNTVGVEAARVIAKA
FT                   LEKKSELKRCHWSDMFTGRLRSEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVRG
FT                   FEALLKSPACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRN
FT                   RLENDGATALAEAFGIIGTLEEVHMPQNGINHPGVTALAQAFAINPLLRVINLNDNTFT
FT                   EKGGVAMAETLKTLRQVEVINFGDCLVRSKGAVAIADAVRGGLPKLKELNLSFCEIKRD
FT                   AALVVAEAVADKAELEKLDLNGNALGEEGCEQLQEVMDSFNMAKVLASLSDDEGEDEDE
FT                   EEEGEEDDEEEEDEEDEEDDDEEEEEQEEEEEPPQRGSGEEPATPLRKILDPNSGEPAP
FT                   VLSSPTPTDLSTFLSFPSPEKLLRLGPKVSVLIVQQTDTSDPEKVVSAFLKVASVFRDD
FT                   ASVKTAVLDAIDALMKKAFSCSSFNSNTFLTRLLIHMGLLKSEDKIKAIPSLHGPLMVL
FT                   NHVVRQDYFPKALAPLLLAFVTKPNGALETCSFARHNLLQTLYNI"
FT   CDS             complement(join(2747696..2747765,2747960..2748081,
FT                   2748167..2748255,2748908..2749010,2751995..2752114,
FT                   2752869..2753061,2753985..2754069,2754153..2754252,
FT                   2754533..2754646,2755330..2755488,2758772..2758906,
FT                   2760948..2761127,2762812..2762871,2764104..2764231,
FT                   2766708..2766819))
FT                   /codon_start=1
FT                   /gene="Rangap1"
FT                   /locus_tag="mCG_8790"
FT                   /product="RAN GTPase activating protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG8790.3 transcript_id=mCT9236.1
FT                   protein_id=mCP13119.1 isoform=CRA_c"
FT                   /protein_id="EDL04562.1"
FT                   /translation="MASEDIAKLAETLAKTQVAGGQLSFKGKGLKLNTAEDAKDVIKEI
FT                   EEFDGLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRSEIPPALISLG
FT                   EGLITAGAQLVELDLSDNAFGPDGVRGFEALLKSPACFTLQELKLNNCGMGIGGGKILA
FT                   AALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFGIIGTLEEVHMPQNGINH
FT                   PGVTALAQAFAINPLLRVINLNDNTFTEKGGVAMAETLKTLRQVEVINFGDCLVRSKGA
FT                   VAIADAVRGGLPKLKELNLSFCEIKRDAALVVAEAVADKAELEKLDLNGNALGEEGCEQ
FT                   LQEVMDSFNMAKVLASLSDDEGEDEDEEEEGEEDDEEEEDEEDEEDDDEEEEEQEEEEE
FT                   PPQRGSGEEPATPLRKILDPNSGEPAPVLSSPTPTDLSTFLSFPSPEKLLRLGPKVSVL
FT                   IVQQTDTSDPEKVVSAFLKVASVFRDDASVKTAVLDAIDALMKKAFSCSSFNSNTFLTR
FT                   LLIHMGLLKSEDKIKAIPSLHGPLMVLNHVVRQDYFPKALAPLLLAFVTKPNGALETCS
FT                   FARHNLLQTLYNI"
FT   assembly_gap    2787588..2787607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2793000..2793162
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    2804371..2804390
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2810167..2838479
FT                   /locus_tag="mCG_8782"
FT                   /note="gene_id=mCG8782.1"
FT   mRNA            join(2810167..2810260,2811040..2811073,2811191..2811388,
FT                   2813935..2814093,2814625..2814705,2815483..2815539,
FT                   2818005..2818047,2818477..2818670,2818980..2819301,
FT                   2820072..2820130,2820809..2820908,2821309..2821470,
FT                   2822604..2822809,2824159..2824259,2825225..2825406,
FT                   2828082..2828167,2834139..2834272,2834437..2834542,
FT                   2834670..2834778,2834987..2835120,2835227..2835390,
FT                   2835708..2838479)
FT                   /locus_tag="mCG_8782"
FT                   /product="mCG8782"
FT                   /note="gene_id=mCG8782.1 transcript_id=mCT9225.2 created on
FT                   06-SEP-2002"
FT   CDS             join(2810187..2810260,2811040..2811073,2811191..2811388,
FT                   2813935..2814093,2814625..2814705,2815483..2815539,
FT                   2818005..2818047,2818477..2818670,2818980..2819301,
FT                   2820072..2820130,2820809..2820908,2821309..2821470,
FT                   2822604..2822809,2824159..2824259,2825225..2825406,
FT                   2828082..2828167,2834139..2834272,2834437..2834542,
FT                   2834670..2834778,2834987..2835120,2835227..2835390,
FT                   2835708..2835972)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8782"
FT                   /product="mCG8782"
FT                   /note="gene_id=mCG8782.1 transcript_id=mCT9225.2
FT                   protein_id=mCP13114.2"
FT                   /protein_id="EDL04559.1"
FT                   /translation="MLSLQTLMERQKRKADIEKGLQFIQSTLPLKQEEYEAFLLKLVQN
FT                   LFAEGNDLFREKDYKQALVQYMEGLNVADYAASDQVALPRELLCKLHVNRAACYFTMGL
FT                   YEKALEDSEKALGLDGESIRALFRKARALNELGRHKEAYECSSRCSLALPHDENVTQLG
FT                   QELAQKLGLRVRKAYKRPQELETFSLLSNGAPAGLTDQGTSNGLGSIDDIETDCYVDLR
FT                   GSPALLPSTPTMPLFPHVLDLLAPLDGSSRTLPGTEGLDDFSDGDVFGPELDTLLDSLS
FT                   LVQGGLPGSGMPSELPQLIPVFPGGTPLLPPVVGGSIPVSSPLPPASFGLVMDPSRKLA
FT                   ASVLDALDSPGPTLDPLDLLPYSEARLGALDSFGSARGSLDKQDSFLEETSSQDHRPPS
FT                   STQKPAPSPEPSMPNTTLLIKNPLAATHEFKQACQLCYPKTGPRAGDYTYREGLEHKCR
FT                   RDVLLGRLRSSENQIWKRIRPRPTKTSFVGSYYLCKDMINKQDCKYGDNCTFAYHQEEI
FT                   DVWTEERKGTLNRDLLFDPLGGVKRGSLTIAKLLKEHQGIFTFLCEICFDSKPRIISKG
FT                   TKDSPSVCSNLAAKHSFYNNKCLVHIVRSTSLKYSKIRQFQEHFQFDVCRHEVRYGCLR
FT                   EDSCHFAHSFIELKVWLLQQYSGMTHEDIVQESKKYWQQMEAHAGKASSGLGAPRTHGP
FT                   STFDLQMKFVCGQCWRNGQVVEPDKDLKYCSAKARHCWTKERRVLLVMSKAKRKWVSVR
FT                   PLPSIRNFPQQYDLCIHAQNGRKCQYVGNCSFAHSPEERDMWTFMKENKILDMQQTYDM
FT                   WLKKHNPGKPGEGTPISSREGEKQIQMPTDYADIMMGYHCWLCGKNSNSKKQWQQHIQS
FT                   EKHKEKVFTSDSDASGWAYRFPMGEFRLCDRLQKGKACPDGDKCRCAHGQEELNEWLDR
FT                   REVLKQKLAKARKDMLLCPRDDDFGKYNFLLQEDGDTTGATPDAPVAATATAATTTTGE
FT                   "
FT   gene            complement(2843000..2844824)
FT                   /locus_tag="mCG_147096"
FT                   /note="gene_id=mCG147096.0"
FT   mRNA            complement(join(2843000..2843910,2844619..2844824))
FT                   /locus_tag="mCG_147096"
FT                   /product="mCG147096"
FT                   /note="gene_id=mCG147096.0 transcript_id=mCT187359.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(2843113..2843307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147096"
FT                   /product="mCG147096"
FT                   /note="gene_id=mCG147096.0 transcript_id=mCT187359.0
FT                   protein_id=mCP108755.0"
FT                   /protein_id="EDL04558.1"
FT                   /translation="MDMCVYTYITHTHKHIYVYILIVSRELAQQLRVLLVLAEDPGLAP
FT                   SSYMVGTYLGSSQPPSLHF"
FT   gene            2844918..2866257
FT                   /gene="Tef"
FT                   /locus_tag="mCG_8793"
FT                   /note="gene_id=mCG8793.2"
FT   mRNA            join(2844918..2845095,2857153..2857470,2862781..2862897,
FT                   2863441..2863661,2865734..2866188)
FT                   /gene="Tef"
FT                   /locus_tag="mCG_8793"
FT                   /product="thyrotroph embryonic factor, transcript variant
FT                   mCT172421"
FT                   /note="gene_id=mCG8793.2 transcript_id=mCT172421.0 created
FT                   on 22-AUG-2002"
FT   CDS             join(2844993..2845095,2857153..2857470,2862781..2862897,
FT                   2863441..2863661,2865734..2865949)
FT                   /codon_start=1
FT                   /gene="Tef"
FT                   /locus_tag="mCG_8793"
FT                   /product="thyrotroph embryonic factor, isoform CRA_b"
FT                   /note="gene_id=mCG8793.2 transcript_id=mCT172421.0
FT                   protein_id=mCP95340.0 isoform=CRA_b"
FT                   /protein_id="EDL04557.1"
FT                   /translation="MSSCSQIGVAPAMDMPEVLKSLLEHSLPWSEKKADKEKGKEKLEE
FT                   DESAAASTMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAQNLL
FT                   LPVAELEGKESASSSTASPPSSSTAIFQPSETVSSTASHMEQEDPGARVSQAKTTFSFS
FT                   YFPVGFWKANCISLTLESSLEKERETPSPIDPSCVEVDVNFNPDPADLVLSSVPGGELF
FT                   NPRKHRFAEEDLKPQPMIKKAKKVFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQ
FT                   ITIRAAFLEKENTALRTEVAELRKEVGKCKTIVSKYETKYGPL"
FT   mRNA            join(2853689..2853929,2857153..2857470,2863441..2863661,
FT                   2865734..2866257)
FT                   /gene="Tef"
FT                   /locus_tag="mCG_8793"
FT                   /product="thyrotroph embryonic factor, transcript variant
FT                   mCT9237"
FT                   /note="gene_id=mCG8793.2 transcript_id=mCT9237.0 created on
FT                   22-AUG-2002"
FT   CDS             join(2853779..2853929,2857153..2857470,2863441..2863661,
FT                   2865734..2865949)
FT                   /codon_start=1
FT                   /gene="Tef"
FT                   /locus_tag="mCG_8793"
FT                   /product="thyrotroph embryonic factor, isoform CRA_a"
FT                   /note="gene_id=mCG8793.2 transcript_id=mCT9237.0
FT                   protein_id=mCP13083.1 isoform=CRA_a"
FT                   /protein_id="EDL04556.1"
FT                   /translation="MSDAGGGKKPPVEPQAGPGPGRAAGERGLSGSFPLVLKKLMENPP
FT                   RETRLDKEKGKEKLEEDESAAASTMAVSASLMPPIWDKTIPYDGESFHLEYMDLDEFLL
FT                   ENGIPASPTHLAQNLLLPVAELEGKESASSSTASPPSSSTAIFQPSETVSSTESSLEKE
FT                   RETPSPIDPSCVEVDVNFNPDPADLVLSSVPGGELFNPRKHRFAEEDLKPQPMIKKAKK
FT                   VFVPDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRTEVAELR
FT                   KEVGKCKTIVSKYETKYGPL"
FT   assembly_gap    2864411..2864760
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    2877163..2877182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2885796..2886240)
FT                   /pseudo
FT                   /locus_tag="mCG_8796"
FT                   /note="gene_id=mCG8796.0"
FT   mRNA            complement(2885796..2886240)
FT                   /pseudo
FT                   /locus_tag="mCG_8796"
FT                   /note="gene_id=mCG8796.0 transcript_id=mCT9234.1 created on
FT                   06-SEP-2002"
FT   assembly_gap    2887284..2887361
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   gene            complement(2892552..2900753)
FT                   /locus_tag="mCG_8800"
FT                   /note="gene_id=mCG8800.1"
FT   mRNA            complement(join(2892552..2894345,2900410..2900753))
FT                   /locus_tag="mCG_8800"
FT                   /product="mCG8800"
FT                   /note="gene_id=mCG8800.1 transcript_id=mCT9243.1 created on
FT                   22-AUG-2002"
FT   CDS             complement(2893202..2894239)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8800"
FT                   /product="mCG8800"
FT                   /note="gene_id=mCG8800.1 transcript_id=mCT9243.1
FT                   protein_id=mCP13087.0"
FT                   /protein_id="EDL04555.1"
FT                   /translation="MQLEIKVALNFIISYLYNKLPRRRADLFGEELERLLRKKYEGHWY
FT                   PEKPLKGSGFRCVHIGEVVDPVVELAAKRSGLAVEDVRANVPEELSVWIDPFEVSYQIG
FT                   EKGVVKVLYLGDSEAGGTPELDKEIKSSFNPDAQVFVPIGSQDSSLSSSPSPSFGQSPS
FT                   PTFIPRSAQPITFTTASFAATKFGSTKMKKGGGASGGVSVGGSGVGGQQPPPQQPRMAR
FT                   SPTKNLLKHKSLSLSMHSLNLIPANPAPQSQLSPNAKEFVYNGGGSPSLFFDGVEGPST
FT                   STTAPFGSGGASTCNSSSFDVSQVFGGGANSLFLEKSPFVEGLSYNLNTMQYPNQPFQP
FT                   VVLAN"
FT   gene            complement(2907809..2914387)
FT                   /locus_tag="mCG_8787"
FT                   /note="gene_id=mCG8787.2"
FT   mRNA            complement(join(2907809..2908372,2912812..2912978,
FT                   2913646..2913669,2914293..2914387))
FT                   /locus_tag="mCG_8787"
FT                   /product="mCG8787"
FT                   /note="gene_id=mCG8787.2 transcript_id=mCT9230.2 created on
FT                   28-AUG-2002"
FT   CDS             complement(join(2908283..2908372,2912812..2912978,
FT                   2913646..2913669,2914293..2914344))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8787"
FT                   /product="mCG8787"
FT                   /note="gene_id=mCG8787.2 transcript_id=mCT9230.2
FT                   protein_id=mCP13091.2"
FT                   /protein_id="EDL04554.1"
FT                   /translation="MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRI
FT                   CDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKK
FT                   YGFKKR"
FT   gene            2914964..2959771
FT                   /gene="Aco2"
FT                   /locus_tag="mCG_8788"
FT                   /note="gene_id=mCG8788.2"
FT   mRNA            join(2914964..2915025,2933596..2933732,2939457..2939715,
FT                   2943415..2943507,2947762..2947920,2948142..2948292,
FT                   2949049..2949153,2950138..2950229,2951709..2951814,
FT                   2954133..2954290,2954485..2954558,2955056..2955167,
FT                   2956529..2956651,2956849..2957004,2957749..2957940,
FT                   2958323..2958455,2958881..2959002,2959271..2959771)
FT                   /gene="Aco2"
FT                   /locus_tag="mCG_8788"
FT                   /product="aconitase 2, mitochondrial"
FT                   /note="gene_id=mCG8788.2 transcript_id=mCT9231.2 created on
FT                   22-AUG-2002"
FT   CDS             join(2914990..2915025,2933596..2933732,2939457..2939715,
FT                   2943415..2943507,2947762..2947920,2948142..2948292,
FT                   2949049..2949153,2950138..2950229,2951709..2951814,
FT                   2954133..2954290,2954485..2954558,2955056..2955167,
FT                   2956529..2956651,2956849..2957004,2957749..2957940,
FT                   2958323..2958455,2958881..2959002,2959271..2959405)
FT                   /codon_start=1
FT                   /gene="Aco2"
FT                   /locus_tag="mCG_8788"
FT                   /product="aconitase 2, mitochondrial"
FT                   /note="gene_id=mCG8788.2 transcript_id=mCT9231.2
FT                   protein_id=mCP13096.2"
FT                   /protein_id="EDL04552.1"
FT                   /translation="MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPSEYIRY
FT                   DLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPANQEIERGKTYLRLRPDRVAMQDATAQ
FT                   MAMLQFISSGLPKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGV
FT                   GFWRPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPW
FT                   ELKCPKVIGVKLTGSLSGWTSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMA
FT                   TICNMGAEIGATTSVFPYNHRMKKYLSKTGRTDIANLAEEFKDHLVPDPGCQYDQVIEI
FT                   NLNELKPHINGPFTPDLAHPVADVGTVAEKEGWPLDIRVGLIGSCTNSSYEDMGRSAAV
FT                   AKQALAHGLKCKSQFTITPGSEQIRATIERDGYAQILRDVGGIVLANACGPCIGQWDRK
FT                   DIKKGEKNTIVTSYNRNFTGRNDANPETHAFVTSPEIVTALAIAGTLKFNPETDFLTGK
FT                   DGKKFKLEAPDADELPRSDFDPGQDTYQHPPKDSSGQRVDVSPTSQRLQLLEPFDKWDG
FT                   KDLEDLQILIKVKGKCTTDHISAAGPWLKFRGHLDNISNNLLIGAINIENGKANSVRNA
FT                   VTQEFGPVPDTARYYKKHGIRWVVIGDENYGEGSSREHAALEPRHLGGRAIITKSFARI
FT                   HETNLKKQGLLPLTFADPSDYNKIHPVDKLTIQGLKDFAPGKPLKCVIKHPNGTQETIL
FT                   LNHTFNETQIEWFRAGSALNRMKELQQ"
FT   gene            2915076..2918108
FT                   /locus_tag="mCG_147094"
FT                   /note="gene_id=mCG147094.0"
FT   mRNA            2915076..2918108
FT                   /locus_tag="mCG_147094"
FT                   /product="mCG147094"
FT                   /note="gene_id=mCG147094.0 transcript_id=mCT187357.0
FT                   created on 13-JAN-2004"
FT   CDS             2915716..2916051
FT                   /codon_start=1
FT                   /locus_tag="mCG_147094"
FT                   /product="mCG147094"
FT                   /note="gene_id=mCG147094.0 transcript_id=mCT187357.0
FT                   protein_id=mCP108753.0"
FT                   /protein_id="EDL04553.1"
FT                   /translation="MVSLKDHSLSSDPADPLFLLFMAANITELSESGCDRLYLSEYRIK
FT                   YFEVTDSCFPDTRWKDEKSEQFDLDCYETSRKLTMPVRWFPTTNLTALETYNVYCKECI
FT                   LFIKRNP"
FT   assembly_gap    2919853..2919872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2921103..2921122
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2932526..2970864)
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /note="gene_id=mCG8784.3"
FT   mRNA            complement(join(2932526..2933697,2960961..2961308,
FT                   2961843..2962044,2962911..2962974,2963318..2963404,
FT                   2967051..2967147,2969755..2970864))
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, transcript variant mCT9227"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT9227.3 created on
FT                   11-JUN-2003"
FT   assembly_gap    2953612..2953631
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(2959673..2961308,2961843..2962044,
FT                   2962911..2962974,2963318..2963404,2967051..2967147,
FT                   2970436..2970864))
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, transcript variant mCT185658"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT185658.0 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(2959673..2961308,2961843..2962044,
FT                   2962911..2962974,2963318..2963404,2967047..2967147,
FT                   2970436..2970846))
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, transcript variant mCT185659"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT185659.0 created
FT                   on 11-JUN-2003"
FT   mRNA            complement(join(2960726..2961053,2962935..2962974,
FT                   2963318..2963404,2967051..2967147,2970436..2970853))
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, transcript variant mCT185661"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT185661.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(2961032..2961053,2962935..2962974,
FT                   2963318..2963404,2967051..2967147,2970436..2970546))
FT                   /codon_start=1
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, isoform CRA_e"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT185661.0
FT                   protein_id=mCP106918.0 isoform=CRA_e"
FT                   /protein_id="EDL04551.1"
FT                   /translation="MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLC
FT                   ICLFDITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFF
FT                   DDILIPPDLTCCIA"
FT   CDS             complement(join(2961255..2961308,2961843..2962044,
FT                   2962911..2962974,2963318..2963404,2967051..2967147,
FT                   2970436..2970546))
FT                   /codon_start=1
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, isoform CRA_d"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT185658.0
FT                   protein_id=mCP106917.0 isoform=CRA_d"
FT                   /protein_id="EDL04550.1"
FT                   /translation="MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLC
FT                   ICLFDITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFF
FT                   DDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPT
FT                   GPSSAEAASSSEELPKKEAPYTLVGSISEPGLGLLSWWTSN"
FT   CDS             complement(join(2961255..2961308,2961843..2962044,
FT                   2962911..2962974,2963318..2963404,2967047..2967086))
FT                   /codon_start=1
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, isoform CRA_a"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT185659.0
FT                   protein_id=mCP106919.0 isoform=CRA_a"
FT                   /protein_id="EDL04547.1"
FT                   /translation="MCSQGMEHPTPKVIHFRYVVFHPFLDEILIGKIKGCSPEGVHVSL
FT                   GFFDDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDT
FT                   SPTGPSSAEAASSSEELPKKEAPYTLVGSISEPGLGLLSWWTSN"
FT   CDS             complement(join(2961284..2961308,2961843..2962044,
FT                   2962911..2962956))
FT                   /codon_start=1
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, isoform CRA_c"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT9227.3
FT                   protein_id=mCP13113.3 isoform=CRA_c"
FT                   /protein_id="EDL04549.1"
FT                   /translation="MTFSSPLSHCSSLPSLMKRSKCGCGSTRRRKERMTCTWTLGRRSA
FT                   SGWWTRALWTHPPQDPVPPRLPLQARSCPRRKHHIHLWDLSVSQD"
FT   mRNA            complement(join(2961831..2962044,2962911..2962974,
FT                   2963318..2963404,2967051..2967147,2970436..2970593,
FT                   2970664..2970856))
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, transcript variant mCT185660"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT185660.0 created
FT                   on 11-JUN-2003"
FT   CDS             complement(join(2961834..2962044,2962911..2962974,
FT                   2963318..2963404,2967051..2967147,2970436..2970546))
FT                   /codon_start=1
FT                   /gene="Polr3h"
FT                   /locus_tag="mCG_8784"
FT                   /product="polymerase (RNA) III (DNA directed) polypeptide
FT                   H, isoform CRA_b"
FT                   /note="gene_id=mCG8784.3 transcript_id=mCT185660.0
FT                   protein_id=mCP106916.0 isoform=CRA_b"
FT                   /protein_id="EDL04548.1"
FT                   /translation="MFVLVEMVDTVRIPPWQFERKLNDSIAEELNKKLANKVVYNVGLC
FT                   ICLFDITKLEDAYVFPGDGASHTKVHFRYVVFHPFLDEILIGKIKGCSPEGVHVSLGFF
FT                   DDILIPPESLQQPAKFDEAEQVWVWEYETEEGAHDLYMDTGEEIRFRVVDESFVDTSPT
FT                   GPSSAEAASSSEELPKKEAPYTLVVS"
FT   gene            2981410..2996384
FT                   /gene="Csdc2"
FT                   /locus_tag="mCG_8780"
FT                   /note="gene_id=mCG8780.1"
FT   mRNA            join(2981410..2981632,2991981..2992282,2994024..2994146,
FT                   2994555..2996384)
FT                   /gene="Csdc2"
FT                   /locus_tag="mCG_8780"
FT                   /product="cold shock domain containing C2, RNA binding"
FT                   /note="gene_id=mCG8780.1 transcript_id=mCT9223.1 created on
FT                   06-SEP-2002"
FT   assembly_gap    2986110..2986680
FT                   /estimated_length=571
FT                   /gap_type="unknown"
FT   assembly_gap    2988149..2988290
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   CDS             join(2992104..2992282,2994024..2994146,2994555..2994717)
FT                   /codon_start=1
FT                   /gene="Csdc2"
FT                   /locus_tag="mCG_8780"
FT                   /product="cold shock domain containing C2, RNA binding"
FT                   /note="gene_id=mCG8780.1 transcript_id=mCT9223.1
FT                   protein_id=mCP13107.2"
FT                   /protein_id="EDL04546.1"
FT                   /translation="MTSESTSPPVVPPLHSPKSPVWPTFPFHREGSRIWERGGGIAPRD
FT                   LPSPLPTKRTRTYSATARASAGPVFKGVCKQFSRSQGHGFITPENGSEDIFVHVSDIEG
FT                   EYVPVEGDEVTYKICPIPPKNQKFQAVEVVLTQLAPHTPHETWSGQVVGS"
FT   assembly_gap    2992707..2992874
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   gene            complement(2996557..3006327)
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /note="gene_id=mCG8801.2"
FT   mRNA            complement(join(2996557..2997061,2997373..2997488,
FT                   2998174..2998249,3001099..3001198,3001617..3001708,
FT                   3001810..3001886,3003241..3003358,3006169..3006321))
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /product="phosphomannomutase 1, transcript variant mCT9244"
FT                   /note="gene_id=mCG8801.2 transcript_id=mCT9244.2 created on
FT                   28-AUG-2002"
FT   mRNA            complement(join(2996561..2997061,2997373..2997488,
FT                   2998174..2998249,3001099..3001198,3001617..3001708,
FT                   3006155..3006320))
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /product="phosphomannomutase 1, transcript variant
FT                   mCT172943"
FT                   /note="gene_id=mCG8801.2 transcript_id=mCT172943.0 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(2996635..2997061,2997373..2997488,
FT                   2998174..2998249,3001099..3001141,3003311..3003358,
FT                   3006169..3006296))
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /product="phosphomannomutase 1, transcript variant
FT                   mCT172942"
FT                   /note="gene_id=mCG8801.2 transcript_id=mCT172942.0 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(2996636..2997061,2997373..2997456,
FT                   2998174..2998249,2999821..2999899,3001099..3001198,
FT                   3001617..3001708,3001810..3001886,3003241..3003358,
FT                   3006169..3006327))
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /product="phosphomannomutase 1, transcript variant
FT                   mCT172941"
FT                   /note="gene_id=mCG8801.2 transcript_id=mCT172941.0 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(2996923..2997061,2997373..2997456,
FT                   2998174..2998249,2999821..2999899,3001099..3001198,
FT                   3001617..3001708,3001810..3001886,3003241..3003358,
FT                   3006169..3006255))
FT                   /codon_start=1
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /product="phosphomannomutase 1, isoform CRA_a"
FT                   /note="gene_id=mCG8801.2 transcript_id=mCT172941.0
FT                   protein_id=mCP95860.0 isoform=CRA_a"
FT                   /protein_id="EDL04542.1"
FT                   /translation="MAVAVEGARRKERILCLFDVDGTLTPARQKIDPEVSAFLQKLRSR
FT                   VQIGVVGGSDYSKIAEQLGEGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEEL
FT                   LQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKCLLGV
FT                   QPRLASASLCRRASFLFAALIEGEDPGEVCGSLEDRVCWQGAAVLPRAGISATAWTAWM
FT                   KTALTSSTSLEMRPVLAGMTLRSMRTPGLSAIAWSPLRTLYSDAVSSSSQRQPTRRDWA
FT                   HS"
FT   CDS             complement(join(2996939..2997061,2997373..2997488,
FT                   2998174..2998249,3001099..3001198,3001617..3001708,
FT                   3001810..3001886,3003241..3003358,3006169..3006255))
FT                   /codon_start=1
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /product="phosphomannomutase 1, isoform CRA_c"
FT                   /note="gene_id=mCG8801.2 transcript_id=mCT9244.2
FT                   protein_id=mCP13100.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q545Q8"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="MGI:MGI:1353418"
FT                   /db_xref="UniProtKB/TrEMBL:Q545Q8"
FT                   /protein_id="EDL04544.1"
FT                   /translation="MAVAVEGARRKERILCLFDVDGTLTPARQKIDPEVSAFLQKLRSR
FT                   VQIGVVGGSDYSKIAEQLGEGDEVIEKFDYVFAENGTVQYKHGRLLSKQTIQNHLGEEL
FT                   LQDLINFCLSYMALLRLPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKKEKIR
FT                   EKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDEDSFDIIHFFGNETSP
FT                   GGNDFEIYADPRTVGHSVVSPQDTVQRCRELFFPETAHEA"
FT   CDS             complement(join(2996939..2997061,2997373..2997488,
FT                   2998174..2998249,3001099..3001198,3001617..3001645))
FT                   /codon_start=1
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /product="phosphomannomutase 1, isoform CRA_d"
FT                   /note="gene_id=mCG8801.2 transcript_id=mCT172943.0
FT                   protein_id=mCP95862.0 isoform=CRA_d"
FT                   /protein_id="EDL04545.1"
FT                   /translation="MALLRLPKKRGTFIEFRNGMLNVSPIGRSCTLEERIEFSELDKKE
FT                   KIREKFVEALKTEFAGKGLRFSRGGMISFDVFPEGWDKRYCLDSLDEDSFDIIHFFGNE
FT                   TSPGGNDFEIYADPRTVGHSVVSPQDTVQRCRELFFPETAHEA"
FT   CDS             complement(join(2997446..2997488,2998174..2998249,
FT                   3001099..3001141,3003311..3003358,3006169..3006255))
FT                   /codon_start=1
FT                   /gene="Pmm1"
FT                   /locus_tag="mCG_8801"
FT                   /product="phosphomannomutase 1, isoform CRA_b"
FT                   /note="gene_id=mCG8801.2 transcript_id=mCT172942.0
FT                   protein_id=mCP95861.0 isoform=CRA_b"
FT                   /db_xref="GOA:D6RG76"
FT                   /db_xref="InterPro:IPR005002"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="MGI:MGI:1353418"
FT                   /db_xref="UniProtKB/TrEMBL:D6RG76"
FT                   /protein_id="EDL04543.1"
FT                   /translation="MAVAVEGARRKERILCLFDVDGTLTPARQKIDPEVSAFLQKLRSR
FT                   LHPGGEDRVLGTGQEGEDPGEVCGSLEDRVCWQGAAVLPRRHDKLRCLPRGLG"
FT   assembly_gap    3013779..3013798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3017085..3017448
FT                   /estimated_length=364
FT                   /gap_type="unknown"
FT   gene            <3018123..>3018578
FT                   /locus_tag="mCG_8804"
FT                   /note="gene_id=mCG8804.1"
FT   mRNA            <3018123..>3018578
FT                   /locus_tag="mCG_8804"
FT                   /product="mCG8804"
FT                   /note="gene_id=mCG8804.1 transcript_id=mCT9247.1 created on
FT                   06-SEP-2002"
FT   CDS             3018123..3018578
FT                   /codon_start=1
FT                   /locus_tag="mCG_8804"
FT                   /product="mCG8804"
FT                   /note="gene_id=mCG8804.1 transcript_id=mCT9247.1
FT                   protein_id=mCP13089.1"
FT                   /protein_id="EDL04541.1"
FT                   /translation="MAPRKGKEKKEEQVISLGPQVAEGENVFGVCHIFASFNDTFVHVT
FT                   DLSGKKTICRVTGRMKVKADRDESSLYAAMLAAQDVAQRCKELGITALHIKLRATGGNR
FT                   TKTPGPGAQSALRALARSGMKIGRIEDVTPIPSDSTRRKGGRCGRRL"
FT   gene            <3026254..>3026626
FT                   /locus_tag="mCG_1027626"
FT                   /note="gene_id=mCG1027626.1"
FT   mRNA            <3026254..>3026626
FT                   /locus_tag="mCG_1027626"
FT                   /product="mCG1027626"
FT                   /note="gene_id=mCG1027626.1 transcript_id=mCT145330.1
FT                   created on 04-OCT-2002"
FT   CDS             3026254..>3026626
FT                   /codon_start=1
FT                   /locus_tag="mCG_1027626"
FT                   /product="mCG1027626"
FT                   /note="gene_id=mCG1027626.1 transcript_id=mCT145330.1
FT                   protein_id=mCP83611.1"
FT                   /protein_id="EDL04540.1"
FT                   /translation="MAAWRLSLCARSLSAIRRLQAAPLCWKSSSSRAVVARSTAARKEQ
FT                   EEPTVQWMEDPDPEDENVYLKNPHFHGYDDDPKVDALNMHAVFFFGFSIALVLGTTFVA
FT                   YVPNYKMIEWARREAAMLVK"
FT   assembly_gap    3026628..3027054
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    3029375..3029886
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   gene            complement(3037987..>3061614)
FT                   /gene="D15Wsu75e"
FT                   /locus_tag="mCG_8781"
FT                   /note="gene_id=mCG8781.3"
FT   mRNA            complement(join(3037987..3040309,3043572..3043694,
FT                   3044967..3045076,3049217..3049238,3061335..>3061614))
FT                   /gene="D15Wsu75e"
FT                   /locus_tag="mCG_8781"
FT                   /product="DNA segment, Chr 15, Wayne State University 75,
FT                   expressed, transcript variant mCT189717"
FT                   /note="gene_id=mCG8781.3 transcript_id=mCT189717.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3037987..3040309,3043572..3043694,
FT                   3044967..3045076,3047996..3048065,3049217..3049238,
FT                   3061335..3061537))
FT                   /gene="D15Wsu75e"
FT                   /locus_tag="mCG_8781"
FT                   /product="DNA segment, Chr 15, Wayne State University 75,
FT                   expressed, transcript variant mCT9224"
FT                   /note="gene_id=mCG8781.3 transcript_id=mCT9224.2 created on
FT                   22-AUG-2002"
FT   CDS             complement(join(3040216..3040309,3043572..3043694,
FT                   3044967..3045076,3049217..3049238,3061335..>3061612))
FT                   /codon_start=1
FT                   /gene="D15Wsu75e"
FT                   /locus_tag="mCG_8781"
FT                   /product="DNA segment, Chr 15, Wayne State University 75,
FT                   expressed, isoform CRA_a"
FT                   /note="gene_id=mCG8781.3 transcript_id=mCT189717.0
FT                   protein_id=mCP110736.0 isoform=CRA_a"
FT                   /protein_id="EDL04538.1"
FT                   /translation="HLTVVVAGRGCPGASSAGPPLPRPQAGPRLGPPLPLLPTPVGYRK
FT                   VQAAAGCPRAIVAAATGPDGAAKSLSGEALRVRPVQGPGPPAQPHHAGETTGRHLGGTL
FT                   LGPPDSVVDVGNTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLTGRK
FT                   IPSYITDLPSEVLSTPFGQALRPFLDSIQIQPPGGNSVGRPNGQS"
FT   CDS             complement(join(3040216..3040309,3043572..3043694,
FT                   3044967..3045076,3047996..3048065,3049217..3049238,
FT                   3061335..3061422))
FT                   /codon_start=1
FT                   /gene="D15Wsu75e"
FT                   /locus_tag="mCG_8781"
FT                   /product="DNA segment, Chr 15, Wayne State University 75,
FT                   expressed, isoform CRA_b"
FT                   /note="gene_id=mCG8781.3 transcript_id=mCT9224.2
FT                   protein_id=mCP13098.2 isoform=CRA_b"
FT                   /protein_id="EDL04539.1"
FT                   /translation="MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHK
FT                   DEFFFGSSGISSCTPGGTLLGPPDSVVDVGNTEVTEEIFLEYLSSLGESLFRGEAYNLF
FT                   EHNCNTFSNEVAQFLTGRKIPSYITDLPSEVLSTPFGQALRPFLDSIQIQPPGGNSVGR
FT                   PNGQS"
FT   gene            <3060976..3085194
FT                   /gene="Xrcc6"
FT                   /locus_tag="mCG_8789"
FT                   /note="gene_id=mCG8789.2"
FT   mRNA            join(<3060976..3061036,3061339..3062656,3064169..3064281,
FT                   3067574..3067712,3067936..3068190,3070625..3070808,
FT                   3072345..3072531,3074239..3074407,3074680..3074841,
FT                   3076250..3076379,3080784..3080884,3082567..3082680,
FT                   3084832..3085194)
FT                   /gene="Xrcc6"
FT                   /locus_tag="mCG_8789"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 6, transcript variant mCT189723"
FT                   /note="gene_id=mCG8789.2 transcript_id=mCT189723.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(3061757..3061932,3062568..3062656,3064169..3064281,
FT                   3067574..3067712,3067936..3068190,3070625..3070808,
FT                   3072345..3072531,3074239..3074407,3074680..3074841,
FT                   3076250..3076379,3080784..3080884,3082567..3082680,
FT                   3084832..3085182)
FT                   /gene="Xrcc6"
FT                   /locus_tag="mCG_8789"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 6, transcript variant mCT9235"
FT                   /note="gene_id=mCG8789.2 transcript_id=mCT9235.1 created on
FT                   22-AUG-2002"
FT   CDS             join(<3062554..3062656,3064169..3064281,3067574..3067712,
FT                   3067936..3068190,3070625..3070808,3072345..3072531,
FT                   3074239..3074407,3074680..3074841,3076250..3076379,
FT                   3080784..3080884,3082567..3082680,3084832..3085028)
FT                   /codon_start=1
FT                   /gene="Xrcc6"
FT                   /locus_tag="mCG_8789"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 6, isoform CRA_a"
FT                   /note="gene_id=mCG8789.2 transcript_id=mCT189723.0
FT                   protein_id=mCP110739.0 isoform=CRA_a"
FT                   /protein_id="EDL04536.1"
FT                   /translation="LLSPSEQTNMSEWESYYKTEGEEEEEEEESPDTGGEYKYSGRDSL
FT                   IFLVDASRAMFESQGEDELTPFDMSIQCIQSVYTSKIISSDRDLLAVVFYGTEKDKNSV
FT                   NFKNIYVLQDLDNPGAKRVLELDQFKGQQGKKHFRDTVGHGSDYSLSEVLWVCANLFSD
FT                   VQLKMSHKRIMLFTNEDDPHGRDSAKASRARTKASDLRDTGIFLDLMHLKKPGGFDVSV
FT                   FYRDIITTAEDEDLGVHFEESSKLEDLLRKVRAKETKKRVLSRLKFKLGEDVVLMVGIY
FT                   NLVQKANKPFPVRLYRETNEPVKTKTRTFNVNTGSLLLPSDTKRSLTYGTRQIVLEKEE
FT                   TEELKRFDEPGLILMGFKPTVMLKKQHYLRPSLFVYPEESLVSGSSTLFSALLTKCVEK
FT                   KVIAVCRYTPRKNVSPYFVALVPQEEELDDQNIQVTPGGFQLVFLPYADDKRKVPFTEK
FT                   VTANQEQIDKMKAIVQKLRFTYRSDSFENPVLQQHFRNLEALALDMMESEQVVDLTLPK
FT                   VEAIKKRLGSLADEFKELVYPPGYNPEGKVAKRKQDDEGSTSKKPKVELSEEELKAHFR
FT                   KGTLGKLTVPTLKDICKAHGLKSGPKKQELLDALIRHLEKN"
FT   CDS             join(3062581..3062656,3064169..3064281,3067574..3067712,
FT                   3067936..3068190,3070625..3070808,3072345..3072531,
FT                   3074239..3074407,3074680..3074841,3076250..3076379,
FT                   3080784..3080884,3082567..3082680,3084832..3085028)
FT                   /codon_start=1
FT                   /gene="Xrcc6"
FT                   /locus_tag="mCG_8789"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 6, isoform CRA_b"
FT                   /note="gene_id=mCG8789.2 transcript_id=mCT9235.1
FT                   protein_id=mCP13111.2 isoform=CRA_b"
FT                   /protein_id="EDL04537.1"
FT                   /translation="MSEWESYYKTEGEEEEEEEESPDTGGEYKYSGRDSLIFLVDASRA
FT                   MFESQGEDELTPFDMSIQCIQSVYTSKIISSDRDLLAVVFYGTEKDKNSVNFKNIYVLQ
FT                   DLDNPGAKRVLELDQFKGQQGKKHFRDTVGHGSDYSLSEVLWVCANLFSDVQLKMSHKR
FT                   IMLFTNEDDPHGRDSAKASRARTKASDLRDTGIFLDLMHLKKPGGFDVSVFYRDIITTA
FT                   EDEDLGVHFEESSKLEDLLRKVRAKETKKRVLSRLKFKLGEDVVLMVGIYNLVQKANKP
FT                   FPVRLYRETNEPVKTKTRTFNVNTGSLLLPSDTKRSLTYGTRQIVLEKEETEELKRFDE
FT                   PGLILMGFKPTVMLKKQHYLRPSLFVYPEESLVSGSSTLFSALLTKCVEKKVIAVCRYT
FT                   PRKNVSPYFVALVPQEEELDDQNIQVTPGGFQLVFLPYADDKRKVPFTEKVTANQEQID
FT                   KMKAIVQKLRFTYRSDSFENPVLQQHFRNLEALALDMMESEQVVDLTLPKVEAIKKRLG
FT                   SLADEFKELVYPPGYNPEGKVAKRKQDDEGSTSKKPKVELSEEELKAHFRKGTLGKLTV
FT                   PTLKDICKAHGLKSGPKKQELLDALIRHLEKN"
FT   gene            complement(3086470..3092639)
FT                   /locus_tag="mCG_8791"
FT                   /note="gene_id=mCG8791.2"
FT   mRNA            complement(join(3086470..3087478,3089007..3089127,
FT                   3092571..3092639))
FT                   /locus_tag="mCG_8791"
FT                   /product="mCG8791"
FT                   /note="gene_id=mCG8791.2 transcript_id=mCT9232.2 created on
FT                   24-SEP-2002"
FT   CDS             complement(join(3087216..3087478,3089007..3089127,
FT                   3092571..3092573))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8791"
FT                   /product="mCG8791"
FT                   /note="gene_id=mCG8791.2 transcript_id=mCT9232.2
FT                   protein_id=mCP13082.2"
FT                   /protein_id="EDL04535.1"
FT                   /translation="MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKT
FT                   LNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSV
FT                   TIKEGSQLKQQIQSIQQSIERLLV"
FT   assembly_gap    3094081..3094104
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3102238..3102436
FT                   /estimated_length=199
FT                   /gap_type="unknown"
FT   gene            3115130..3173461
FT                   /locus_tag="mCG_141066"
FT                   /note="gene_id=mCG141066.0"
FT   mRNA            join(3115130..3115350,3116945..3117068,3117902..3117952,
FT                   3120112..3120185,3122593..3122698,3124988..3125191,
FT                   3126978..3127108,3128155..3128269,3129895..3130011,
FT                   3131223..3131322,3131428..3131562,3134575..3134689,
FT                   3136369..3136460,3137679..3137820,3138957..3139068,
FT                   3142685..3142745,3144792..3144889,3147745..3147913,
FT                   3148225..3148372,3149930..3150205,3153821..3153986,
FT                   3156220..3156318,3159126..3159236,3159523..3159686,
FT                   3162114..3162195,3162358..3162533,3170037..3170118,
FT                   3170513..3170619,3171498..3171629,3171801..3171913,
FT                   3173260..3173461)
FT                   /locus_tag="mCG_141066"
FT                   /product="mCG141066"
FT                   /note="gene_id=mCG141066.0 transcript_id=mCT172903.0
FT                   created on 06-SEP-2002"
FT   CDS             join(3115192..3115350,3116945..3117068,3117902..3117952,
FT                   3120112..3120185,3122593..3122698,3124988..3125191,
FT                   3126978..3127108,3128155..3128269,3129895..3130011,
FT                   3131223..3131322,3131428..3131562,3134575..3134689,
FT                   3136369..3136460,3137679..3137820,3138957..3139068,
FT                   3142685..3142745,3144792..3144889,3147745..3147913,
FT                   3148225..3148372,3149930..3150205,3153821..3153986,
FT                   3156220..3156318,3159126..3159236,3159523..3159686,
FT                   3162114..3162195,3162358..3162533,3170037..3170118,
FT                   3170513..3170619,3171498..3171629,3171801..3171913,
FT                   3173260..3173305)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141066"
FT                   /product="mCG141066"
FT                   /note="gene_id=mCG141066.0 transcript_id=mCT172903.0
FT                   protein_id=mCP95822.0"
FT                   /protein_id="EDL04534.1"
FT                   /translation="MTAADHPAFGRDEEAALLLERTHHRHDPRWLLPVSPHVCMACALE
FT                   LLPEPGVSLVRKKHVVFCFQDALVRHTSLVAQLVAQDQRVCIHFVRVLFGLLNSVEDGS
FT                   MADLCIEVLVQLTTQPNMEQTIRCLMNECHRELCNLRSMGGSLATTTLLGKLVDTIPGL
FT                   ADELVMEHGNLMEHLLRGLVYPNEGVQASICYLYGKLYSSPTAAEMLSGHFREKLCALF
FT                   LSTLDSAQTKDLQINCLGLLRQLLKYDLFVSLIMNKSVPVEGAESVERPSRETSLPLVL
FT                   KKFLLSRDEILQVASSHCITAVLVHSPAKHAVAFIHADIPEFLFEHLSSSSEILVWSSY
FT                   NCLILLAEEPLFFSKCHTVYGIEAVVRSLQGSQQMTNTELHTQGLLLFKEILTRQPEEI
FT                   RLFTSSALCRDASRALQEAVSSPVLAVAAEALRAISAFLRKDHQSSLPVQYRALRALLE
FT                   AMLSRCMEFSQTPLNRRSLGHACSRNSEKATLRKGSFLLSTLEGFRNACRLAVEFQGEP
FT                   SAQENPFTAPSAEKEDTLEAFSEYLLSACDSQCIPMVMRYSEEATHPKLMEVFLSILHS
FT                   LFVIIPHMKVKFSRKLADSSFIRLTLELKARFCSGQSHSSLNQVCSSFLYYMCLNLLSA
FT                   PEKTEPLSQEELSAVSEFLQHGLPHISSRTPESLAFLSDRQYVEAATRQRQYCILLLFY
FT                   LAHIHDDRFVPEAELFVAVQSFLLSLQDQGECPPPVVCKASMYLLAVCGDKDSALAEAV
FT                   ISAIRKFLEGIPDLRGVYTHHPLLLRFFLAYPGLMSRFGHRVLELWFSWEESGYENLDD
FT                   DSSPGRTVFPANLAALFRVLQSTPSILLILLDLVYSSPVDTARKVLIVLRVFLWENEDV
FT                   KVGGLIRGHFLLILQRLLVEYGASTSGGNLPLLLNLLSLVQMRNESEQELDSMAMKLLH
FT                   QVSMLCGKCSPAHVDILQPSFNFLYWSLHQTTPSSQKRAAAVLLSSTALLELLEKMLAL
FT                   TWTETGSSPRTPLLSSAWLLTASFSAQQHNGNLQVHRTLSVELNQVLKALSFPKKMSAL
FT                   LSAAILRFLRTALQQSFSSALVVLVPSGDQPLSTPEDAVLAPLGKSQVLALLIGLQNLL
FT                   VQKDPLLSQACIGCLEALLDYLHARSPDIALHVASQPWNRFLLFTLLDAGENSFLRPEI
FT                   LRLMTLFVQYRSSCVLSREEVGLILQGAALVDLSALSNDTLQALHGFLLQVQSMSLLND
FT                   QHMTQTLQSSLEGLCSRTFPAQPLFQDMLCLGGVSVSQAHIRG"
FT   assembly_gap    3119834..3120021
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    3123407..3123533
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    3132395..3132415
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    3135309..3135332
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    3140404..3140423
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3165230..3165249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3174591..3188847
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /note="gene_id=mCG20391.3"
FT   mRNA            join(3174591..3174695,3176699..3176817,3179930..3180013,
FT                   3181228..3181409,3181717..3181788,3187513..3188847)
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, transcript variant
FT                   mCT186793"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT186793.0 created
FT                   on 03-NOV-2003"
FT   mRNA            join(3174609..3174695,3176699..3176817,3178071..3178192,
FT                   3178392..3178476,3181228..3181409,3181717..3181788,
FT                   3187513..3188228)
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, transcript variant
FT                   mCT20936"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT20936.2 created
FT                   on 03-NOV-2003"
FT   mRNA            join(3174652..3174695,3176699..3176817,3178071..3178192,
FT                   3181228..3181409,3181717..3181788,3187513..3187551,
FT                   3188546..3188690)
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, transcript variant
FT                   mCT172907"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT172907.0 created
FT                   on 03-NOV-2003"
FT   mRNA            join(3174663..3174695,3176699..3176817,3178071..3178585)
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, transcript variant
FT                   mCT186794"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT186794.0 created
FT                   on 03-NOV-2003"
FT   CDS             join(3176715..3176817,3178071..3178192,3178392..3178476,
FT                   3181228..3181409,3181717..3181788,3187513..3187638)
FT                   /codon_start=1
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, isoform CRA_d"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT20936.2
FT                   protein_id=mCP13102.2 isoform=CRA_d"
FT                   /protein_id="EDL04532.1"
FT                   /translation="MDLLQFLAAFSVLLWPGTEVTGALKSTLDPSLKIYKKMFEVKRRE
FT                   QLLALKNLAQLNDIHQQYKILDVMLKGLFKVLEDSRTVLIAADVLPDGPVPQDEKLKDA
FT                   FSHVVENTAFFGDVVLRFPKIVHHYFDHNSNWNLLIRWGISFCNQTGVFDQGPHSPILS
FT                   LMAQELGITEKDSDFRNPFKTDQTEFIPSTDPFQKALREEEKRRKKEERRKEIRKGPRI
FT                   SRSQSEL"
FT   CDS             join(3176715..3176817,3178071..3178192,3181228..3181335)
FT                   /codon_start=1
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, isoform CRA_e"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT172907.0
FT                   protein_id=mCP95826.0 isoform=CRA_e"
FT                   /protein_id="EDL04533.1"
FT                   /translation="MDLLQFLAAFSVLLWPGTEVTGALKSTLDPSLKIYKKMFEVKRRE
FT                   QLLALKNLAQLNDIHQQYKILDVMLKGLFKLSRTWWRTQPFLVTSCCASQRLSTTTLTI
FT                   IPTGTS"
FT   CDS             join(3176715..3176817,3179930..3179955)
FT                   /codon_start=1
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, isoform CRA_a"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT186793.0
FT                   protein_id=mCP108034.0 isoform=CRA_a"
FT                   /protein_id="EDL04529.1"
FT                   /translation="MDLLQFLAAFSVLLWPGTEVTGALKSTLDPSLKISGCGATHL"
FT   CDS             join(3176715..3176817,3178071..3178342)
FT                   /codon_start=1
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, isoform CRA_b"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT186794.0
FT                   protein_id=mCP108033.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR026321"
FT                   /db_xref="MGI:MGI:1923707"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CED1"
FT                   /protein_id="EDL04530.1"
FT                   /translation="MDLLQFLAAFSVLLWPGTEVTGALKSTLDPSLKIYKKMFEVKRRE
FT                   QLLALKNLAQLNDIHQQYKILDVMLKGLFKVCQEAGQLAAGQGFSWSTEEGFSKGDSVH
FT                   RGSDPYVEGLEWDSGNGGRN"
FT   mRNA            join(3178317..3178476,3181228..3181409,3181717..3181788,
FT                   3187513..3187743)
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, transcript variant
FT                   mCT186795"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT186795.0 created
FT                   on 03-NOV-2003"
FT   CDS             join(3178377..3178476,3181228..3181409,3181717..3181788,
FT                   3187513..3187638)
FT                   /codon_start=1
FT                   /gene="2310042L06Rik"
FT                   /locus_tag="mCG_20391"
FT                   /product="RIKEN cDNA 2310042L06, isoform CRA_c"
FT                   /note="gene_id=mCG20391.3 transcript_id=mCT186795.0
FT                   protein_id=mCP108032.0 isoform=CRA_c"
FT                   /protein_id="EDL04531.1"
FT                   /translation="MGFLQVLEDSRTVLIAADVLPDGPVPQDEKLKDAFSHVVENTAFF
FT                   GDVVLRFPKIVHHYFDHNSNWNLLIRWGISFCNQTGVFDQGPHSPILSLMAQELGITEK
FT                   DSDFRNPFKTDQTEFIPSTDPFQKALREEEKRRKKEERRKEIRKGPRISRSQSEL"
FT   assembly_gap    3190407..3190426
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3194297..3252479
FT                   /gene="Srebf2"
FT                   /locus_tag="mCG_20385"
FT                   /note="gene_id=mCG20385.2"
FT   mRNA            join(3194297..3194541,3216767..3217183,3218131..3218312,
FT                   3219782..3219928,3222126..3222347,3224185..3224299,
FT                   3224435..3224616,3225746..3225938,3226395..3226576,
FT                   3228998..3229274,3232380..3232549,3239315..3239483,
FT                   3241165..3241282,3242035..3242144,3243281..3243467,
FT                   3244739..3244907,3246756..3246941,3250306..3250417,
FT                   3250818..3252479)
FT                   /gene="Srebf2"
FT                   /locus_tag="mCG_20385"
FT                   /product="sterol regulatory element binding factor 2,
FT                   transcript variant mCT20930"
FT                   /note="gene_id=mCG20385.2 transcript_id=mCT20930.2 created
FT                   on 06-SEP-2002"
FT   CDS             join(3194454..3194541,3216767..3217183,3218131..3218312,
FT                   3219782..3219928,3222126..3222347,3224185..3224299,
FT                   3224435..3224616,3225746..3225938,3226395..3226576,
FT                   3228998..3229274,3232380..3232549,3239315..3239483,
FT                   3241165..3241282,3242035..3242144,3243281..3243467,
FT                   3244739..3244907,3246756..3246941,3250306..3250417,
FT                   3250818..3251038)
FT                   /codon_start=1
FT                   /gene="Srebf2"
FT                   /locus_tag="mCG_20385"
FT                   /product="sterol regulatory element binding factor 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20385.2 transcript_id=mCT20930.2
FT                   protein_id=mCP13122.2 isoform=CRA_b"
FT                   /protein_id="EDL04528.1"
FT                   /translation="MDESSELGVLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDL
FT                   FSEQLCSSFPGGGSNGGSGNNSSGRGNNGGATDPAVQRSFSQVPLSTFSPSAASPQAPA
FT                   LQVKVSPTPPRATPVLQPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNA
FT                   ATSFQVLQPQVQSLVTSPQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAA
FT                   PQVQQVPVLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLV
FT                   GSNGTILTTMPVMMGQEKVPIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKII
FT                   ELKDLVMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLG
FT                   SLVDSDVDLKIDDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDS
FT                   PPVALGMVDRSRILLCVLTFLGLSFNPLTSLLQWGGAHNTDQHPYSGSGRSVLSLESGA
FT                   GGWFDWMVPTLLLWLVNGVIVLSVFVKLLVHGEPVIRPHSRPSVTFWRHRKQADLDLAK
FT                   GDFAAAAANLQTCLSVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQRWR
FT                   ATPATAAGFEDEAKSSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAE
FT                   EKILPSTLIEIHLTAAMGLKTRCGGKLGFLASYFLNRAQSLCGPEHSTVPDSLRWLCHP
FT                   LGQKFFMERSWSIKSAAKESLYCAQRSPADPIAQVHQAFCKNLLERAVESLVKPQAKKK
FT                   AGDQEEESCEFSSALEYLKLLHSFVDSVGFVTSPFSSSSVLRSALGPDVICRWWTSAVT
FT                   MAISWLQGDDAAVRSRFTEVERVPKALEVTECVSSLVVYVLFAKGILVRSPLVKAVFYT
FT                   CRAMHASLSGKADGQQNSFCHCERASGHLWSSLNVSGTTSDPSLNHVIQLFTCDLLLSL
FT                   RTALWQKQASASQLLGETYHASGTELAGFQRDLGSLRRLAHSFRPAYRKVFLHEATVRL
FT                   MAGASPTRTHQLLEHSLRRRPTQNTKHGEVDTWPGQRERATAILLACRHLPLSFLSSPG
FT                   QRAVLLAEAARTLEKVGDRRSCSDCQQMIVKLGGGTAIAAS"
FT   mRNA            join(<3194467..3194541,3216767..3217183,3218131..3218312,
FT                   3219782..3219928,3222126..3222347,3224185..3224299,
FT                   3224435..3224616,3225746..3225938,3226395..3226576,
FT                   3228998..3229274,3232380..3232549,3239315..3239483,
FT                   3241165..3241282,3242035..3242144,3243281..3243413,
FT                   3244739..3244907,3246756..3246941,3250306..3250417,
FT                   3250818..3251797)
FT                   /gene="Srebf2"
FT                   /locus_tag="mCG_20385"
FT                   /product="sterol regulatory element binding factor 2,
FT                   transcript variant mCT189661"
FT                   /note="gene_id=mCG20385.2 transcript_id=mCT189661.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3194469..3194541,3216767..3217183,3218131..3218312,
FT                   3219782..3219928,3222126..3222347,3224185..3224299,
FT                   3224435..3224616,3225746..3225938,3226395..3226576,
FT                   3228998..3229274,3232380..3232549,3239315..3239483,
FT                   3241165..3241282,3242035..3242144,3243281..3243413,
FT                   3244739..3244907,3246756..3246941,3250306..3250417,
FT                   3250818..3251038)
FT                   /codon_start=1
FT                   /gene="Srebf2"
FT                   /locus_tag="mCG_20385"
FT                   /product="sterol regulatory element binding factor 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20385.2 transcript_id=mCT189661.0
FT                   protein_id=mCP110665.0 isoform=CRA_a"
FT                   /protein_id="EDL04527.1"
FT                   /translation="ELGVLETMETLTELGDELTLGDIDEMLQFVSNQVGEFPDLFSEQL
FT                   CSSFPGGGSNGGSGNNSSGRGNNGGATDPAVQRSFSQVPLSTFSPSAASPQAPALQVKV
FT                   SPTPPRATPVLQPRPQPQPQPPAQLQQQTVMITPTFSTAPQTRIIQQPLIYQNAATSFQ
FT                   VLQPQVQSLVTSPQVQPVTIQQQVQTVQAQRVLTQTANGTLQTLAPATVQTVAAPQVQQ
FT                   VPVLVQPQIIKTDSLVLTTLKTDGSPVMAAVQNPALTALTAPIQTAALQVPTLVGSNGT
FT                   ILTTMPVMMGQEKVPIKQVPGGVKQLDPPKEGERRTTHNIIEKRYRSSINDKIIELKDL
FT                   VMGTDAKMHKSGVLRKAIDYIKYLQQVNHKLRQENMVLKLANQKNKLLKGIDLGSLVDS
FT                   DVDLKIDDFNQNVLLMSPPASDSGSQAGFSPYSIDSEPGSPLLDDAKVKDEPDSPPVAL
FT                   GMVDRSRILLCVLTFLGLSFNPLTSLLQWGGAHNTDQHPYSGSGRSVLSLESGAGGWFD
FT                   WMVPTLLLWLVNGVIVLSVFVKLLVHGEPVIRPHSRPSVTFWRHRKQADLDLAKGDFAA
FT                   AAANLQTCLSVLGRALPTSRLDLACSLSWNVIRYSLQKLRLVRWLLKKVFQRWRATPAT
FT                   AAGFEDEAKSSARDAALAYHRLHQLHITGKLPAGSACSDVHMALCAVNLAECAEEKILP
FT                   STLIEIHLTAAMGLKTRCGGKLGFLASYFLNRAQSLCGPEHSTVPDSLRWLCHPLGQKF
FT                   FMERSWSIKSAAKESLYCAQRSPADPIAQVHQAFCKNLLERAVESLVKPQAKKKAGDQE
FT                   EESCEFSSALEYLKLLHSFVDSVGFVTSPFSSSSVLRSALGPDVICRWWTSAVTMAISW
FT                   LQGDDAAVRSRFTEVERVPKALEVTESPLVKAVFYTCRAMHASLSGKADGQQNSFCHCE
FT                   RASGHLWSSLNVSGTTSDPSLNHVIQLFTCDLLLSLRTALWQKQASASQLLGETYHASG
FT                   TELAGFQRDLGSLRRLAHSFRPAYRKVFLHEATVRLMAGASPTRTHQLLEHSLRRRPTQ
FT                   NTKHGEVDTWPGQRERATAILLACRHLPLSFLSSPGQRAVLLAEAARTLEKVGDRRSCS
FT                   DCQQMIVKLGGGTAIAAS"
FT   assembly_gap    3194703..3194783
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    3203756..3203792
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    3229728..3229953
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   gene            complement(3254076..>3259133)
FT                   /locus_tag="mCG_20393"
FT                   /note="gene_id=mCG20393.2"
FT   mRNA            complement(join(3254076..3254668,3254872..3255018,
FT                   3255584..3255717,3259012..>3259133))
FT                   /locus_tag="mCG_20393"
FT                   /product="mCG20393"
FT                   /note="gene_id=mCG20393.2 transcript_id=mCT20938.2 created
FT                   on 06-SEP-2002"
FT   CDS             complement(join(3254274..3254668,3254872..3255018,
FT                   3255584..3255717,3259012..>3259133))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20393"
FT                   /product="mCG20393"
FT                   /note="gene_id=mCG20393.2 transcript_id=mCT20938.2
FT                   protein_id=mCP13109.2"
FT                   /protein_id="EDL04526.1"
FT                   /translation="RSHTAVYAVCGVAALLVLVGIGARLGLERAHSPRARRTVTRTLTE
FT                   LLKQPGPQEPLPPPLGPPLGNCVQVQMGDGVLRGSPHNSTDKKRLNNAPLGSATPGPPR
FT                   GPRLQGGGSLTLQPDYAKFATLKAAALKATEVAPQDFYQRFPSTETGPRTLPARVPRPP
FT                   EDLPALLDACPWAPPGYVPPAGPVSSVPYAAWTAGRPARPLPRSHLVAQVSPAPRRPNH
FT                   APRRQFSVEKLPEAFSAQQASFYSSAGRGPRHLSTNSKAEVTV"
FT   assembly_gap    3262678..3262697
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3268799..3271411)
FT                   /locus_tag="mCG_20392"
FT                   /note="gene_id=mCG20392.1"
FT   mRNA            complement(join(3268799..3270328,3271154..3271411))
FT                   /locus_tag="mCG_20392"
FT                   /product="mCG20392"
FT                   /note="gene_id=mCG20392.1 transcript_id=mCT20937.2 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(3270152..3270328,3271154..3271387))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20392"
FT                   /product="mCG20392"
FT                   /note="gene_id=mCG20392.1 transcript_id=mCT20937.2
FT                   protein_id=mCP13103.2"
FT                   /protein_id="EDL04525.1"
FT                   /translation="MGARRLRVRSQRSRDSSVPTQCNQTECFDPLVRNCVSCELFHTPD
FT                   TGHSKQRHGDRRDLPEVSSLPAPHAPLLTLEPMSLENVFVPSSETPHASAPTWPPLKED
FT                   ADSALPRHSVPVPATELGSTELVTTKTAGPEQ"
FT   assembly_gap    3270708..3271142
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    3281049..3281085
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            complement(3281561..>3292200)
FT                   /gene="Cenpm"
FT                   /locus_tag="mCG_20397"
FT                   /note="gene_id=mCG20397.1"
FT   mRNA            complement(join(3281561..3281964,3287332..3287411,
FT                   3288779..3288871,3291585..3291664,3292075..>3292200))
FT                   /gene="Cenpm"
FT                   /locus_tag="mCG_20397"
FT                   /product="centromere protein M, transcript variant
FT                   mCT189690"
FT                   /note="gene_id=mCG20397.1 transcript_id=mCT189690.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3281561..3281964,3286746..3286837,
FT                   3287332..3287411,3288779..3288871,3291585..3291664,
FT                   3292075..3292200))
FT                   /gene="Cenpm"
FT                   /locus_tag="mCG_20397"
FT                   /product="centromere protein M, transcript variant
FT                   mCT20942"
FT                   /note="gene_id=mCG20397.1 transcript_id=mCT20942.1 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(3281768..3281964,3287332..3287411,
FT                   3288779..3288871,3291585..3291664,3292075..>3292197))
FT                   /codon_start=1
FT                   /gene="Cenpm"
FT                   /locus_tag="mCG_20397"
FT                   /product="centromere protein M, isoform CRA_a"
FT                   /note="gene_id=mCG20397.1 transcript_id=mCT189690.0
FT                   protein_id=mCP110667.0 isoform=CRA_a"
FT                   /protein_id="EDL04523.1"
FT                   /translation="RGGPCDGLKAPCAEPSGAAAAEMSVLRSMDKLPDLNRATVLLVST
FT                   EDALLQQLAESMLKDDCASELRVHLANSLPLPSNVNRPRIDLIVFVINLHSKYSLQKVE
FT                   EFLQHVDSSFFLGKVCFLVTGGGKLSCSHGAASGAHSADLRWPCARRLRAEPDVLAAEP
FT                   REPPIQGAVSITALHTFAASSKSSHCW"
FT   CDS             complement(join(3281824..3281964,3286746..3286837,
FT                   3287332..3287411,3288779..3288871,3291585..3291664,
FT                   3292075..3292131))
FT                   /codon_start=1
FT                   /gene="Cenpm"
FT                   /locus_tag="mCG_20397"
FT                   /product="centromere protein M, isoform CRA_b"
FT                   /note="gene_id=mCG20397.1 transcript_id=mCT20942.1
FT                   protein_id=mCP13123.1 isoform=CRA_b"
FT                   /protein_id="EDL04524.1"
FT                   /translation="MSVLRSMDKLPDLNRATVLLVSTEDALLQQLAESMLKDDCASELR
FT                   VHLANSLPLPSNVNRPRIDLIVFVINLHSKYSLQKVEEFLQHVDSSFFLGKVCFLVTGA
FT                   GQESHCSVHQNTVIKLAHTYRSPLLLCDLQVESFRAAMARRLVRILQICAGHVPGVSAL
FT                   NLMSLLRSPENPPSKEL"
FT   gene            3299849..3308204
FT                   /locus_tag="mCG_20394"
FT                   /note="gene_id=mCG20394.2"
FT   mRNA            join(3299849..3300200,3307018..3307507)
FT                   /locus_tag="mCG_20394"
FT                   /product="mCG20394, transcript variant mCT172908"
FT                   /note="gene_id=mCG20394.2 transcript_id=mCT172908.0 created
FT                   on 28-AUG-2002"
FT   CDS             join(3300025..3300200,3307018..3307180)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20394"
FT                   /product="mCG20394, isoform CRA_a"
FT                   /note="gene_id=mCG20394.2 transcript_id=mCT172908.0
FT                   protein_id=mCP95827.0 isoform=CRA_a"
FT                   /protein_id="EDL04521.1"
FT                   /translation="MERSCFEPREASLGRYWDPFLPLRGRNQWTIKASQRDLRCRDTPS
FT                   LPAVMDDRCREPRCQSLRDAALSGLVCACLPGHLRPHPGGLWSLHLLLRAWPAGGAQVA
FT                   HAAPPGGP"
FT   mRNA            join(<3303544..3303838,3307018..3308204)
FT                   /locus_tag="mCG_20394"
FT                   /product="mCG20394, transcript variant mCT20939"
FT                   /note="gene_id=mCG20394.2 transcript_id=mCT20939.1 created
FT                   on 28-AUG-2002"
FT   CDS             join(<3303546..3303838,3307018..3307180)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20394"
FT                   /product="mCG20394, isoform CRA_b"
FT                   /note="gene_id=mCG20394.2 transcript_id=mCT20939.1
FT                   protein_id=mCP13110.1 isoform=CRA_b"
FT                   /protein_id="EDL04522.1"
FT                   /translation="CGGPQREGSLIVRRGTRVPSQPKTATSWPTQRPPDQTSSISRGSS
FT                   GLSLSASSSHSGHRWQCLWGQQLRLSPLANTEPLRLRHLALCKDCRIGVSGMSQSLRDA
FT                   ALSGLVCACLPGHLRPHPGGLWSLHLLLRAWPAGGAQVAHAAPPGGP"
FT   assembly_gap    3310596..3310985
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    3311781..3312030
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   gene            3322507..3341352
FT                   /gene="Sept3"
FT                   /locus_tag="mCG_133080"
FT                   /note="gene_id=mCG133080.1"
FT   mRNA            join(3322507..3322671,3326915..3327106,3330559..3330687,
FT                   3331176..3331257,3331871..3332008,3333286..3333403,
FT                   3333936..3334031,3336695..3336794,3337904..3337955,
FT                   3338238..3341124)
FT                   /gene="Sept3"
FT                   /locus_tag="mCG_133080"
FT                   /product="septin 3, transcript variant mCT134444"
FT                   /note="gene_id=mCG133080.1 transcript_id=mCT134444.1
FT                   created on 18-DEC-2002"
FT   assembly_gap    3322775..3322794
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<3322795..3322980,3326915..3327106,3330559..3330687,
FT                   3331176..3331257,3331871..3332008,3333286..3333403,
FT                   3333936..3334031,3336695..3336794,3337904..3337955,
FT                   3338238..3338331,3338751..3338816,3340743..3341352)
FT                   /gene="Sept3"
FT                   /locus_tag="mCG_133080"
FT                   /product="septin 3, transcript variant mCT189726"
FT                   /note="gene_id=mCG133080.1 transcript_id=mCT189726.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(3322795..3322980,3326944..3327106,3330559..3330687,
FT                   3331176..3331257,3331871..3332008,3333286..3333403,
FT                   3333936..3334031,3336695..3336794,3337904..3337955,
FT                   3338238..3338331,3338751..3338816,3340743..3341352)
FT                   /gene="Sept3"
FT                   /locus_tag="mCG_133080"
FT                   /product="septin 3, transcript variant mCT172403"
FT                   /note="gene_id=mCG133080.1 transcript_id=mCT172403.0
FT                   created on 18-DEC-2002"
FT   CDS             join(<3322842..3322980,3326915..3327106,3330559..3330687,
FT                   3331176..3331257,3331871..3332008,3333286..3333403,
FT                   3333936..3334031,3336695..3336794,3337904..3337955,
FT                   3338238..3338331,3338751..3338804)
FT                   /codon_start=1
FT                   /gene="Sept3"
FT                   /locus_tag="mCG_133080"
FT                   /product="septin 3, isoform CRA_c"
FT                   /note="gene_id=mCG133080.1 transcript_id=mCT189726.0
FT                   protein_id=mCP110691.0 isoform=CRA_c"
FT                   /protein_id="EDL04520.1"
FT                   /translation="AVRRRGARPGCRGRLAQGEPAPGSALQPRALSISRRTRDKGGFMS
FT                   KGLPEARTDAAMSELVPEPRPKPAVPMKPVSINSNLLGYIGIDTIIEQMRKKTMKTGFD
FT                   FNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGVKMK
FT                   LTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLYFIS
FT                   PTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEFYPQ
FT                   KEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNHCEF
FT                   ALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPNKKLCASLKRSGEGFNL"
FT   CDS             join(3326944..3327106,3330559..3330687,3331176..3331257,
FT                   3331871..3332008,3333286..3333403,3333936..3334031,
FT                   3336695..3336794,3337904..3337955,3338238..3338331,
FT                   3338751..3338804)
FT                   /codon_start=1
FT                   /gene="Sept3"
FT                   /locus_tag="mCG_133080"
FT                   /product="septin 3, isoform CRA_b"
FT                   /note="gene_id=mCG133080.1 transcript_id=mCT172403.0
FT                   protein_id=mCP95322.0 isoform=CRA_b"
FT                   /protein_id="EDL04519.1"
FT                   /translation="MSELVPEPRPKPAVPMKPVSINSNLLGYIGIDTIIEQMRKKTMKT
FT                   GFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGV
FT                   KMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLY
FT                   FISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEF
FT                   YPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNH
FT                   CEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPNKKLCASLKRSGEGFN
FT                   L"
FT   CDS             join(3326944..3327106,3330559..3330687,3331176..3331257,
FT                   3331871..3332008,3333286..3333403,3333936..3334031,
FT                   3336695..3336794,3337904..3337955,3338238..3338373)
FT                   /codon_start=1
FT                   /gene="Sept3"
FT                   /locus_tag="mCG_133080"
FT                   /product="septin 3, isoform CRA_a"
FT                   /note="gene_id=mCG133080.1 transcript_id=mCT134444.1
FT                   protein_id=mCP83362.1 isoform=CRA_a"
FT                   /protein_id="EDL04518.1"
FT                   /translation="MSELVPEPRPKPAVPMKPVSINSNLLGYIGIDTIIEQMRKKTMKT
FT                   GFDFNIMVVGQSGLGKSTLVNTLFKSQVSRKASSWNREEKIPKTVEIKAIGHVIEEGGV
FT                   KMKLTVIDTPGFGDQINNENCWEPIEKYINEQYEKFLKEEVNIARKKRIPDTRVHCCLY
FT                   FISPTGHSLRPLDLEFMKHLSKVVNIIPVIAKADTMTLEEKSEFKQRVRKELEVNGIEF
FT                   YPQKEFDEDLEDKTENDKIRQESMPFAVVGSDKEYQVNGKRVLGRKTPWGIIEVENLNH
FT                   CEFALLRDFVIRTHLQDLKEVTHNIHYETYRAKRLNDNGGLPPVSVDTEESHDSNP"
FT   gene            3346450..3362117
FT                   /locus_tag="mCG_20395"
FT                   /note="gene_id=mCG20395.1"
FT   mRNA            join(3346450..3346564,3353211..3353319,3353584..3353725,
FT                   3353886..3353978,3356019..3356123,3361268..3362117)
FT                   /locus_tag="mCG_20395"
FT                   /product="mCG20395"
FT                   /note="gene_id=mCG20395.1 transcript_id=mCT20940.1 created
FT                   on 28-AUG-2002"
FT   CDS             join(3346503..3346564,3353211..3353319,3353584..3353725,
FT                   3353886..3353978,3356019..3356123,3361268..3361836)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20395"
FT                   /product="mCG20395"
FT                   /note="gene_id=mCG20395.1 transcript_id=mCT20940.1
FT                   protein_id=mCP13112.1"
FT                   /protein_id="EDL04517.1"
FT                   /translation="MAVNQNHTVDRRWAAIPHGESLLKKCSEVDLSFPQSPPGSNLFSG
FT                   TKRGALFLTSYRVIFVTSRADNDPMFSFTMPFHLMNNCTVEQPIFGANYIKGTIQAAPD
FT                   GGWEGSATFKIVFRKGGAIDFAQLMAKAASAAAQGVPLRVASFWMGPLGIYVITGDRNM
FT                   YAPQAYQVAYGAPPAGYGASPVGYGVPSAGYGAPPAGYGAPPVGYVAPSPGYDVLPPGY
FT                   GAVRYGSPPPLYVATPMGYGVPPPGYGPPPVRYGSPPPGYEAPTMEYGAQPPRYGTTPM
FT                   GSGSPPPRYEAPPMGYGTPPSGRESIPPGSRATSVAQEAPPAGSEAGHPMSVAVQNPEF
FT                   QASFPSTSSSQVHSPRSKM"
FT   assembly_gap    3373809..3373851
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   gene            complement(3377097..3386436)
FT                   /gene="Naga"
FT                   /locus_tag="mCG_20384"
FT                   /note="gene_id=mCG20384.2"
FT   mRNA            complement(join(3377097..3377760,3378211..3378354,
FT                   3379890..3380087,3382337..3382498,3383048..3383142,
FT                   3383394..3383571,3384321..3384492,3384938..3385073,
FT                   3385794..3385870,3386308..3386436))
FT                   /gene="Naga"
FT                   /locus_tag="mCG_20384"
FT                   /product="N-acetyl galactosaminidase, alpha, transcript
FT                   variant mCT20929"
FT                   /note="gene_id=mCG20384.2 transcript_id=mCT20929.2 created
FT                   on 22-AUG-2002"
FT   mRNA            complement(join(3377097..3377760,3378211..3378354,
FT                   3379890..3380087,3382337..3382498,3383048..3383142,
FT                   3383394..3383571,3384938..3385073,3385794..3385870,
FT                   3386308..3386398))
FT                   /gene="Naga"
FT                   /locus_tag="mCG_20384"
FT                   /product="N-acetyl galactosaminidase, alpha, transcript
FT                   variant mCT172407"
FT                   /note="gene_id=mCG20384.2 transcript_id=mCT172407.0 created
FT                   on 22-AUG-2002"
FT   mRNA            complement(join(3377098..3377760,3378211..3378354,
FT                   3379890..3380087,3382337..3382498,3383048..3383142,
FT                   3383394..3383571,3384321..3384492,3384938..3384989,
FT                   3385027..3385073,3385794..3385870,3386308..3386398))
FT                   /gene="Naga"
FT                   /locus_tag="mCG_20384"
FT                   /product="N-acetyl galactosaminidase, alpha, transcript
FT                   variant mCT172408"
FT                   /note="gene_id=mCG20384.2 transcript_id=mCT172408.0 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(3377614..3377760,3378211..3378354,
FT                   3379890..3380087,3382337..3382498,3383048..3383142,
FT                   3383394..3383571,3384321..3384492,3384938..3385073,
FT                   3385794..3385809))
FT                   /codon_start=1
FT                   /gene="Naga"
FT                   /locus_tag="mCG_20384"
FT                   /product="N-acetyl galactosaminidase, alpha, isoform CRA_c"
FT                   /note="gene_id=mCG20384.2 transcript_id=mCT20929.2
FT                   protein_id=mCP13086.2 isoform=CRA_c"
FT                   /protein_id="EDL04516.1"
FT                   /translation="MLQKTVLLLALVAQVLMLENGLLRTPPMGWLAWERFRCNIDCVED
FT                   PKNCISERLFMEMADRLAQDGWRDLGYVYLNIDDCWIGGRDASGRLIPDPKRFPHGIAF
FT                   LADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSR
FT                   ERAEGYPKMAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSRVCNLWRNYKDIQDSW
FT                   KSVLSILDWFVRHQDVLQPVAGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLL
FT                   MSTDLRTISPQNMDILQNPLMIKINQDPLGIQGRRILKSKSHIEVFKRYLSNQASALVF
FT                   FSRRTDMPFRFHCSLLELNYPKGRVYEGQNVFTGDIFSGLQTEVNFTVIINPSGVVMWY
FT                   LYPIKDLGISTMMSHW"
FT   CDS             complement(join(3377614..3377760,3378211..3378354,
FT                   3379890..3380087,3382337..3382498,3383048..3383142,
FT                   3383394..3383571,3384321..3384479))
FT                   /codon_start=1
FT                   /gene="Naga"
FT                   /locus_tag="mCG_20384"
FT                   /product="N-acetyl galactosaminidase, alpha, isoform CRA_b"
FT                   /note="gene_id=mCG20384.2 transcript_id=mCT172408.0
FT                   protein_id=mCP95326.0 isoform=CRA_b"
FT                   /protein_id="EDL04515.1"
FT                   /translation="MEMADRLAQDGWRDLGYVYLNIDDCWIGGRDASGRLIPDPKRFPH
FT                   GIAFLADYAHSLGLKLGIYEDMGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCF
FT                   SSSRERAEGYPKMAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSRVCNLWRNYKDI
FT                   QDSWKSVLSILDWFVRHQDVLQPVAGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLA
FT                   APLLMSTDLRTISPQNMDILQNPLMIKINQDPLGIQGRRILKSKSHIEVFKRYLSNQAS
FT                   ALVFFSRRTDMPFRFHCSLLELNYPKGRVYEGQNVFTGDIFSGLQTEVNFTVIINPSGV
FT                   VMWYLYPIKDLGISTMMSHW"
FT   CDS             complement(join(3377614..3377760,3378211..3378354,
FT                   3379890..3380087,3382337..3382498,3383048..3383142,
FT                   3383394..3383532))
FT                   /codon_start=1
FT                   /gene="Naga"
FT                   /locus_tag="mCG_20384"
FT                   /product="N-acetyl galactosaminidase, alpha, isoform CRA_a"
FT                   /note="gene_id=mCG20384.2 transcript_id=mCT172407.0
FT                   protein_id=mCP95327.0 isoform=CRA_a"
FT                   /protein_id="EDL04514.1"
FT                   /translation="MGKMTCMGYPGTTLDKVELDAETFAEWKVDMLKLDGCFSSSRERA
FT                   EGYPKMAAALNATGRPIAFSCSWPAYEGGLPPKVNYTEVSRVCNLWRNYKDIQDSWKSV
FT                   LSILDWFVRHQDVLQPVAGPGHWNDPDMLLIGNFGLSFDESRAQMALWTVLAAPLLMST
FT                   DLRTISPQNMDILQNPLMIKINQDPLGIQGRRILKSKSHIEVFKRYLSNQASALVFFSR
FT                   RTDMPFRFHCSLLELNYPKGRVYEGQNVFTGDIFSGLQTEVNFTVIINPSGVVMWYLYP
FT                   IKDLGISTMMSHW"
FT   gene            3386498..3393312
FT                   /gene="C920005C14Rik"
FT                   /locus_tag="mCG_49820"
FT                   /note="gene_id=mCG49820.2"
FT   mRNA            join(3386498..3386641,3390622..3393312)
FT                   /gene="C920005C14Rik"
FT                   /locus_tag="mCG_49820"
FT                   /product="RIKEN cDNA C920005C14, transcript variant
FT                   mCT182055"
FT                   /note="gene_id=mCG49820.2 transcript_id=mCT182055.0 created
FT                   on 25-APR-2003"
FT   mRNA            join(3388408..3388655,3390622..3393312)
FT                   /gene="C920005C14Rik"
FT                   /locus_tag="mCG_49820"
FT                   /product="RIKEN cDNA C920005C14, transcript variant
FT                   mCT182054"
FT                   /note="gene_id=mCG49820.2 transcript_id=mCT182054.0 created
FT                   on 25-APR-2003"
FT   mRNA            join(3388747..3388823,3390622..3393312)
FT                   /gene="C920005C14Rik"
FT                   /locus_tag="mCG_49820"
FT                   /product="RIKEN cDNA C920005C14, transcript variant
FT                   mCT50003"
FT                   /note="gene_id=mCG49820.2 transcript_id=mCT50003.2 created
FT                   on 25-APR-2003"
FT   CDS             3390849..3391628
FT                   /codon_start=1
FT                   /gene="C920005C14Rik"
FT                   /locus_tag="mCG_49820"
FT                   /product="RIKEN cDNA C920005C14, isoform CRA_a"
FT                   /note="gene_id=mCG49820.2 transcript_id=mCT182054.0
FT                   protein_id=mCP104976.0 isoform=CRA_a"
FT                   /protein_id="EDL04511.1"
FT                   /translation="MKLNKRSVAHYALSDSPADHTGFLRSWGGPGSPPTPSGTGRRYWF
FT                   VLKGNLLFSFETRESRVPLSLVVLEGCTVELAEAPVPEEFAFAIRFDAPGVRPHLLAAD
FT                   GQAAQEAWVKALSRASFGYMRLVVRELESQLQDARQSLALHRCASQRAVASCSKSQAPD
FT                   HRAPDPENGHFLPRDRSSIGTVEERGIRPIGRDLTEWELQGPASLLLSMGQSPVSPESS
FT                   CFSTLHDWYGKEIMELRRGWQQRAKGSQTENKSQNRP"
FT   CDS             3390849..3391628
FT                   /codon_start=1
FT                   /gene="C920005C14Rik"
FT                   /locus_tag="mCG_49820"
FT                   /product="RIKEN cDNA C920005C14, isoform CRA_a"
FT                   /note="gene_id=mCG49820.2 transcript_id=mCT182055.0
FT                   protein_id=mCP104977.0 isoform=CRA_a"
FT                   /protein_id="EDL04512.1"
FT                   /translation="MKLNKRSVAHYALSDSPADHTGFLRSWGGPGSPPTPSGTGRRYWF
FT                   VLKGNLLFSFETRESRVPLSLVVLEGCTVELAEAPVPEEFAFAIRFDAPGVRPHLLAAD
FT                   GQAAQEAWVKALSRASFGYMRLVVRELESQLQDARQSLALHRCASQRAVASCSKSQAPD
FT                   HRAPDPENGHFLPRDRSSIGTVEERGIRPIGRDLTEWELQGPASLLLSMGQSPVSPESS
FT                   CFSTLHDWYGKEIMELRRGWQQRAKGSQTENKSQNRP"
FT   CDS             3390849..3391628
FT                   /codon_start=1
FT                   /gene="C920005C14Rik"
FT                   /locus_tag="mCG_49820"
FT                   /product="RIKEN cDNA C920005C14, isoform CRA_a"
FT                   /note="gene_id=mCG49820.2 transcript_id=mCT50003.2
FT                   protein_id=mCP34626.2 isoform=CRA_a"
FT                   /protein_id="EDL04513.1"
FT                   /translation="MKLNKRSVAHYALSDSPADHTGFLRSWGGPGSPPTPSGTGRRYWF
FT                   VLKGNLLFSFETRESRVPLSLVVLEGCTVELAEAPVPEEFAFAIRFDAPGVRPHLLAAD
FT                   GQAAQEAWVKALSRASFGYMRLVVRELESQLQDARQSLALHRCASQRAVASCSKSQAPD
FT                   HRAPDPENGHFLPRDRSSIGTVEERGIRPIGRDLTEWELQGPASLLLSMGQSPVSPESS
FT                   CFSTLHDWYGKEIMELRRGWQQRAKGSQTENKSQNRP"
FT   gene            3393581..3396631
FT                   /gene="1500032L24Rik"
FT                   /locus_tag="mCG_20389"
FT                   /note="gene_id=mCG20389.3"
FT   mRNA            join(3393581..3393826,3395457..3395597,3396405..3396631)
FT                   /gene="1500032L24Rik"
FT                   /locus_tag="mCG_20389"
FT                   /product="RIKEN cDNA 1500032L24, transcript variant
FT                   mCT20934"
FT                   /note="gene_id=mCG20389.3 transcript_id=mCT20934.3 created
FT                   on 25-APR-2003"
FT   mRNA            join(3393608..3393777,3395457..3395597,3396405..3396631)
FT                   /gene="1500032L24Rik"
FT                   /locus_tag="mCG_20389"
FT                   /product="RIKEN cDNA 1500032L24, transcript variant
FT                   mCT182053"
FT                   /note="gene_id=mCG20389.3 transcript_id=mCT182053.0 created
FT                   on 25-APR-2003"
FT   mRNA            join(3394777..3394902,3395457..3395597,3396405..3396631)
FT                   /gene="1500032L24Rik"
FT                   /locus_tag="mCG_20389"
FT                   /product="RIKEN cDNA 1500032L24, transcript variant
FT                   mCT172906"
FT                   /note="gene_id=mCG20389.3 transcript_id=mCT172906.1 created
FT                   on 25-APR-2003"
FT   CDS             join(3395506..3395597,3396405..3396606)
FT                   /codon_start=1
FT                   /gene="1500032L24Rik"
FT                   /locus_tag="mCG_20389"
FT                   /product="RIKEN cDNA 1500032L24, isoform CRA_a"
FT                   /note="gene_id=mCG20389.3 transcript_id=mCT172906.1
FT                   protein_id=mCP95825.1 isoform=CRA_a"
FT                   /protein_id="EDL04508.1"
FT                   /translation="MSGHSSARTSLLCLRNMTFLSQRMTTTTINRAQGAQEKALMMWWH
FT                   AQLPPVGRRVKESPQPHLLMVCDKSPESCALGGSLTAVHRVLEITSKQIRSV"
FT   CDS             join(3395506..3395597,3396405..3396606)
FT                   /codon_start=1
FT                   /gene="1500032L24Rik"
FT                   /locus_tag="mCG_20389"
FT                   /product="RIKEN cDNA 1500032L24, isoform CRA_a"
FT                   /note="gene_id=mCG20389.3 transcript_id=mCT20934.3
FT                   protein_id=mCP13094.3 isoform=CRA_a"
FT                   /protein_id="EDL04509.1"
FT                   /translation="MSGHSSARTSLLCLRNMTFLSQRMTTTTINRAQGAQEKALMMWWH
FT                   AQLPPVGRRVKESPQPHLLMVCDKSPESCALGGSLTAVHRVLEITSKQIRSV"
FT   CDS             join(3395506..3395597,3396405..3396606)
FT                   /codon_start=1
FT                   /gene="1500032L24Rik"
FT                   /locus_tag="mCG_20389"
FT                   /product="RIKEN cDNA 1500032L24, isoform CRA_a"
FT                   /note="gene_id=mCG20389.3 transcript_id=mCT182053.0
FT                   protein_id=mCP104975.0 isoform=CRA_a"
FT                   /protein_id="EDL04510.1"
FT                   /translation="MSGHSSARTSLLCLRNMTFLSQRMTTTTINRAQGAQEKALMMWWH
FT                   AQLPPVGRRVKESPQPHLLMVCDKSPESCALGGSLTAVHRVLEITSKQIRSV"
FT   gene            complement(3397723..3401800)
FT                   /gene="Ndufa6"
FT                   /locus_tag="mCG_20386"
FT                   /note="gene_id=mCG20386.2"
FT   mRNA            complement(join(3397723..3397931,3398539..3398654,
FT                   3401635..3401796))
FT                   /gene="Ndufa6"
FT                   /locus_tag="mCG_20386"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 6 (B14), transcript variant mCT20931"
FT                   /note="gene_id=mCG20386.2 transcript_id=mCT20931.0 created
FT                   on 22-AUG-2002"
FT   mRNA            complement(join(3397732..3397931,3398539..3398654,
FT                   3399887..3399989,3401635..3401800))
FT                   /gene="Ndufa6"
FT                   /locus_tag="mCG_20386"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 6 (B14), transcript variant mCT172409"
FT                   /note="gene_id=mCG20386.2 transcript_id=mCT172409.0 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(3397800..3397931,3398539..3398654,
FT                   3401635..3401782))
FT                   /codon_start=1
FT                   /gene="Ndufa6"
FT                   /locus_tag="mCG_20386"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 6 (B14), isoform CRA_b"
FT                   /note="gene_id=mCG20386.2 transcript_id=mCT20931.0
FT                   protein_id=mCP13093.1 isoform=CRA_b"
FT                   /protein_id="EDL04507.1"
FT                   /translation="MAAAATGLRQAAAAAASTSVKPIFSRDLNEAKRRVRELYRAWYRE
FT                   VPNTVHLMQLDITVKQGRDKVREMFMKNAHVTDPRVVDLLVIKGKMELQETIKVWKQRT
FT                   HVMRFFHETETPRPKDFLSKFYMGHDP"
FT   CDS             complement(join(3397800..3397931,3398539..3398654,
FT                   3399887..3399902))
FT                   /codon_start=1
FT                   /gene="Ndufa6"
FT                   /locus_tag="mCG_20386"
FT                   /product="NADH dehydrogenase (ubiquinone) 1 alpha
FT                   subcomplex, 6 (B14), isoform CRA_a"
FT                   /note="gene_id=mCG20386.2 transcript_id=mCT172409.0
FT                   protein_id=mCP95328.0 isoform=CRA_a"
FT                   /protein_id="EDL04506.1"
FT                   /translation="MASAQVHLMQLDITVKQGRDKVREMFMKNAHVTDPRVVDLLVIKG
FT                   KMELQETIKVWKQRTHVMRFFHETETPRPKDFLSKFYMGHDP"
FT   gene            3408046..3409241
FT                   /pseudo
FT                   /locus_tag="mCG_1027786"
FT                   /note="gene_id=mCG1027786.1"
FT   mRNA            join(3408046..3408136,3408214..3409241)
FT                   /pseudo
FT                   /locus_tag="mCG_1027786"
FT                   /note="gene_id=mCG1027786.1 transcript_id=mCT145490.1
FT                   created on 24-SEP-2002"
FT   assembly_gap    3408141..3408205
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    3410624..3410643
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3413635..3415817
FT                   /estimated_length=2183
FT                   /gap_type="unknown"
FT   gene            complement(3418576..3436445)
FT                   /locus_tag="mCG_20388"
FT                   /note="gene_id=mCG20388.3"
FT   mRNA            complement(join(3418576..3418826,3418923..3419064,
FT                   3419491..3419678,3419886..3420027,3420212..3420388,
FT                   3420774..3420934,3421005..3421157,3421397..3421568,
FT                   3432028..3432272,3436289..>3436385))
FT                   /locus_tag="mCG_20388"
FT                   /product="mCG20388, transcript variant mCT189665"
FT                   /note="gene_id=mCG20388.3 transcript_id=mCT189665.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(3418581..3418826,3418923..3419064,
FT                   3419491..3419678,3419886..3420027,3420212..3420388,
FT                   3420774..3420934,3421005..3421157,3421397..3421568,
FT                   3432028..3432276,3436301..3436445))
FT                   /locus_tag="mCG_20388"
FT                   /product="mCG20388, transcript variant mCT20933"
FT                   /note="gene_id=mCG20388.3 transcript_id=mCT20933.1 created
FT                   on 22-AUG-2002"
FT   CDS             complement(join(3418648..3418826,3418923..3419064,
FT                   3419491..3419678,3419886..3420027,3420212..3420388,
FT                   3420774..3420934,3421005..3421157,3421397..3421568,
FT                   3432028..3432272,3436289..>3436316))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20388"
FT                   /product="mCG20388, isoform CRA_a"
FT                   /note="gene_id=mCG20388.3 transcript_id=mCT189665.0
FT                   protein_id=mCP110666.0 isoform=CRA_a"
FT                   /protein_id="EDL04504.1"
FT                   /translation="VSERTGKGKAGVRIEKCFQRNPKSSRAAMRLPTGAELWPIAIFTV
FT                   IFLILVNLMHWRQRWTAHYPPGPMPWPVLGNLLHMDFQNMPAGFQKLRGRYGDLFSLQL
FT                   ASESVVVLNGLTALREALVKHSEDTADRPPLHFNDLLGFGPRSQGIVLARYGPAWRQQR
FT                   RFSVSTMHHFGLGKKSLEQWVTEEARCLCAAFADHTGHPFSPNTLLDKAVCNVIASLLY
FT                   ACRFEYDDPRFIRLLGLLKETLKEEAGFLPMFLNVFPMLLRIPGLVGKVFPGKRAFVTM
FT                   LDELLAEHKTTWDPTQPPRDLTDAFLAEVEKAKGNPESSFNDENLRTVVGDLFSAGMVT
FT                   TSTTLSWALMLMILHPDVQRRVQQEIDEVIGQVQCPEMADQARMPYTNAVIHEVQRFAD
FT                   ILPLGVPHKTSRDIELQGFLIPKGTTLITNLSSALKDETVWEKPLCFHPEHFLDAQGHF
FT                   VKPEAFMPFSAGRRSCLGEPLARMELFLFFTCLLQRFSISVPDGQPQPSDHGVFRALTT
FT                   PCPYQLCALPR"
FT   CDS             complement(join(3418648..3418826,3418923..3419064,
FT                   3419491..3419678,3419886..3420027,3420212..3420388,
FT                   3420774..3420934,3421005..3421157,3421397..3421568,
FT                   3432028..3432216))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20388"
FT                   /product="mCG20388, isoform CRA_b"
FT                   /note="gene_id=mCG20388.3 transcript_id=mCT20933.1
FT                   protein_id=mCP13095.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9JKY7"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008069"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:1929474"
FT                   /db_xref="UniProtKB/TrEMBL:Q9JKY7"
FT                   /protein_id="EDL04505.1"
FT                   /translation="MRLPTGAELWPIAIFTVIFLILVNLMHWRQRWTAHYPPGPMPWPV
FT                   LGNLLHMDFQNMPAGFQKLRGRYGDLFSLQLASESVVVLNGLTALREALVKHSEDTADR
FT                   PPLHFNDLLGFGPRSQGIVLARYGPAWRQQRRFSVSTMHHFGLGKKSLEQWVTEEARCL
FT                   CAAFADHTGHPFSPNTLLDKAVCNVIASLLYACRFEYDDPRFIRLLGLLKETLKEEAGF
FT                   LPMFLNVFPMLLRIPGLVGKVFPGKRAFVTMLDELLAEHKTTWDPTQPPRDLTDAFLAE
FT                   VEKAKGNPESSFNDENLRTVVGDLFSAGMVTTSTTLSWALMLMILHPDVQRRVQQEIDE
FT                   VIGQVQCPEMADQARMPYTNAVIHEVQRFADILPLGVPHKTSRDIELQGFLIPKGTTLI
FT                   TNLSSALKDETVWEKPLCFHPEHFLDAQGHFVKPEAFMPFSAGRRSCLGEPLARMELFL
FT                   FFTCLLQRFSISVPDGQPQPSDHGVFRALTTPCPYQLCALPR"
FT   assembly_gap    3422289..3422308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3423543..3423562
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3425055..3431198
FT                   /estimated_length=6144
FT                   /gap_type="unknown"
FT   assembly_gap    3436520..3436766
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    3451364..3451729
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    3456096..3456208
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            complement(3459260..3463594)
FT                   /locus_tag="mCG_133073"
FT                   /note="gene_id=mCG133073.1"
FT   mRNA            complement(join(3459260..3459508,3460131..3460318,
FT                   3460515..3460656,3460840..3461016,3461647..3461807,
FT                   3461898..3462050,3462319..3462490,3463346..3463594))
FT                   /locus_tag="mCG_133073"
FT                   /product="mCG133073, transcript variant mCT172402"
FT                   /note="gene_id=mCG133073.1 transcript_id=mCT172402.0
FT                   created on 22-AUG-2002"
FT   mRNA            complement(join(3459278..3459508,3459609..3459750,
FT                   3460131..3460318,3460515..3460656,3460840..3461016,
FT                   3461647..3461807,3461898..3462050,3462319..3462490,
FT                   3463346..3463594))
FT                   /locus_tag="mCG_133073"
FT                   /product="mCG133073, transcript variant mCT134437"
FT                   /note="gene_id=mCG133073.1 transcript_id=mCT134437.1
FT                   created on 22-AUG-2002"
FT   CDS             complement(join(3459318..3459508,3459609..3459750,
FT                   3460131..3460318,3460515..3460656,3460840..3461016,
FT                   3461647..3461807,3461898..3462050,3462319..3462490,
FT                   3463346..3463534))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133073"
FT                   /product="mCG133073, isoform CRA_b"
FT                   /note="gene_id=mCG133073.1 transcript_id=mCT134437.1
FT                   protein_id=mCP83050.0 isoform=CRA_b"
FT                   /protein_id="EDL04503.1"
FT                   /translation="MELLTGAGLWSVAIFTVIFILLVDLMHRHQRWTSRYPPGPVPWPV
FT                   LGNLLQVDLDNMPYSLYKLQNRYGDVFSLQMGWKPMVVINGLKAMKEVLLTCGEDTADR
FT                   PQVPIFEYLGVKPGSQGVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEARHL
FT                   CDAFTAQAGQPINPNTMLNNAVCNVIASLIFARRFEYEDPYLIRMQKVLEDSLTEISGL
FT                   IPEVLNMFPILLRIPGLPGKVFQGQKSLLAIVENLLTENRNTWDPDQPPRNLTDAFLAE
FT                   IEKVKGNAESSFNDENLRMVVLDLFTAGMVTTSTTLSWALLLMILHPDVQRRVQQEIDA
FT                   VIGQVRHPEMADQARMPYTNAVIHEVQRFGDIAPLNLPRITSRDIEVQDFLIPKGSILI
FT                   PNMSSVLKDETVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSAGRRSCLGEPLARMELFL
FT                   FFTCLLQHFSFSVPNGQPRPRNLGVFPFPVAPYPYQLCAVMREQGH"
FT   CDS             complement(join(3459338..3459508,3460131..3460318,
FT                   3460515..3460656,3460840..3461016,3461647..3461807,
FT                   3461898..3462050,3462319..3462490,3463346..3463534))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133073"
FT                   /product="mCG133073, isoform CRA_a"
FT                   /note="gene_id=mCG133073.1 transcript_id=mCT172402.0
FT                   protein_id=mCP95321.0 isoform=CRA_a"
FT                   /protein_id="EDL04502.1"
FT                   /translation="MELLTGAGLWSVAIFTVIFILLVDLMHRHQRWTSRYPPGPVPWPV
FT                   LGNLLQVDLDNMPYSLYKLQNRYGDVFSLQMGWKPMVVINGLKAMKEVLLTCGEDTADR
FT                   PQVPIFEYLGVKPGSQGVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEARHL
FT                   CDAFTAQAGQPINPNTMLNNAVCNVIASLIFARRFEYEDPYLIRMQKVLEDSLTEISGL
FT                   IPEVLNMFPILLRIPGLPGKVFQGQKSLLAIVENLLTENRNTWDPDQPPRNLTDAFLAE
FT                   IEKVKGNAESSFNDENLRMVVLDLFTAGMVTTSTTLSWALLLMILHPDVQRRVQQEIDA
FT                   VIGQVRHPEMADQARMPYTNAVIHEVQRFGDIAPLNLPRITSRDIEVQDFLIPKAADHA
FT                   WVSPWPAWSSSSSSRASCSTLASQCPMDSPGLETLVSFLFRLPPTPTSSVL"
FT   assembly_gap    3465013..3466849
FT                   /estimated_length=1837
FT                   /gap_type="unknown"
FT   assembly_gap    3468243..3468262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3477085..3477330
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   gene            complement(3477979..3480009)
FT                   /pseudo
FT                   /locus_tag="mCG_1027624"
FT                   /note="gene_id=mCG1027624.0"
FT   mRNA            complement(join(3477979..3478235,3478422..3478563,
FT                   3478701..3478877,3479828..3479871,3479921..3480009))
FT                   /pseudo
FT                   /locus_tag="mCG_1027624"
FT                   /note="gene_id=mCG1027624.0 transcript_id=mCT145328.0
FT                   created on 24-SEP-2002"
FT   gene            3490086..3493168
FT                   /pseudo
FT                   /locus_tag="mCG_133088"
FT                   /note="gene_id=mCG133088.1"
FT   mRNA            join(3490086..3490204,3492582..3492757,3493086..3493168)
FT                   /pseudo
FT                   /locus_tag="mCG_133088"
FT                   /note="gene_id=mCG133088.1 transcript_id=mCT134452.1
FT                   created on 06-SEP-2002"
FT   gene            3508954..3513381
FT                   /locus_tag="mCG_8136"
FT                   /note="gene_id=mCG8136.1"
FT   mRNA            join(3508954..3509194,3510152..3510323,3510592..3510744,
FT                   3510835..3510995,3511628..3511804,3511988..3512129,
FT                   3512326..3512513,3512888..3513029,3513130..3513381)
FT                   /locus_tag="mCG_8136"
FT                   /product="mCG8136, transcript variant mCT7730"
FT                   /note="gene_id=mCG8136.1 transcript_id=mCT7730.1 created on
FT                   22-AUG-2002"
FT   mRNA            join(<3508962..3509194,3510152..3510323,3510592..3510744,
FT                   3510835..3510995,3511628..3511804,3512326..3512513,
FT                   3512888..3513029,3513130..3513381)
FT                   /locus_tag="mCG_8136"
FT                   /product="mCG8136, transcript variant mCT189724"
FT                   /note="gene_id=mCG8136.1 transcript_id=mCT189724.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3508964..3509194,3510152..3510323,3510592..3510744,
FT                   3510835..3510995,3511628..3511804,3512326..3512358)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8136"
FT                   /product="mCG8136, isoform CRA_a"
FT                   /note="gene_id=mCG8136.1 transcript_id=mCT189724.0
FT                   protein_id=mCP110729.0 isoform=CRA_a"
FT                   /protein_id="EDL04500.1"
FT                   /translation="VHWSLGSLGSSGAAMELLTGTDLWPVAIFTVIFILLVDLTHQRQR
FT                   WTSRYPPGPVPWPVLGNLLQVDLGNMPYSLYKLQNRYGDVFSLQMAWKPMVVINGLKAM
FT                   KEMLLTCGEDTADRPPVPIFEYLGVKPGSQGVVLAPYGPEWREQRRFSVSTLRNFGLGK
FT                   KSLEDWVTKEANHLCDAFTAQAGQPINPNPMLNKSTCNVIASLIFARRFEYEDPFLIRM
FT                   LKVLEQSLTEVSGLIPEVLNAFPILLRIPRLADKALQGQKSFIAILDNLLTENRTTWDP
FT                   VQAPRNLTDAFLAEIEKAESNKKSMRS"
FT   CDS             join(3509006..3509194,3510152..3510323,3510592..3510744,
FT                   3510835..3510995,3511628..3511804,3511988..3512129,
FT                   3512326..3512513,3512888..3513029,3513130..3513320)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8136"
FT                   /product="mCG8136, isoform CRA_b"
FT                   /note="gene_id=mCG8136.1 transcript_id=mCT7730.1
FT                   protein_id=mCP21581.2 isoform=CRA_b"
FT                   /db_xref="GOA:P11714"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008069"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:88606"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11714"
FT                   /protein_id="EDL04501.1"
FT                   /translation="MELLTGTDLWPVAIFTVIFILLVDLTHQRQRWTSRYPPGPVPWPV
FT                   LGNLLQVDLGNMPYSLYKLQNRYGDVFSLQMAWKPMVVINGLKAMKEMLLTCGEDTADR
FT                   PPVPIFEYLGVKPGSQGVVLAPYGPEWREQRRFSVSTLRNFGLGKKSLEDWVTKEANHL
FT                   CDAFTAQAGQPINPNPMLNKSTCNVIASLIFARRFEYEDPFLIRMLKVLEQSLTEVSGL
FT                   IPEVLNAFPILLRIPRLADKALQGQKSFIAILDNLLTENRTTWDPVQAPRNLTDAFLAE
FT                   IEKAKGNPESSFNDENLLMVVRDLFGAGMLTTSTTLSWALMLMILHPDVQRRVQQEIDE
FT                   VIGQVRHPEMADQAHMPYTNAVIHEVQRFGDIVPVNLPRITSHDIEVQDFLIPKGTILL
FT                   PNMSSMLKDESVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSAGRRSCLGEALARMELFL
FT                   FFTCLLQRFSFSVPDGQPQPSNSGVYGILVAPSPYQLCAVVRDQGH"
FT   gene            3519182..3521649
FT                   /pseudo
FT                   /locus_tag="mCG_48601"
FT                   /note="gene_id=mCG48601.1"
FT   mRNA            join(3519182..3519308,3519949..3520115,3520326..3520475,
FT                   3520712..3520846,3521241..3521382,3521483..3521649)
FT                   /pseudo
FT                   /locus_tag="mCG_48601"
FT                   /note="gene_id=mCG48601.1 transcript_id=mCT48784.1 created
FT                   on 24-SEP-2002"
FT   assembly_gap    3566694..3567326
FT                   /estimated_length=633
FT                   /gap_type="unknown"
FT   assembly_gap    3568226..3571128
FT                   /estimated_length=2903
FT                   /gap_type="unknown"
FT   gene            3572725..3575253
FT                   /pseudo
FT                   /locus_tag="mCG_133086"
FT                   /note="gene_id=mCG133086.0"
FT   mRNA            join(3572725..3572783,3572883..3573876,3574067..3575253)
FT                   /pseudo
FT                   /locus_tag="mCG_133086"
FT                   /note="gene_id=mCG133086.0 transcript_id=mCT134450.1
FT                   created on 05-SEP-2002"
FT   assembly_gap    3573895..3574057
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    3575254..3575726
FT                   /estimated_length=473
FT                   /gap_type="unknown"
FT   assembly_gap    3584810..3584975
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   gene            3594660..3595057
FT                   /pseudo
FT                   /locus_tag="mCG_1027783"
FT                   /note="gene_id=mCG1027783.1"
FT   mRNA            3594660..3595057
FT                   /pseudo
FT                   /locus_tag="mCG_1027783"
FT                   /note="gene_id=mCG1027783.1 transcript_id=mCT145487.1
FT                   created on 24-SEP-2002"
FT   assembly_gap    3607847..3607866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3609453..3609589
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            3611434..3615772
FT                   /locus_tag="mCG_10954"
FT                   /note="gene_id=mCG10954.2"
FT   mRNA            join(3611434..3611695,3612561..3612732,3613004..3613156,
FT                   3613236..3613396,3614018..3614194,3614378..3614519,
FT                   3614712..3614899,3615281..3615422,3615523..3615772)
FT                   /locus_tag="mCG_10954"
FT                   /product="mCG10954, transcript variant mCT11024"
FT                   /note="gene_id=mCG10954.2 transcript_id=mCT11024.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(3611507..3611695,3612561..3612732,3613004..3613156,
FT                   3613236..3613396,3614018..3614194,3614378..3614519,
FT                   3614712..3614899,3615281..3615422,3615523..3615713)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10954"
FT                   /product="mCG10954, isoform CRA_a"
FT                   /note="gene_id=mCG10954.2 transcript_id=mCT11024.2
FT                   protein_id=mCP12241.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BVD2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008069"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:88604"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BVD2"
FT                   /protein_id="EDL04498.1"
FT                   /translation="MELLTGTDLWSVAIFTVIFILLVDLMHRRQSWTSCYPPGPVPWPV
FT                   LGNLLQVDLNNMPYSLYKLQNRYGDVFSLQMAWKPMVVINRMKAMKEVLLTCGEDTADR
FT                   PPVPIFEHLGFKPRSQGMIFAPYGPEWREQRRFSLSSLRNFGLGRKSLEEWVIKEAGHL
FT                   CDAFTTQAGQYINPNTMLKKATCNVIASLIFARRFEYEDPYLIRMLKVLEDSLTELSGL
FT                   IPEVINTFPILLHIPRLADKFLQSQKSFIAIVDNLLTENRTTWDPAQSPRNLTDAFLAE
FT                   IEKAKGNPESSFNDENLRMVVIDLFTAGILTTSTTLSWALLLMILHPDVQRRVQQEIDE
FT                   VIGQVRHPEMADQAHMPYTNAVIHEVQRFGDIVPLHLPRITSRDIEVQDFLIPKGTILL
FT                   PNMSSVHMDDTVWEKPLRFHPEHFLDAQGHFVKHEAFITFSAGRRSCLGEPLARMELFL
FT                   FFTCLLQRFSFSVPDGQPQPSDHRVFSIMVAPSPYQLCAVIREQGH"
FT   mRNA            join(<3611556..3611695,3612590..3612732,3613004..3613156,
FT                   3613236..3613396,3614018..3614899,3615281..3615422,
FT                   3615523..3615771)
FT                   /locus_tag="mCG_10954"
FT                   /product="mCG10954, transcript variant mCT189693"
FT                   /note="gene_id=mCG10954.2 transcript_id=mCT189693.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<3611670..3611695,3612590..3612732,3613004..3613156,
FT                   3613236..3613396,3614018..3614224)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10954"
FT                   /product="mCG10954, isoform CRA_b"
FT                   /note="gene_id=mCG10954.2 transcript_id=mCT189693.0
FT                   protein_id=mCP110682.0 isoform=CRA_b"
FT                   /protein_id="EDL04499.1"
FT                   /translation="IICHTACTSLQMAWKPMVVINRMKAMKEVLLTCGEDTADRPPVPI
FT                   FEHLGFKPRSQGMIFAPYGPEWREQRRFSLSSLRNFGLGRKSLEEWVIKEAGHLCDAFT
FT                   TQAGQYINPNTMLKKATCNVIASLIFARRFEYEDPYLIRMLKVLEDSLTELSGLIPEVI
FT                   NTFPILLHIPRLADKFLQSQKSFIAIVDNLLTENRTTWDPAQSPRNLTDAFLAEIEKAI
FT                   GSSKTFS"
FT   gene            3618556..3621865
FT                   /pseudo
FT                   /locus_tag="mCG_141059"
FT                   /note="gene_id=mCG141059.0"
FT   mRNA            join(3618556..3618711,3619354..3619529,3619664..3619882,
FT                   3620079..3620200,3621461..3621596,3621696..3621865)
FT                   /pseudo
FT                   /locus_tag="mCG_141059"
FT                   /note="gene_id=mCG141059.0 transcript_id=mCT172882.0
FT                   created on 05-SEP-2002"
FT   gene            complement(3665348..3669341)
FT                   /pseudo
FT                   /locus_tag="mCG_10956"
FT                   /note="gene_id=mCG10956.1"
FT   mRNA            complement(join(3665348..3665463,3665564..3665705,
FT                   3666186..3666378,3666782..3666987,3667621..3667767,
FT                   3667857..3668025,3668225..3668452,3669101..3669341))
FT                   /pseudo
FT                   /locus_tag="mCG_10956"
FT                   /note="gene_id=mCG10956.1 transcript_id=mCT11026.1 created
FT                   on 05-SEP-2002"
FT   gene            complement(3672332..>3677301)
FT                   /locus_tag="mCG_142682"
FT                   /note="gene_id=mCG142682.0"
FT   mRNA            complement(join(3672332..3672579,3672680..3672821,
FT                   3673115..3673302,3673499..3673640,3673823..3673999,
FT                   3674626..3674786,3674877..3675029,3675298..3675469,
FT                   3677036..>3677301))
FT                   /locus_tag="mCG_142682"
FT                   /product="mCG142682"
FT                   /note="gene_id=mCG142682.0 transcript_id=mCT181608.0
FT                   created on 26-MAR-2003"
FT   CDS             complement(join(3672389..3672579,3672680..3672821,
FT                   3673115..3673302,3673499..3673640,3673823..3673999,
FT                   3674626..3674786,3674877..3675029,3675298..3675469,
FT                   3677036..>3677299))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142682"
FT                   /product="mCG142682"
FT                   /note="gene_id=mCG142682.0 transcript_id=mCT181608.0
FT                   protein_id=mCP104529.0"
FT                   /protein_id="EDL04497.1"
FT                   /translation="CFLILGVVLSVGHWPLGSLGSSGATMELLTGTGLWSVAIFTVIFL
FT                   ILVDLMHRRQHWTSRYPPGPVPWPVLGNLLQVDLDNIPYSLYKLQNRYGDVFSLQMAWK
FT                   PVVVINGLKAMQEVLLTCGKDTADHPPVPIFEYLGFKSKSQGVVLASYGPEWREQRQFS
FT                   VSTLRNFGLGKKSLEEWVTKEAKHLCDAFTARAGQSINPNTMLNNAVCNVIASLIFARR
FT                   FEYEDPFLIRMLKMREESLKEVTGFIPGVLNTFPILLRIPGLADMVFQSQKTFMAILDN
FT                   LVTENRTTWDPDQPPRNLADAFLAEIQKAKGNPESSFNDENLCMVVSDLFTAGMVTTST
FT                   TLSCALLLMILHPDVQRRVQQEIDAVIGQVRCPEMADQARMPYTNAVIHEVQRFGDIIP
FT                   LNIPRITSRDIEVQDFLIPKGTILIPNMSSMLKDETVWEKPLRFYPEHFLDAQGHFVKP
FT                   EAFMPFSAGRRSCLGEPLARMELFLFFTCLLQRFSFSVPAGQPQPSDHRIFAIPVAPYP
FT                   YQVCAIMREQGH"
FT   gene            complement(3692554..>3698523)
FT                   /locus_tag="mCG_142681"
FT                   /note="gene_id=mCG142681.1"
FT   mRNA            complement(join(3692554..3694547,3694942..3695130,
FT                   3695351..3695492,3695632..3695808,3696473..3696633,
FT                   3696715..3696867,3698260..>3698523))
FT                   /locus_tag="mCG_142681"
FT                   /product="mCG142681, transcript variant mCT189683"
FT                   /note="gene_id=mCG142681.1 transcript_id=mCT189683.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(3693118..3693365,3694406..3694547,
FT                   3694942..3695130,3695351..3695492,3695632..3695808,
FT                   3696473..3696633,3696715..3696867,3697152..3697323,
FT                   3698260..3698500))
FT                   /locus_tag="mCG_142681"
FT                   /product="mCG142681, transcript variant mCT181609"
FT                   /note="gene_id=mCG142681.1 transcript_id=mCT181609.0
FT                   created on 26-MAR-2003"
FT   CDS             complement(join(3694943..3695130,3695351..3695492,
FT                   3695632..3695808,3696473..3696633,3696715..3696867,
FT                   3697152..3697323,3698260..3698448))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142681"
FT                   /product="mCG142681, isoform CRA_a"
FT                   /note="gene_id=mCG142681.1 transcript_id=mCT181609.0
FT                   protein_id=mCP104530.0 isoform=CRA_a"
FT                   /protein_id="EDL04495.1"
FT                   /translation="MELLTGTGLWPVAIFTVIFILLVDLMHRRQRWTSRYPPGPVPWPV
FT                   LGNLLQVDLDNMPYSLYKLQNRYGDVFSLQMAWKPVVVISGLKAVREVLVTCGEDTADR
FT                   PEMPIFQHLGYGEKAKGVVFAPYGPEWRELRRFSVSTLRNLGLGKKSLEQWVTEEAGHL
FT                   CDAFTAQAGSPLDPYTLLNKAVCNVIASLIYARRFEYGDPDFIKMLKILKENMGENTGL
FT                   FPEVLNTFPILLHIPGLADKVFPGQKTFLTLVNKLVTEHKRTWDPDQPPRDLTDAFLAE
FT                   MEKAKGNPKSSFNEANLRLVVFDLFGAGIVTSSITLTWALLLMILHPDVQRRVQEEIDE
FT                   VIGQVRCPEMADQAHMPYTNAVIHEVQRFADIVPMNLPHKTSHDIGSTGLPYP"
FT   CDS             complement(join(3694943..3695130,3695351..3695492,
FT                   3695632..3695808,3696473..3696633,3696715..3696867,
FT                   3698260..>3698281))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142681"
FT                   /product="mCG142681, isoform CRA_b"
FT                   /note="gene_id=mCG142681.1 transcript_id=mCT189683.0
FT                   protein_id=mCP110651.0 isoform=CRA_b"
FT                   /protein_id="EDL04496.1"
FT                   /translation="HAIQLVQGVVFAPYGPEWRELRRFSVSTLRNLGLGKKSLEQWVTE
FT                   EAGHLCDAFTAQAGSPLDPYTLLNKAVCNVIASLIYARRFEYGDPDFIKMLKILKENMG
FT                   ENTGLFPEVLNTFPILLHIPGLADKVFPGQKTFLTLVNKLVTEHKRTWDPDQPPRDLTD
FT                   AFLAEMEKAKGNPKSSFNEANLRLVVFDLFGAGIVTSSITLTWALLLMILHPDVQRRVQ
FT                   EEIDEVIGQVRCPEMADQAHMPYTNAVIHEVQRFADIVPMNLPHKTSHDIGSTGLPYP"
FT   assembly_gap    3697773..3697792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3706407..3711193)
FT                   /pseudo
FT                   /locus_tag="mCG_133091"
FT                   /note="gene_id=mCG133091.1"
FT   mRNA            complement(join(3706407..3706573,3706674..3706793,
FT                   3707398..3707425,3707842..3707982,3708243..3708384,
FT                   3708504..3708698,3709342..3709498,3709580..3709695,
FT                   3709941..3710138,3711033..3711193))
FT                   /pseudo
FT                   /locus_tag="mCG_133091"
FT                   /note="gene_id=mCG133091.1 transcript_id=mCT134455.1
FT                   created on 05-SEP-2002"
FT   gene            complement(3727775..3739753)
FT                   /pseudo
FT                   /locus_tag="mCG_10955"
FT                   /note="gene_id=mCG10955.2"
FT   mRNA            complement(join(3727775..3727950,3728051..3728192,
FT                   3735762..3735898,3737054..3737196,3738654..3738717,
FT                   3739565..3739753))
FT                   /pseudo
FT                   /locus_tag="mCG_10955"
FT                   /note="gene_id=mCG10955.2 transcript_id=mCT11025.1 created
FT                   on 05-SEP-2002"
FT   gene            complement(3745246..3749644)
FT                   /locus_tag="mCG_142680"
FT                   /note="gene_id=mCG142680.0"
FT   mRNA            complement(join(3745246..3745731,3746258..3746358,
FT                   3746578..3746719,3746858..3747034,3747696..3747856,
FT                   3747938..3748090,3749309..3749644))
FT                   /locus_tag="mCG_142680"
FT                   /product="mCG142680"
FT                   /note="gene_id=mCG142680.0 transcript_id=mCT181607.0
FT                   created on 26-MAR-2003"
FT   CDS             complement(join(3745690..3745731,3746258..3746358,
FT                   3746578..3746719,3746858..3747034,3747696..3747856,
FT                   3747938..3747983))
FT                   /codon_start=1
FT                   /locus_tag="mCG_142680"
FT                   /product="mCG142680"
FT                   /note="gene_id=mCG142680.0 transcript_id=mCT181607.0
FT                   protein_id=mCP104531.0"
FT                   /protein_id="EDL04494.1"
FT                   /translation="MEEVGHLFDVFTAHAGSPLNPYPLLDKAVCNVIVSLIYAHRFEYG
FT                   DPDFIKMLKVLKENMGENIGLFSEVLNTFPILLRIPGLADKVFPGQKTFLIMVDKLVTE
FT                   HKRTWNSDQPPRDLTDAFMAEMEKAKGNPESSFNDANLCLVVLDLLGAATVTTSTTLSW
FT                   ALLLMILHPDVQCQVQQEIDEVIWYVWLPEMADQVCMPFTNAVIHEGMTLISNLFRAEG
FT                   "
FT   gene            complement(3772489..3775110)
FT                   /pseudo
FT                   /locus_tag="mCG_1027620"
FT                   /note="gene_id=mCG1027620.1"
FT   mRNA            complement(join(3772489..3772664,3774230..3774506,
FT                   3774728..3774873,3775013..3775110))
FT                   /pseudo
FT                   /locus_tag="mCG_1027620"
FT                   /note="gene_id=mCG1027620.1 transcript_id=mCT145324.1
FT                   created on 24-SEP-2002"
FT   assembly_gap    3786201..3786526
FT                   /estimated_length=326
FT                   /gap_type="unknown"
FT   gene            complement(3816188..3820540)
FT                   /locus_tag="mCG_4193"
FT                   /note="gene_id=mCG4193.2"
FT   mRNA            complement(join(3816188..3816437,3816538..3817651,
FT                   3817790..3817966,3820275..3820536))
FT                   /locus_tag="mCG_4193"
FT                   /product="mCG4193, transcript variant mCT172922"
FT                   /note="gene_id=mCG4193.2 transcript_id=mCT172922.0 created
FT                   on 28-AUG-2002"
FT   mRNA            complement(join(3816189..3816437,3816538..3816679,
FT                   3817105..3817292,3817510..3817651,3817790..3817966,
FT                   3818632..3818792,3818874..3819026,3819305..3819440,
FT                   3820275..3820540))
FT                   /locus_tag="mCG_4193"
FT                   /product="mCG4193, transcript variant mCT3044"
FT                   /note="gene_id=mCG4193.2 transcript_id=mCT3044.1 created on
FT                   28-AUG-2002"
FT   mRNA            complement(join(3816208..3816437,3816538..3816679,
FT                   3817105..3817292,3817510..3817651,3817790..3817966,
FT                   3820275..3820531))
FT                   /locus_tag="mCG_4193"
FT                   /product="mCG4193, transcript variant mCT172923"
FT                   /note="gene_id=mCG4193.2 transcript_id=mCT172923.0 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(3816259..3816437,3816538..3816679,
FT                   3817105..3817292,3817510..3817651,3817790..3817966,
FT                   3820275..3820463))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4193"
FT                   /product="mCG4193, isoform CRA_c"
FT                   /note="gene_id=mCG4193.2 transcript_id=mCT172923.0
FT                   protein_id=mCP95841.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q6P8N9"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:1919004"
FT                   /db_xref="UniProtKB/TrEMBL:Q6P8N9"
FT                   /protein_id="EDL04493.1"
FT                   /translation="MELLTGTDLWPVAIFTVIFILLVDLLHRRQRWTSRYPPGPVPWPV
FT                   LGNLLQVDLDNMPYSFYKVVKMFPIVLRIPGLADKIFPGQKTFLTMVDKLVTEHKRTWD
FT                   PDQPPRDLTDAFMAEMETAKGNPESSFNEANLRLVVLDLFGGGIVTTSATLTWALLLMI
FT                   LHPDVQRRVQEEIDEVIGQARRPEMADQARMPYTNAVIHEVQRFADIAPMTLPHRTSCD
FT                   IEVQGFLIPKGTTLICNLSSVLKDETVWEKPLRFYPEHFLDAQGHFVKPEAFMPFSAGR
FT                   RACLGEPLVRMELFLFFTCLLQRFSFSVPDGQPLPSDYGIYSMVVSPAPYQLCAVVR"
FT   CDS             complement(join(3816259..3816437,3816538..3816679,
FT                   3817105..3817292,3817510..3817651,3817790..3817966,
FT                   3818632..3818792,3818874..3819026,3819305..3819440,
FT                   3820275..3820463))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4193"
FT                   /product="mCG4193, isoform CRA_b"
FT                   /note="gene_id=mCG4193.2 transcript_id=mCT3044.1
FT                   protein_id=mCP12238.2 isoform=CRA_b"
FT                   /protein_id="EDL04492.1"
FT                   /translation="MELLTGTDLWPVAIFTVIFILLVDLLHRRQRWTSRYPPGPVPWPV
FT                   LGNLLQVDLDNMPYSFYKMGWNAMVIVNGLKAVQEALVTCGEYTADRPEMPIFPHLGYG
FT                   QKDKGLVLAPYGPEWQEQRRFSMSTMRNFGLGKKSLEQWVTEEAGHLCDAFTDQAGSPL
FT                   NPYTLLNKAVCNVIASLIYAHRFKYKDPDFIKMLKVLKENTREKIGLIPEVVKMFPIVL
FT                   RIPGLADKIFPGQKTFLTMVDKLVTEHKRTWDPDQPPRDLTDAFMAEMETAKGNPESSF
FT                   NEANLRLVVLDLFGGGIVTTSATLTWALLLMILHPDVQRRVQEEIDEVIGQARRPEMAD
FT                   QARMPYTNAVIHEVQRFADIAPMTLPHRTSCDIEVQGFLIPKGTTLICNLSSVLKDETV
FT                   WEKPLRFYPEHFLDAQGHFVKPEAFMPFSAGRRACLGEPLVRMELFLFFTCLLQRFSFS
FT                   VPDGQPLPSDYGIYSMVVSPAPYQLCAVVR"
FT   CDS             complement(join(3817454..3817651,3817790..3817966,
FT                   3820275..3820463))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4193"
FT                   /product="mCG4193, isoform CRA_a"
FT                   /note="gene_id=mCG4193.2 transcript_id=mCT172922.0
FT                   protein_id=mCP95842.0 isoform=CRA_a"
FT                   /protein_id="EDL04491.1"
FT                   /translation="MELLTGTDLWPVAIFTVIFILLVDLLHRRQRWTSRYPPGPVPWPV
FT                   LGNLLQVDLDNMPYSFYKVVKMFPIVLRIPGLADKIFPGQKTFLTMVDKLVTEHKRTWD
FT                   PDQPPRDLTDAFMAEMETAKGNPESSFNEANLRLVVLDLFGGGIVTTSATLTWALLLMI
FT                   LHPDVQRETDGAGKKGGVGYRHSS"
FT   assembly_gap    3827693..3827733
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   gene            complement(3834318..3838573)
FT                   /locus_tag="mCG_4191"
FT                   /note="gene_id=mCG4191.1"
FT   mRNA            complement(join(3834318..3834563,3834601..3834742,
FT                   3835173..3835360,3835569..3835719,3835847..3836023,
FT                   3836684..3836844,3837194..3837539,3838313..3838573))
FT                   /locus_tag="mCG_4191"
FT                   /product="mCG4191"
FT                   /note="gene_id=mCG4191.1 transcript_id=mCT3042.1 created on
FT                   05-SEP-2002"
FT   CDS             complement(join(3834322..3834563,3834601..3834742,
FT                   3835173..3835360,3835569..3835719,3835847..3836023,
FT                   3836684..3836844,3837194..3837539,3838313..3838501))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4191"
FT                   /product="mCG4191"
FT                   /note="gene_id=mCG4191.1 transcript_id=mCT3042.1
FT                   protein_id=mCP12232.2"
FT                   /protein_id="EDL04490.1"
FT                   /translation="MELLTGTDLWPVAIFTVIFILLVDLMHRHQRWTSRYPPGPVLWPV
FT                   LGNLLQVDLDNMPYSLYKLQNRYGDVFSLKLGRNPMVIVNRLMAVQEVLVTCGENTADR
FT                   PEMPIFLPPSNGQKAKGTNQCGRQRWHQSHTRGTVSNGRSGLNAGVNGFKTSNKKSLKS
FT                   IVEPFSILEGGRDILGSPLNPYTLLEKAMCNVIASLVYAHCFEYEDPDCIKMLRALKEY
FT                   MIEKIGLIPEVVKMFPIVLRIPGLADKIFPGQTTFLTMVDKLLTEHKRTWDPDQPPRDL
FT                   IDAFLAEMEKAKGNPESSFNEANLRQIVLDLFGAGTAPTSTTLSWALLLMILHPDVQSE
FT                   NGLVQEEIDEVIGQARRPEMADQARMPYTNAVIHEVQRFADIAPMTLQHRTSCDIEVQG
FT                   FLIPKGTTLIPNLSSVLKDETVWEKPLRFHPEHFLDAQGHFVKPEAFMPFSAEIFGGWS
FT                   TNQFPVRLSPIPPTGRRSCLGESLARMELFLFFTCLLQRFSFSVPDGQPQPSDYGIYSI
FT                   LVSPAPYQLCAVVR"
FT   gene            complement(3846498..3850625)
FT                   /locus_tag="mCG_4201"
FT                   /note="gene_id=mCG4201.0"
FT   mRNA            complement(join(3846498..3846746,3846847..3846988,
FT                   3847361..3847548,3847724..3847865,3848049..3848225,
FT                   3848860..3849020,3849099..3849251,3849517..3849688,
FT                   3850364..3850625))
FT                   /locus_tag="mCG_4201"
FT                   /product="mCG4201"
FT                   /note="gene_id=mCG4201.0 transcript_id=mCT3023.0 created on
FT                   22-AUG-2002"
FT   CDS             complement(join(3846568..3846746,3846847..3846988,
FT                   3847361..3847548,3847724..3847865,3848049..3848225,
FT                   3848860..3849020,3849099..3849251,3849517..3849688,
FT                   3850364..3850552))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4201"
FT                   /product="mCG4201"
FT                   /note="gene_id=mCG4201.0 transcript_id=mCT3023.0
FT                   protein_id=mCP12242.1"
FT                   /db_xref="GOA:A0A0R4IZY2"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR008069"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="MGI:MGI:1923529"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4IZY2"
FT                   /protein_id="EDL04489.1"
FT                   /translation="MGLLVGDDLWAVVIFTAIFLLLVDLVHRRQRWTACYPPGPVPFPG
FT                   LGNLLQVDFENIPYSFYKLQNRYGNVFSLQMAWKPVVVVNGLKAVRELLVTYGEDTSDR
FT                   PLMPIYNHIGYGHKSKGVILAPYGPEWREQRRFSVSTLRDFGLGKKSLEQWVTEEAGHL
FT                   CDAFTKEAEHPFNPSPLLSKAVSNVIASLIYARRFEYEDPFFNRMLKTLKESLGEDTGF
FT                   VGEVLNAIPMLLHIPGLPDKAFPKLNSFIALVNKMLIEHDSTWDPAQPPRDLTDAFLAE
FT                   VEKAKGNPESSFNDKNLRIVVIDLFMAGMVTTSTTLSWALLLMILHPDVQRRVHQEIDE
FT                   VIGHVRHPEMADQARMPYTNAVIHEVQRFADIVPTNLPHMTSRDIKFQDFFIPKGTTLI
FT                   PNLSSVLKDETVWEKPLRFYPEHFLDAQGHFVKHEAFMPFSAGRRSCLGEPLARMELFL
FT                   FFTCLLQRFSFSVPDGQPRPSDYGIYTMPVTPEPYQLCAVAR"
FT   gene            complement(3865731..3968590)
FT                   /gene="Tcf20"
FT                   /locus_tag="mCG_4199"
FT                   /note="gene_id=mCG4199.2"
FT   mRNA            complement(join(3865731..3866166,3871996..3872045,
FT                   3881518..3881611,3907852..3913624,3968442..3968590))
FT                   /gene="Tcf20"
FT                   /locus_tag="mCG_4199"
FT                   /product="transcription factor 20"
FT                   /note="gene_id=mCG4199.2 transcript_id=mCT3034.2 created on
FT                   22-AUG-2002"
FT   assembly_gap    3872776..3872816
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    3902440..3903197
FT                   /estimated_length=758
FT                   /gap_type="unknown"
FT   CDS             complement(3908357..3913588)
FT                   /codon_start=1
FT                   /gene="Tcf20"
FT                   /locus_tag="mCG_4199"
FT                   /product="transcription factor 20"
FT                   /note="gene_id=mCG4199.2 transcript_id=mCT3034.2
FT                   protein_id=mCP12239.1"
FT                   /protein_id="EDL04486.1"
FT                   /translation="MQSFREQSSYHGNQQSYPQEVHSSSRIEEFSPRQAQMFQNFGGAG
FT                   GGSSGTGSSSSGRRGTAAAAAAMASETSGHQGYQGFRKEAGDFYYMAGNKDTVAAGTPQ
FT                   PPQRRPSGPVQSYGPPQGSSFGNQYASEGHVSQFQAQHSALGGVSHYQQDYTGPFSPGS
FT                   AQYQQQASSQQQQQQQQQQQQQQQQQQQQVQQLRQQLYQSHQPLPQTTGQPASGSSHLQ
FT                   PMQRPSTLPSSAGYQLRVGQFGQHYQSSASSSSSSSFPSPQRFSQSGQSYDGSYSVNAG
FT                   SQYEGHNVGSNAQAYGTQSNYSYQPQSMKNFEQAKIPPGNQQGQQQQQQQPQPQQQQPQ
FT                   QQQQQQQQQQHPPQHVMQYTNAATKMPLQSQVGQYNQPEVPVRSPMQFHQNFSPISNPS
FT                   PAASVVQSPSCSSTPSPLMQSGENLQCGQGNVPMSSRNRILQLMPQLSPTPSMMPSPNS
FT                   HAAGFKGFGLEGVPEKRLTDPGLSSLSALSSQVANLPNTVQHMLLSDALTPQKKTSKRP
FT                   SSSSKKADSCTNSEGSSQPEEQLKSPMAESLDGGCSSSSEDQGERVRQLSGQSTSSDTT
FT                   YKCGASEKAGSSPTQGAQNEAPRLSTSPATRDEAASPGAKDTSLSSEGNTKVNEKTVGV
FT                   IVSREAMTGRVEKSGGQDKGSQEDDPAASQRPPSNSGVKEISHTSLPQPDPPGGGSKGN
FT                   KNGDNNSSNHNGEGNGPSSHSAVGPSFTGRTEPSKSPGSLRYSYKESFGSAVPRNVSGY
FT                   PQYPSGQEKGDFGSHGERKGRNEKFPSLLQEVLQGYHHHPDRRYPRSAQEHQGMASGLE
FT                   GTARPNILVSQTNELASRGLLNKSIGSLLENPHWGPWERKSSSTAPEMKQINLSDYPIP
FT                   RKFEIEPPSSAHEPGGSLSERRSVICDISPLRQIVRDPGAHSLGHMGTDARIGRNERLN
FT                   PSLSQSVILPGGLVSMETKLKSQSGQIKEEDFEQSKSQASFNKKSGDHCHPTSIKHETY
FT                   RGNASPGAAAHDSISDYGPQDSRSTPMRRVPGRVGSRETMRGRSSSQYHDFAEKLKMSP
FT                   GRSRGPGGDPHHMNPHMTFSERANRSSLHAPFSPNSESLASAYHTNTRAHAYGDPNTGL
FT                   NSQLHYKRQMYQQQQEEYKDWASSSAQGVIAAAQHRQEGPRKSPRQQQFLDRVRSPLKN
FT                   DKDGMMYGPPVGTYHDPSTQEAGRCLMSSDGLPAKSMELKHSSQKLQESCWDLSRQTSP
FT                   AKSSGPPGMSNQKRYGPPHEPDGHGLAESAQSSKPSNVMLRLPGQEDHSSQNPLIMRRR
FT                   VRSFISPIPSKRQSQDVKNSNADDKGRLLHPSKEGADKAYNSYSHLSHSQDIKSIPKRD
FT                   SSKDLPNPDNRNCPAVTLTSPAKTKILPPRKGRGLKLEAIVQKITSPNIRRSASANSAE
FT                   AGGDTVTLDDILSLKSGPPEGGTVATQEAEMEKRKCEVVSDLVSVTNQESNVEKPLPGP
FT                   SEEWRGSGDDKVKTEAHVETASTGKEPSGTMTSTASQKPGGNQGRPDGSLGGAAPLIFP
FT                   DSKNVAPVGILAPEANPKAEEKENDTVMISPKQESFPPKGYFPSGKKKGRPIGSVNKQK
FT                   KQQQQPPPPPQPPQMPEGSADGEPKPKKQRQRRERRKPGAQPRKRKTKQAVPIVEPQEP
FT                   EIKLKYATQPLDKTDAKNKSFFPYIHVVNKCELGAVCTIINAEEEEQTKLVRSRKGQRS
FT                   LTPPPQQHRKQGAPSFILYAAGACGNRVFCYGAPGLLSLWQVGQLP"
FT   gene            complement(3921551..3922693)
FT                   /locus_tag="mCG_147104"
FT                   /note="gene_id=mCG147104.0"
FT   mRNA            complement(3921551..3922693)
FT                   /locus_tag="mCG_147104"
FT                   /product="mCG147104"
FT                   /note="gene_id=mCG147104.0 transcript_id=mCT187367.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3922140..3922430)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147104"
FT                   /product="mCG147104"
FT                   /note="gene_id=mCG147104.0 transcript_id=mCT187367.0
FT                   protein_id=mCP108763.0"
FT                   /protein_id="EDL04488.1"
FT                   /translation="MTKSSLIKDSINWGWLTGSEVQPVISKAGAWQYLGRHGGGGAESS
FT                   TSSSQGCKQNTDFQASLSAHTHSNTPPTGLHLLLVPPPPQAPFPWPSIYKL"
FT   assembly_gap    3927944..3928078
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    3934958..3935293
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    3945531..3945550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3956205..3956363
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   gene            <3958169..3962274
FT                   /locus_tag="mCG_54425"
FT                   /note="gene_id=mCG54425.2"
FT   mRNA            join(<3958169..3958267,3961801..3962274)
FT                   /locus_tag="mCG_54425"
FT                   /product="mCG54425"
FT                   /note="gene_id=mCG54425.2 transcript_id=mCT54608.2 created
FT                   on 05-SEP-2002"
FT   CDS             join(<3958169..3958267,3961801..3962256)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54425"
FT                   /product="mCG54425"
FT                   /note="gene_id=mCG54425.2 transcript_id=mCT54608.2
FT                   protein_id=mCP33911.2"
FT                   /protein_id="EDL04487.1"
FT                   /translation="VSLCLTGTRRIPESSRGTGCRETLGPVPASFPTLSRTTAKHMCDA
FT                   LGTESSRNHGFSNSPPVLDSSLSFVSHSSLPPTHCSPMSTSPWLNSVQWLPKSHSPGHK
FT                   ALSWLSSKCQPPLPCFIVSAKPNKLCPWPSLFPEAEEPASAETKVFLPCFFRSNSNAAS
FT                   LITIHSFIHSTLAEYHIPSIE"
FT   assembly_gap    3970795..3971003
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    3981253..3981307
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    3989063..3989280
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    4017967..4017986
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4019926..4020585
FT                   /estimated_length=660
FT                   /gap_type="unknown"
FT   assembly_gap    4023310..4023395
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    4039895..4039914
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4042118..4042174
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   gene            complement(4054532..4058309)
FT                   /locus_tag="mCG_128427"
FT                   /note="gene_id=mCG128427.0"
FT   mRNA            complement(join(4054532..4056591,4058211..4058309))
FT                   /locus_tag="mCG_128427"
FT                   /product="mCG128427"
FT                   /note="gene_id=mCG128427.0 transcript_id=mCT129725.1
FT                   created on 28-AUG-2002"
FT   CDS             complement(4056064..4056345)
FT                   /codon_start=1
FT                   /locus_tag="mCG_128427"
FT                   /product="mCG128427"
FT                   /note="gene_id=mCG128427.0 transcript_id=mCT129725.1
FT                   protein_id=mCP83436.1"
FT                   /protein_id="EDL04485.1"
FT                   /translation="MSLGFCPGCFFHQESHSSPGHFSMDKVVLSPTGLLWIASLSSSPL
FT                   TATPAELCMWLSWHRPPNLVPRQTWSCEDIAGPLLGLCLATESLQLLG"
FT   assembly_gap    4061544..4077660
FT                   /estimated_length=16117
FT                   /gap_type="unknown"
FT   assembly_gap    4078697..4078716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4085869..4085888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4089707..4089742
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    4111836..4111924
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    4114390..4114586
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    4119891..4120140
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    4129128..4129310
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   gene            4156373..4179480
FT                   /locus_tag="mCG_4197"
FT                   /note="gene_id=mCG4197.3"
FT   mRNA            join(4156373..4156519,4157832..4157981,4158060..4158173,
FT                   4158487..4158528,4158812..4158831,4159121..4159195,
FT                   4160495..4160607,4161796..4161875,4168953..4168987,
FT                   4171100..4171182,4172310..4172406,4173000..4173712,
FT                   4174292..4174484,4174814..4174917,4175928..4176004,
FT                   4176630..4176760,4178575..4178717,4179397..4179480)
FT                   /locus_tag="mCG_4197"
FT                   /product="mCG4197, transcript variant mCT3032"
FT                   /note="gene_id=mCG4197.3 transcript_id=mCT3032.3 created on
FT                   12-JUN-2003"
FT   mRNA            join(4156389..4156519,4157832..4157981,4158060..4158173,
FT                   4158487..4158528,4158812..4158831,4159121..4159195,
FT                   4160495..4160607,4161796..4161875,4168953..4168987,
FT                   4169497..4169661,4171100..4171148)
FT                   /locus_tag="mCG_4197"
FT                   /product="mCG4197, transcript variant mCT185574"
FT                   /note="gene_id=mCG4197.3 transcript_id=mCT185574.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(4156516..4156519,4157832..4157981,4158060..4158173,
FT                   4158487..4158528,4158812..4158831,4159121..4159195,
FT                   4160495..4160607,4161796..4161875,4168953..4168987,
FT                   4171100..4171182,4172310..4172406,4173000..4173122)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4197"
FT                   /product="mCG4197, isoform CRA_b"
FT                   /note="gene_id=mCG4197.3 transcript_id=mCT3032.3
FT                   protein_id=mCP12233.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q80XK9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:1890404"
FT                   /db_xref="UniProtKB/TrEMBL:Q80XK9"
FT                   /protein_id="EDL04484.1"
FT                   /translation="MGLHSELKLAVPWGHIALKVWGSQKNPPVLCLHGWLDNANSFDRL
FT                   IPLLPQDFCYMAMDFGGHGLSSHYNPGLPYYQQNFVSEVRRVATAFKWNQFTLLGHSFG
FT                   GCVGGTFACMFPEMVDKLILLDSTPFFLDSNEMENILTYRRRNIEHTLQVEASQKKSLR
FT                   AVSPEEMLQGFLNNNSHLDKDCGELILQRGTTKVDAGLVLNRDRRISWPENSFDFVSKE
FT                   MFVHSAKSLQASVLMIKALQGYYDVRRANDADKAPMHFMVDTLRSTLKERFQFVEVPGN
FT                   HYIHMNKPQVVAGVVGPFLQGLQRMTSARL"
FT   CDS             join(4156516..4156519,4157832..4157981,4158060..4158173,
FT                   4158487..4158528,4158812..4158831,4159121..4159195,
FT                   4160495..4160607,4161796..4161875,4168953..4168987,
FT                   4169497..4169499)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4197"
FT                   /product="mCG4197, isoform CRA_a"
FT                   /note="gene_id=mCG4197.3 transcript_id=mCT185574.0
FT                   protein_id=mCP106832.0 isoform=CRA_a"
FT                   /protein_id="EDL04483.1"
FT                   /translation="MGLHSELKLAVPWGHIALKVWGSQKNPPVLCLHGWLDNANSFDRL
FT                   IPLLPQDFCYMAMDFGGHGLSSHYNPGLPYYQQNFVSEVRRVATAFKWNQFTLLGHSFG
FT                   GCVGGTFACMFPEMVDKLILLDSTPFFLDSNEMENILTYRRRNIEHTLQVEASQKKSLR
FT                   AVSPEEMLQGFLNNNSHLDKDCGELILQRGTTKVDAGLVLNRDRRISW"
FT   gene            complement(4172592..4179510)
FT                   /locus_tag="mCG_4187"
FT                   /note="gene_id=mCG4187.2"
FT   mRNA            complement(join(4172592..4173714,4174292..4174490,
FT                   4174820..4174917,4175928..4176045,4176635..4176760,
FT                   4178575..4178717,4179397..4179510))
FT                   /locus_tag="mCG_4187"
FT                   /product="mCG4187"
FT                   /note="gene_id=mCG4187.2 transcript_id=mCT3043.2 created on
FT                   22-AUG-2002"
FT   CDS             complement(join(4173629..4173714,4174292..4174490,
FT                   4174820..4174917,4175928..4176045,4176635..4176760,
FT                   4178575..4178717,4179397..4179469))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4187"
FT                   /product="mCG4187"
FT                   /note="gene_id=mCG4187.2 transcript_id=mCT3043.2
FT                   protein_id=mCP12240.1"
FT                   /protein_id="EDL04482.1"
FT                   /translation="MVSRRKKRKAGGHEESIPSPPGYSAVPVKFSAKQQAPHYLYMRQH
FT