
ID   CH466549; SV 2; linear; genomic DNA; CON; MUS; 25548115 BP.
AC   CH466549;
PR   Project:PRJNA11785;
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 8)
DE   Mus musculus 232000009781273 genomic scaffold, whole genome shotgun
DE   sequence.
KW   .
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
RN   [1]
RP   1-25548115
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
RN   [2]
RP   1-25548115
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
RN   [3]
RP   1-25548115
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
DR   MD5; cf2a18d472de91be06fc53edc6db5047.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000220.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000000701; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001729; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000002803; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006356; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006360; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000011148; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000011158; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021003; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021081; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021091; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021115; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021177; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021178; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021187; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021189; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021190; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021208; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021270; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021277; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021280; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021282; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000021886; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033854; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037957; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000040856; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041347; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041550; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041645; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041712; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045404; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047414; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056508; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000058600; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060863; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066359; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000066364; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000068940; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079013; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000079017; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000087075; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000094910; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020002; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020003; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020004; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020005; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020007; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020014; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020015; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020024; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020027; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020031; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020040; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020049; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020051; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020057; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020066; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020068; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020073; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020074; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020076; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020084; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020085; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020086; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020087; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020090; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020092; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020094; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020097; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020119; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020121; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020128; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020131; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020132; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020135; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020154; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020156; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020166; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020167; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0020172; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0019957; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019958; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019959; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019960; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019962; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019969; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019970; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019980; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019983; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019987; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0019996; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020005; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020007; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020012; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020020; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020022; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020027; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020028; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020030; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020038; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020039; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020040; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020041; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020044; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020046; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020048; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020051; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020073; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020074; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020084; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020087; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020088; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020091; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020110; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020112; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020122; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020123; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0020128; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0019933; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019934; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019935; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019936; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019938; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019945; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019946; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019956; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019959; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019963; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019972; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019981; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019983; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019984; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019989; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0019999; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020004; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020005; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020007; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020016; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020017; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020018; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020022; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020024; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020027; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020049; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020050; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020059; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020062; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020063; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020066; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020085; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020087; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020097; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020098; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0020103; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019943; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019944; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019945; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019946; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019948; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019955; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019956; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019966; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019969; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019973; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019982; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019991; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019993; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0019998; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020006; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020008; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020013; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020014; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020016; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020024; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020025; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020026; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020027; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020030; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020032; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020034; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020037; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020059; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020060; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020069; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020072; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020073; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020095; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020097; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020107; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020108; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0020113; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019745; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019746; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019747; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019748; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019750; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019757; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019758; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019768; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019771; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019775; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019784; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019793; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019795; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019796; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019801; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019810; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019812; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019816; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019817; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019819; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019827; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019828; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019829; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019830; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019832; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019834; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019836; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019839; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019861; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019862; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019871; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019874; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019875; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019878; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019897; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019899; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019909; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019910; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0019915; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020392; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020393; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020394; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020395; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020397; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020404; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020405; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020415; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020418; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020422; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020431; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020440; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020442; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020443; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020448; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020453; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020455; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020459; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020460; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020462; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020470; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020471; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020472; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020473; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020475; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020477; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020479; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020482; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020504; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020514; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020517; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020518; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020521; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020540; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020542; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020552; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020553; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0020558; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019291; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019292; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019293; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019294; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019296; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019303; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019304; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019314; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019317; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019321; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019330; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019339; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019341; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019346; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019350; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019352; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019358; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019359; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019360; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019370; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019371; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019374; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019376; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019378; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019381; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019402; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019403; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019412; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019415; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019416; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019419; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019437; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019439; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019449; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019450; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0019455; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021037; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0019717; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019718; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019719; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019720; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019722; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019729; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019730; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019740; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019743; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019747; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019756; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019765; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019767; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019768; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019773; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019778; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019783; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019784; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019786; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019795; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019796; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019797; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019799; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019801; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019803; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019806; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019828; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019829; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019830; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019838; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019841; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019842; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019845; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019864; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019866; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019876; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019877; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0019882; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0019828; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019829; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019830; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019831; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019833; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019840; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019841; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019851; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019854; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019858; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019867; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019876; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019878; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019879; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019884; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019893; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019895; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019900; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019901; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019903; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019911; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019912; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019913; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019914; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019916; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019918; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019920; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019923; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019945; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019946; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019955; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019958; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019959; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019962; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019981; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019983; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019993; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019994; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0019999; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0019817; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019818; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019819; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019820; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019822; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019829; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019830; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019840; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019843; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019847; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019856; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019865; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019867; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019868; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019873; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019879; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019885; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019886; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019888; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019896; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019897; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019898; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019899; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019901; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019903; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019905; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019908; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019930; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019940; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019943; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019944; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019947; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019966; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019968; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019978; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019979; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0019984; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0019904; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019905; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019906; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019907; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019909; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019916; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019917; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019927; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019930; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019934; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019943; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019952; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019954; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019955; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019960; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019970; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019975; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019976; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019978; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019986; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019987; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019988; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019989; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019991; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019993; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019995; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0019998; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020020; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020021; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020030; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020033; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020034; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020037; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020055; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020057; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020067; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020068; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0020073; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019859; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019860; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019861; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019862; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019864; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019871; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019872; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019883; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019887; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019896; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019905; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019907; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019908; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019913; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019917; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019923; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019924; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019926; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019934; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019935; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019936; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019939; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019941; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019943; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019946; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019968; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019978; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019981; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019982; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0019985; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020004; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020006; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020016; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020017; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0020022; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020421; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020422; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020423; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020424; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020426; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020433; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020434; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020444; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020447; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020451; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020460; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020469; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020471; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020476; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020481; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020483; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020488; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020489; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020491; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020499; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020500; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020501; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020504; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020506; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020508; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020511; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020533; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020535; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020543; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020546; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020547; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020550; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020569; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020571; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020581; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020582; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0020587; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019055; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019056; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019057; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019058; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019060; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019067; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019068; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019077; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019080; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019084; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019093; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019102; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019108; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019114; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019116; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019120; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019123; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019131; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019133; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019135; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019137; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019140; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019162; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019163; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019173; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019176; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019177; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019180; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019199; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019201; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019211; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019212; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0019217; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019345; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019346; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019347; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019348; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019350; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019357; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019358; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019368; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019371; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019375; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019384; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019393; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019395; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019396; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019401; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019409; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019411; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019416; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019417; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019419; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019427; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019428; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019429; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019431; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019433; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019435; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019438; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019460; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019471; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019474; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019475; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019478; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019497; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019499; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019509; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019510; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0019515; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000000717; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001780; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000002880; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000009039; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000011302; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021490; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021495; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021506; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021595; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021606; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021607; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021698; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021706; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000021726; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041229; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000043058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044687; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000044923; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046404; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049788; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050993; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000051934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056110; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057324; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072646; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075072; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079735; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000084882; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085026; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085052; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000085116; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090990; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000094361; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000095410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109844; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109957; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110020; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110113; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000110117; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000118101; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000146174; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000150384; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000153627; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160413; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160830; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162735; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165079; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166123; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170188; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000177549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178224; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193053; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000199089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000222375; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035640; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035642; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035644; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035645; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035652; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035683; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035687; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035715; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035726; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035742; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035759; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035790; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035801; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035815; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035831; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035835; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035846; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035847; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035849; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035858; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035860; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035861; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035862; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035870; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035872; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035877; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035897; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035971; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0035977; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036001; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036008; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036009; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036022; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036079; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036084; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036107; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036108; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0036124; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0035561; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035563; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035564; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035565; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035572; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035604; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035608; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035637; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035648; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035664; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035681; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035712; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035723; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035736; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035751; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035755; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035763; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035764; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035767; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035776; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035777; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035779; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035780; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035788; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035790; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035795; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035816; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035886; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035887; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035919; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035926; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035927; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035940; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0035997; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036001; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036024; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036026; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0036042; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0035543; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035545; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035546; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035547; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035554; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035585; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035589; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035618; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035629; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035645; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035662; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035693; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035704; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035705; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035717; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035737; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035745; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035746; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035749; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035759; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035760; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035761; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035768; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035770; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035775; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035796; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035868; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035869; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035895; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035902; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035903; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035916; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035974; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0035978; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036001; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036003; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0036022; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035566; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035568; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035569; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035570; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035577; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035608; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035612; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035641; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035652; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035668; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035685; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035716; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035727; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035739; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035757; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035769; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035770; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035773; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035782; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035784; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035785; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035786; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035794; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035796; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035801; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035822; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035893; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035894; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035924; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035931; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035932; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0035945; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036003; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036007; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036030; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036031; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0036049; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035340; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035343; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035344; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035351; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035381; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035385; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035414; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035425; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035441; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035458; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035500; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035501; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035513; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035531; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035535; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035539; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035540; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035542; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035551; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035552; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035553; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035555; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035562; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035564; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035569; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035590; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035663; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035664; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035695; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035702; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035703; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035716; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035772; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035776; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035801; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035803; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0035819; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036058; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036060; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036061; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036062; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036069; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036100; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036104; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036133; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036144; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036160; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036176; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036206; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036217; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036218; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036230; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036242; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036246; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036253; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036254; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036257; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036266; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036269; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036270; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036271; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036278; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036280; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036285; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036305; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036378; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036410; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036417; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036418; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036431; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036489; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036493; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036517; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036518; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0036530; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035265; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035267; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035269; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035270; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035277; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035310; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035314; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035347; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035358; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035376; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035396; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035426; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035437; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035449; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035460; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035464; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035474; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035475; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035476; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035490; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035491; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035499; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035502; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035508; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035528; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035600; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035601; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035631; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035639; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035640; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035653; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035707; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035711; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035733; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035735; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0035752; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0040508; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0035261; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035263; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035265; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035266; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035273; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035301; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035305; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035334; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035345; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035361; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035378; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035409; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035420; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035421; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035433; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035447; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035455; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035456; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035459; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035470; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035471; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035472; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035479; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035481; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035486; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035507; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035582; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035583; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035589; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035614; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035621; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035622; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035635; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035690; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035694; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035717; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035719; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0035731; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0035393; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035395; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035396; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035397; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035404; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035435; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035439; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035468; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035479; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035495; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035512; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035542; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035554; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035555; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035567; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035583; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035587; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035595; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035596; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035599; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035608; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035609; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035611; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035612; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035619; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035621; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035626; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035647; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035720; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035721; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035753; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035760; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035761; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035774; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035831; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035835; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035859; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035860; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0035876; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0035377; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035379; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035381; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035382; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035389; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035420; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035424; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035454; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035465; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035481; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035498; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035528; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035539; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035540; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035552; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035565; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035573; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035574; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035576; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035585; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035588; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035589; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035590; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035597; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035599; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035604; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035624; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035698; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035730; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035737; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035738; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035751; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035807; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035811; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035834; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035836; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0035849; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0035529; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035531; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035533; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035534; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035541; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035572; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035576; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035605; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035616; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035632; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035649; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035680; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035691; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035692; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035704; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035719; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035723; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035733; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035734; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035737; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035747; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035748; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035750; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035751; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035758; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035760; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035765; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035785; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035859; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035860; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035889; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035896; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035897; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035910; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035965; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035969; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035993; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0035994; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0036010; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035389; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035391; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035392; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035393; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035400; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035430; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035434; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035469; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035485; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035502; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035533; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035544; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035545; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035557; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035568; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035583; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035584; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035586; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035595; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035596; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035597; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035606; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035608; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035613; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035634; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035707; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035737; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035744; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035745; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035758; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035816; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035820; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035844; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035845; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0035861; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036088; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036090; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036092; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036093; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036100; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036131; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036135; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036164; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036175; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036191; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036208; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036239; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036250; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036262; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036274; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036278; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036289; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036290; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036293; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036302; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036304; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036306; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036314; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036316; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036321; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036342; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036413; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036418; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036442; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036450; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036451; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036464; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036520; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036524; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036547; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036549; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0036565; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034944; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034946; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034948; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034950; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034957; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034988; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0034993; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035027; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035035; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035052; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035071; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035102; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035125; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035138; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035142; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035147; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035151; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035162; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035169; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035171; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035177; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035199; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035275; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035276; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035305; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035313; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035314; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035327; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035382; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035386; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035409; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035411; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0035424; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034780; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034782; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034784; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034785; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034792; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034823; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034827; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034856; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034867; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034883; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034901; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034932; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034943; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034944; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034956; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034975; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034978; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034985; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034986; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034989; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034998; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0034999; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035002; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035009; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035011; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035016; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035036; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035108; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035139; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035147; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035148; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035161; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035216; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035220; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035244; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035246; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0035262; mus_musculus_wsbeij.
DR   PubMed; 12040188.
CC   On Sep 6, 2005 this sequence version replaced gi:70980431.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
FH   Key             Location/Qualifiers
FT   source          1..25548115
FT                   /organism="Mus musculus"
FT                   /chromosome="12"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    6148..6532
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    7723..10228
FT                   /estimated_length=2506
FT                   /gap_type="unknown"
FT   gene            complement(11798..13545)
FT                   /locus_tag="mCG_119437"
FT                   /note="gene_id=mCG119437.1"
FT   mRNA            complement(11798..13545)
FT                   /locus_tag="mCG_119437"
FT                   /product="mCG119437"
FT                   /note="gene_id=mCG119437.1 transcript_id=mCT120611.1
FT                   created on 23-JAN-2003"
FT   CDS             complement(11986..13275)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119437"
FT                   /product="mCG119437"
FT                   /note="gene_id=mCG119437.1 transcript_id=mCT120611.1
FT                   protein_id=mCP50430.1"
FT                   /protein_id="EDL18975.1"
FT   assembly_gap    14294..15146
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    16718..19007
FT                   /estimated_length=2290
FT                   /gap_type="unknown"
FT   assembly_gap    20136..20155
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21337..21356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    25832..28320
FT                   /estimated_length=2489
FT                   /gap_type="unknown"
FT   gene            complement(40175..40956)
FT                   /locus_tag="mCG_119440"
FT                   /note="gene_id=mCG119440.1"
FT   mRNA            complement(40175..40956)
FT                   /locus_tag="mCG_119440"
FT                   /product="mCG119440"
FT                   /note="gene_id=mCG119440.1 transcript_id=mCT120614.1
FT                   created on 23-JAN-2003"
FT   CDS             complement(40720..40938)
FT                   /codon_start=1
FT                   /locus_tag="mCG_119440"
FT                   /product="mCG119440"
FT                   /note="gene_id=mCG119440.1 transcript_id=mCT120614.1
FT                   protein_id=mCP50445.1"
FT                   /protein_id="EDL18974.1"
FT   gene            59533..>61940
FT                   /locus_tag="mCG_1047989"
FT                   /note="gene_id=mCG1047989.1"
FT   mRNA            join(59533..59719,61196..>61940)
FT                   /locus_tag="mCG_1047989"
FT                   /product="mCG1047989"
FT                   /note="gene_id=mCG1047989.1 transcript_id=mCT165693.1
FT                   created on 04-FEB-2003"
FT   CDS             61626..61940
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047989"
FT                   /product="mCG1047989"
FT                   /note="gene_id=mCG1047989.1 transcript_id=mCT165693.1
FT                   protein_id=mCP50195.1"
FT                   /protein_id="EDL18973.1"
FT                   "
FT   gene            66723..67959
FT                   /locus_tag="mCG_119436"
FT                   /note="gene_id=mCG119436.1"
FT   mRNA            66723..67959
FT                   /locus_tag="mCG_119436"
FT                   /product="mCG119436"
FT                   /note="gene_id=mCG119436.1 transcript_id=mCT120610.1
FT                   created on 23-JAN-2003"
FT   CDS             66897..67409
FT                   /codon_start=1
FT                   /locus_tag="mCG_119436"
FT                   /product="mCG119436"
FT                   /note="gene_id=mCG119436.1 transcript_id=mCT120610.1
FT                   protein_id=mCP50429.1"
FT                   /protein_id="EDL18972.1"
FT                   PYMPYLA"
FT   gene            69757..70240
FT                   /locus_tag="mCG_1048062"
FT                   /note="gene_id=mCG1048062.1"
FT   mRNA            69757..70240
FT                   /locus_tag="mCG_1048062"
FT                   /product="mCG1048062"
FT                   /note="gene_id=mCG1048062.1 transcript_id=mCT165766.1
FT                   created on 05-FEB-2003"
FT   CDS             70080..70211
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048062"
FT                   /product="mCG1048062"
FT                   /note="gene_id=mCG1048062.1 transcript_id=mCT165766.1
FT                   protein_id=mCP50095.1"
FT                   /protein_id="EDL18971.1"
FT   assembly_gap    85814..87385
FT                   /estimated_length=1572
FT                   /gap_type="unknown"
FT   gene            complement(88920..90523)
FT                   /locus_tag="mCG_8476"
FT                   /note="gene_id=mCG8476.2"
FT   mRNA            complement(88920..90523)
FT                   /locus_tag="mCG_8476"
FT                   /product="mCG8476"
FT                   /note="gene_id=mCG8476.2 transcript_id=mCT7570.2 created on
FT                   23-JAN-2003"
FT   CDS             complement(89209..89943)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8476"
FT                   /product="mCG8476"
FT                   /note="gene_id=mCG8476.2 transcript_id=mCT7570.2
FT                   protein_id=mCP2626.2"
FT                   /protein_id="EDL18970.1"
FT   assembly_gap    94062..94081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <96495..202318
FT                   /gene="Adck1"
FT                   /locus_tag="mCG_8475"
FT                   /note="gene_id=mCG8475.3"
FT   mRNA            join(<96495..96536,104260..104405,107635..107718,
FT                   138045..138248,167194..167353,179353..179511,
FT                   184910..185026,196085..196234,197343..197540,
FT                   199616..199809,201613..202317)
FT                   /gene="Adck1"
FT                   /locus_tag="mCG_8475"
FT                   /product="aarF domain containing kinase 1, transcript
FT                   variant mCT191282"
FT                   /note="gene_id=mCG8475.3 transcript_id=mCT191282.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<96742..96913,104260..104405,107635..107718,
FT                   138045..138248,167194..167353,179353..179511,
FT                   184910..185026,196085..196234,197343..197540,
FT                   199616..199809,201613..202315)
FT                   /gene="Adck1"
FT                   /locus_tag="mCG_8475"
FT                   /product="aarF domain containing kinase 1, transcript
FT                   variant mCT191281"
FT                   /note="gene_id=mCG8475.3 transcript_id=mCT191281.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(96780..96913,104260..104405,107635..107718,
FT                   138045..138289,167194..167353,179353..179511,
FT                   184910..185026,196085..196234,197343..197540,
FT                   199616..199809,201613..202318)
FT                   /gene="Adck1"
FT                   /locus_tag="mCG_8475"
FT                   /product="aarF domain containing kinase 1, transcript
FT                   variant mCT7573"
FT                   /note="gene_id=mCG8475.3 transcript_id=mCT7573.2 created on
FT                   20-JAN-2003"
FT   gene            complement(101240..>113072)
FT                   /locus_tag="mCG_144675"
FT                   /note="gene_id=mCG144675.0"
FT   mRNA            complement(join(101240..102802,104451..104696,
FT                   112596..>113072))
FT                   /locus_tag="mCG_144675"
FT                   /product="mCG144675"
FT                   /note="gene_id=mCG144675.0 transcript_id=mCT184099.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(102401..102802,104451..>104486))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144675"
FT                   /product="mCG144675"
FT                   /note="gene_id=mCG144675.0 transcript_id=mCT184099.0
FT                   protein_id=mCP105369.0"
FT                   /protein_id="EDL18969.1"
FT   CDS             join(104271..104405,107635..107718,138045..138289,
FT                   167194..167353,179353..179511,184910..185026,
FT                   196085..196234,197343..197540,199616..199809,
FT                   201613..201790)
FT                   /codon_start=1
FT                   /gene="Adck1"
FT                   /locus_tag="mCG_8475"
FT                   /product="aarF domain containing kinase 1, isoform CRA_b"
FT                   /note="gene_id=mCG8475.3 transcript_id=mCT7573.2
FT                   protein_id=mCP2621.2 isoform=CRA_b"
FT                   /protein_id="EDL18967.1"
FT   assembly_gap    111274..111308
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    118237..119075
FT                   /estimated_length=839
FT                   /gap_type="unknown"
FT   assembly_gap    134449..134897
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   assembly_gap    136150..136275
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    137940..137959
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<138172..138248,167194..167353,179353..179511,
FT                   184910..185026,196085..196234,197343..197540,
FT                   199616..199809,201613..201790)
FT                   /codon_start=1
FT                   /gene="Adck1"
FT                   /locus_tag="mCG_8475"
FT                   /product="aarF domain containing kinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG8475.3 transcript_id=mCT191281.0
FT                   protein_id=mCP112240.0 isoform=CRA_a"
FT                   /protein_id="EDL18965.1"
FT                   LGWLTRAPHRM"
FT   CDS             join(<138172..138248,167194..167353,179353..179511,
FT                   184910..185026,196085..196234,197343..197540,
FT                   199616..199809,201613..201790)
FT                   /codon_start=1
FT                   /gene="Adck1"
FT                   /locus_tag="mCG_8475"
FT                   /product="aarF domain containing kinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG8475.3 transcript_id=mCT191282.0
FT                   protein_id=mCP112241.0 isoform=CRA_a"
FT                   /protein_id="EDL18966.1"
FT                   LGWLTRAPHRM"
FT   assembly_gap    168489..169838
FT                   /estimated_length=1350
FT                   /gap_type="unknown"
FT   gene            complement(172398..180490)
FT                   /locus_tag="mCG_1051008"
FT                   /note="gene_id=mCG1051008.0"
FT   mRNA            complement(join(172398..173144,179297..179505,
FT                   180451..180490))
FT                   /locus_tag="mCG_1051008"
FT                   /product="mCG1051008"
FT                   /note="gene_id=mCG1051008.0 transcript_id=mCT194797.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(172680..172913)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051008"
FT                   /product="mCG1051008"
FT                   /note="gene_id=mCG1051008.0 transcript_id=mCT194797.0
FT                   protein_id=mCP115826.0"
FT                   /protein_id="EDL18968.1"
FT   assembly_gap    187985..188004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    192341..192360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    195063..195082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    216839..216858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    234050..234069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    235019..235038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    248472..249085
FT                   /estimated_length=614
FT                   /gap_type="unknown"
FT   assembly_gap    250290..250309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    254646..254665
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    267890..268134
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    279884..280350
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    281421..281743
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    338589..339165
FT                   /estimated_length=577
FT                   /gap_type="unknown"
FT   assembly_gap    351014..351033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    359312..359440
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    360708..360836
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    363985..364004
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    380268..380521
FT                   /estimated_length=254
FT                   /gap_type="unknown"
FT   assembly_gap    390210..390307
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    442175..442210
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    456586..456819
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   gene            464443..>592060
FT                   /locus_tag="mCG_8479"
FT                   /note="gene_id=mCG8479.2"
FT   mRNA            join(464443..464755,536245..537634,574360..574377,
FT                   592031..>592060)
FT                   /locus_tag="mCG_8479"
FT                   /product="mCG8479"
FT                   /note="gene_id=mCG8479.2 transcript_id=mCT7530.2 created on
FT                   13-MAR-2003"
FT   assembly_gap    465776..465795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    485472..485491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    486981..487021
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    496443..496462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(536926..537634,574360..574377,592031..>592060)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8479"
FT                   /product="mCG8479"
FT                   /note="gene_id=mCG8479.2 transcript_id=mCT7530.2
FT                   protein_id=mCP2618.2"
FT                   /protein_id="EDL18964.1"
FT   assembly_gap    554840..554973
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    568662..568681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    572097..572138
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    589841..589860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    669819..669838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            695143..>1274968
FT                   /locus_tag="mCG_8477"
FT                   /note="gene_id=mCG8477.3"
FT   mRNA            join(695143..695362,696557..696657,929018..929319,
FT                   935042..935203,996674..997112,1002147..1002530,
FT                   1090257..1090460,1096464..1096490,1244962..1245081,
FT                   1252269..1252650,1253860..1254050,1254883..1255056,
FT                   1259850..1259876,1274849..>1274968)
FT                   /locus_tag="mCG_8477"
FT                   /product="mCG8477, transcript variant mCT7534"
FT                   /note="gene_id=mCG8477.3 transcript_id=mCT7534.2 created on
FT                   10-JUN-2003"
FT   mRNA            join(695198..695362,929018..929319,935042..935203,
FT                   996674..997112,1002147..1002530,1090257..1090460,
FT                   1096464..1096490,1244962..1245081,1252269..1252650,
FT                   1253860..1254050,1254883..1255056,1259850..1259876,
FT                   1274849..>1274968)
FT                   /locus_tag="mCG_8477"
FT                   /product="mCG8477, transcript variant mCT185506"
FT                   /note="gene_id=mCG8477.3 transcript_id=mCT185506.0 created
FT                   on 10-JUN-2003"
FT   assembly_gap    705520..705539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    718679..718698
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    779167..779186
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    836011..836030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    841944..841986
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    858610..858934
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    876652..876792
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    906906..906925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    909320..909612
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    915446..915465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    927104..927140
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   CDS             join(935102..935203,996674..997112,1002147..1002530,
FT                   1090257..1090460,1096464..1096490,1244962..1245081,
FT                   1252269..1252650,1253860..1254050,1254883..1255056,
FT                   1259850..1259876,1274849..>1274968)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8477"
FT                   /product="mCG8477, isoform CRA_a"
FT                   /note="gene_id=mCG8477.3 transcript_id=mCT185506.0
FT                   protein_id=mCP106764.0 isoform=CRA_a"
FT                   /protein_id="EDL18962.1"
FT   CDS             join(935102..935203,996674..997112,1002147..1002530,
FT                   1090257..1090460,1096464..1096490,1244962..1245081,
FT                   1252269..1252650,1253860..1254050,1254883..1255056,
FT                   1259850..1259876,1274849..>1274968)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8477"
FT                   /product="mCG8477, isoform CRA_a"
FT                   /note="gene_id=mCG8477.3 transcript_id=mCT7534.2
FT                   protein_id=mCP2628.1 isoform=CRA_a"
FT                   /protein_id="EDL18963.1"
FT   assembly_gap    999994..1000014
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    1003558..1003577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1107216..1107335
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    1127414..1127433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1182896..1183331
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   assembly_gap    1191941..1192666
FT                   /estimated_length=726
FT                   /gap_type="unknown"
FT   assembly_gap    1219281..1219314
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    1271748..1272013
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    1300572..1300722
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    1333619..1333638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1351904..1351923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1353929..1353948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1376293..1376312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1380505..1380524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1383885..1383904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1385641..1386052
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    1388115..1388134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1439593..1439612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1451658..1451908
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    1486145..1486164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1487724..1487743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1532138..1532220
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    1535256..1535480
FT                   /estimated_length=225
FT                   /gap_type="unknown"
FT   gene            <1556371..2078089
FT                   /locus_tag="mCG_6347"
FT                   /note="gene_id=mCG6347.2"
FT   mRNA            join(1556371..1557530,1720223..1720404,1912752..1912923,
FT                   1943013..1943102,1948386..1948693,2027473..2027551,
FT                   2075415..2078089)
FT                   /locus_tag="mCG_6347"
FT                   /product="mCG6347, transcript variant mCT5578"
FT                   /note="gene_id=mCG6347.2 transcript_id=mCT5578.2 created on
FT                   23-JAN-2003"
FT   mRNA            join(<1556371..1557530,1720223..1720404,1912752..1912923,
FT                   1943013..1943102,1948386..1948693,2027473..2027560,
FT                   2075718..2077373)
FT                   /locus_tag="mCG_6347"
FT                   /product="mCG6347, transcript variant mCT191270"
FT                   /note="gene_id=mCG6347.2 transcript_id=mCT191270.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<1557272..1557530,1720223..1720404,1912752..1912923,
FT                   1943013..1943102,1948386..1948693,2027473..2027560,
FT                   2075718..2076340)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6347"
FT                   /product="mCG6347, isoform CRA_a"
FT                   /note="gene_id=mCG6347.2 transcript_id=mCT191270.0
FT                   protein_id=mCP112191.0 isoform=CRA_a"
FT                   /protein_id="EDL18960.1"
FT   CDS             join(1557290..1557530,1720223..1720404,1912752..1912923,
FT                   1943013..1943102,1948386..1948693,2027473..2027551,
FT                   2075415..2076340)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6347"
FT                   /product="mCG6347, isoform CRA_b"
FT                   /note="gene_id=mCG6347.2 transcript_id=mCT5578.2
FT                   protein_id=mCP2631.2 isoform=CRA_b"
FT                   /protein_id="EDL18961.1"
FT   assembly_gap    1581251..1581303
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    1608060..1608115
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    1637382..1637456
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    1695695..1695714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1725853..1725872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1727976..1728247
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    1752738..1752757
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1820660..1823846
FT                   /estimated_length=3187
FT                   /gap_type="unknown"
FT   assembly_gap    1853475..1854037
FT                   /estimated_length=563
FT                   /gap_type="unknown"
FT   assembly_gap    1863121..1863246
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    1864484..1864503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1905300..1905319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1919868..1919887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1958005..1958074
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1992239..1992258
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1996241..1996337
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    2004008..2004027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2018142..2018161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2072343..2072556
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    2104682..2105300
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    2107900..2108369
FT                   /estimated_length=470
FT                   /gap_type="unknown"
FT   assembly_gap    2114114..2114133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2117997..2118016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2118668..2118965
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    2124012..2124164
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    2162564..2162583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2170144..2170244
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    2180128..2180772
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    2181389..2183104
FT                   /estimated_length=1716
FT                   /gap_type="unknown"
FT   assembly_gap    2212676..2212695
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2272100..2272154
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    2273625..2273728
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    2302814..2303228
FT                   /estimated_length=415
FT                   /gap_type="unknown"
FT   assembly_gap    2304903..2304922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2306102..2306121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2307491..2307510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2308570..2308589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2310164..2311589
FT                   /estimated_length=1426
FT                   /gap_type="unknown"
FT   assembly_gap    2321856..2321875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2323330..2323349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2324546..2325113)
FT                   /locus_tag="mCG_3623"
FT                   /note="gene_id=mCG3623.1"
FT   mRNA            complement(2324546..2325111)
FT                   /locus_tag="mCG_3623"
FT                   /product="mCG3623, transcript variant mCT3086"
FT                   /note="gene_id=mCG3623.1 transcript_id=mCT3086.0 created on
FT                   23-JAN-2003"
FT   mRNA            complement(join(2324563..2324888,2324985..2325113))
FT                   /locus_tag="mCG_3623"
FT                   /product="mCG3623, transcript variant mCT179050"
FT                   /note="gene_id=mCG3623.1 transcript_id=mCT179050.0 created
FT                   on 23-JAN-2003"
FT   CDS             complement(join(2324696..2324888,2324985..2325076))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3623"
FT                   /product="mCG3623, isoform CRA_a"
FT                   /note="gene_id=mCG3623.1 transcript_id=mCT179050.0
FT                   protein_id=mCP101972.0 isoform=CRA_a"
FT                   /protein_id="EDL18958.1"
FT   CDS             complement(2324696..2324944)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3623"
FT                   /product="mCG3623, isoform CRA_b"
FT                   /note="gene_id=mCG3623.1 transcript_id=mCT3086.0
FT                   protein_id=mCP2633.1 isoform=CRA_b"
FT                   /protein_id="EDL18959.1"
FT   assembly_gap    2325947..2325966
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2326834..2326853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2329156..2329175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2333535..2333554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2342963..2343291
FT                   /estimated_length=329
FT                   /gap_type="unknown"
FT   assembly_gap    2350248..2350352
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    2355715..2355984
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    2398765..2398784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2441232..2441394
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    2444672..2444768
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    2452675..2452694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2463736..2464160
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   gene            complement(2473062..2486729)
FT                   /gene="Dio2"
FT                   /locus_tag="mCG_3622"
FT                   /note="gene_id=mCG3622.1"
FT   mRNA            complement(join(2473062..2478502,2486595..2486729))
FT                   /gene="Dio2"
FT                   /locus_tag="mCG_3622"
FT                   /product="deiodinase, iodothyronine, type II"
FT                   /note="gene_id=mCG3622.1 transcript_id=mCT3085.1 created on
FT                   20-JAN-2003"
FT   CDS             complement(join(2478070..2478502,2486595..2486608))
FT                   /codon_start=1
FT                   /gene="Dio2"
FT                   /locus_tag="mCG_3622"
FT                   /product="deiodinase, iodothyronine, type II"
FT                   /note="gene_id=mCG3622.1 transcript_id=mCT3085.1
FT                   protein_id=mCP2629.1"
FT                   /protein_id="EDL18957.1"
FT   assembly_gap    2486730..2494671
FT                   /estimated_length=7942
FT                   /gap_type="unknown"
FT   assembly_gap    2552373..2552473
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    2557376..2557395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2571157..2574995
FT                   /estimated_length=3839
FT                   /gap_type="unknown"
FT   assembly_gap    2581814..2582024
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    2595479..2595498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2600820..2600839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2606744..2608015
FT                   /estimated_length=1272
FT                   /gap_type="unknown"
FT   assembly_gap    2624648..2624667
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2653374..2653393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2658543..2658850
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    2677093..2677112
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2691717..2691736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<2693398..2706481)
FT                   /locus_tag="mCG_147633"
FT                   /note="gene_id=mCG147633.0"
FT   mRNA            complement(join(<2693398..2693488,2706271..2706481))
FT                   /locus_tag="mCG_147633"
FT                   /product="mCG147633"
FT                   /note="gene_id=mCG147633.0 transcript_id=mCT187896.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(<2693398..2693488,2706271..2706438))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147633"
FT                   /product="mCG147633"
FT                   /note="gene_id=mCG147633.0 transcript_id=mCT187896.0
FT                   protein_id=mCP109009.0"
FT                   /protein_id="EDL18956.1"
FT   assembly_gap    2702235..2702254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2710216..2710300
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2733921..2733964
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            complement(2735235..3118256)
FT                   /gene="4930534B04Rik"
FT                   /locus_tag="mCG_3626"
FT                   /note="gene_id=mCG3626.2"
FT   mRNA            complement(join(2735235..2736403,2745445..2745547,
FT                   2746174..2746237,2755909..2756022,2759017..2759094,
FT                   2806529..2806552,2826830..2826879,2948771..2948963,
FT                   2962846..2962905,2966084..2966260,2987272..2987436,
FT                   2991691..2992341,2998443..2998793,3021865..3022016,
FT                   3026183..3026315,3028352..3028426,3033021..3033107,
FT                   3059482..3059598,3067060..3067132,3072950..3073041,
FT                   3081412..3081527,3082636..3082762,3098246..3098332,
FT                   3100229..3100390,3103948..3104082,3115532..3115672,
FT                   3118118..3118256))
FT                   /gene="4930534B04Rik"
FT                   /locus_tag="mCG_3626"
FT                   /product="RIKEN cDNA 4930534B04"
FT                   /note="gene_id=mCG3626.2 transcript_id=mCT3090.2 created on
FT                   23-JAN-2003"
FT   assembly_gap    2740965..2741269
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   CDS             complement(join(2746226..2746237,2755909..2756022,
FT                   2759017..2759094,2806529..2806552,2826830..2826879,
FT                   2948771..2948963,2962846..2962905,2966084..2966260,
FT                   2987272..2987436,2991691..2992341,2998443..2998793,
FT                   3021865..3022016,3026183..3026315,3028352..3028426,
FT                   3033021..3033107,3059482..3059598,3067060..3067132,
FT                   3072950..3073041,3081412..3081527,3082636..3082762,
FT                   3098246..3098332,3100229..3100375))
FT                   /codon_start=1
FT                   /gene="4930534B04Rik"
FT                   /locus_tag="mCG_3626"
FT                   /product="RIKEN cDNA 4930534B04"
FT                   /note="gene_id=mCG3626.2 transcript_id=mCT3090.2
FT                   protein_id=mCP2622.2"
FT                   /protein_id="EDL18954.1"
FT   gene            <2782490..2800062
FT                   /locus_tag="mCG_145970"
FT                   /note="gene_id=mCG145970.0"
FT   mRNA            join(<2782490..2782609,2787072..2787170,2796335..2796401,
FT                   2799343..2800062)
FT                   /locus_tag="mCG_145970"
FT                   /product="mCG145970"
FT                   /note="gene_id=mCG145970.0 transcript_id=mCT186078.0
FT                   created on 04-JUL-2003"
FT   assembly_gap    2782904..2783056
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   CDS             join(<2787101..2787170,2796335..2796401,2799343..2799460)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145970"
FT                   /product="mCG145970"
FT                   /note="gene_id=mCG145970.0 transcript_id=mCT186078.0
FT                   protein_id=mCP107378.0"
FT                   /protein_id="EDL18955.1"
FT   assembly_gap    2790112..2793296
FT                   /estimated_length=3185
FT                   /gap_type="unknown"
FT   assembly_gap    2794684..2794703
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2801806..2801825
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2813145..2813164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2819739..2819758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2820945..2820964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2822577..2822896
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    2861207..2862328
FT                   /estimated_length=1122
FT                   /gap_type="unknown"
FT   assembly_gap    2863907..2863926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2866450..2866879
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    2881310..2881329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2883481..2883500
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2913630..2913684
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    2947398..2947439
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    2968932..2969236
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    2971477..2971538
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    2975872..2975989
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    2977461..2978163
FT                   /estimated_length=703
FT                   /gap_type="unknown"
FT   assembly_gap    3011474..3011493
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3012927..3012946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3013941..3013960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3031104..3032377
FT                   /estimated_length=1274
FT                   /gap_type="unknown"
FT   assembly_gap    3043961..3043980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3056942..3056963
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    3064961..3065545
FT                   /estimated_length=585
FT                   /gap_type="unknown"
FT   assembly_gap    3070368..3070425
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            3134895..3252721
FT                   /gene="Tshr"
FT                   /locus_tag="mCG_48850"
FT                   /note="gene_id=mCG48850.1"
FT   mRNA            join(3134895..3135139,3207499..3207570,3211918..3211992,
FT                   3216354..3216428,3219185..3219259,3221637..3221714,
FT                   3226063..3226131,3233372..3233449,3247845..3248033,
FT                   3251165..3252721)
FT                   /gene="Tshr"
FT                   /locus_tag="mCG_48850"
FT                   /product="thyroid stimulating hormone receptor, transcript
FT                   variant mCT49033"
FT                   /note="gene_id=mCG48850.1 transcript_id=mCT49033.1 created
FT                   on 20-JAN-2003"
FT   mRNA            join(<3134901..3135139,3207499..3207570,3211918..3211992,
FT                   3216354..3216428,3219185..3219259,3221637..3221714,
FT                   3226063..3226131,3233372..3233449,3235945..3236500)
FT                   /gene="Tshr"
FT                   /locus_tag="mCG_48850"
FT                   /product="thyroid stimulating hormone receptor, transcript
FT                   variant mCT191283"
FT                   /note="gene_id=mCG48850.1 transcript_id=mCT191283.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<3134901..3135139,3207499..3207570,3211918..3211992,
FT                   3216354..3216428,3219185..3219259,3221637..3221714,
FT                   3226063..3226131,3233372..3233449,3235945..3235990)
FT                   /codon_start=1
FT                   /gene="Tshr"
FT                   /locus_tag="mCG_48850"
FT                   /product="thyroid stimulating hormone receptor, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG48850.1 transcript_id=mCT191283.0
FT                   protein_id=mCP112238.0 isoform=CRA_a"
FT                   /protein_id="EDL18952.1"
FT   CDS             join(3134970..3135139,3207499..3207570,3211918..3211992,
FT                   3216354..3216428,3219185..3219259,3221637..3221714,
FT                   3226063..3226131,3233372..3233449,3247845..3248033,
FT                   3251165..3252578)
FT                   /codon_start=1
FT                   /gene="Tshr"
FT                   /locus_tag="mCG_48850"
FT                   /product="thyroid stimulating hormone receptor, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG48850.1 transcript_id=mCT49033.1
FT                   protein_id=mCP25672.2 isoform=CRA_b"
FT                   /protein_id="EDL18953.1"
FT                   QISEEYKQTAL"
FT   assembly_gap    3165364..3165383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3166557..3166576
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3170578..3170597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3179817..3180623
FT                   /estimated_length=807
FT                   /gap_type="unknown"
FT   assembly_gap    3189843..3190157
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   assembly_gap    3215060..3215185
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    3221767..3221888
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    3234104..3234379
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    3264899..3264934
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   gene            complement(3272546..>3304614)
FT                   /gene="Gtf2a1"
FT                   /locus_tag="mCG_3627"
FT                   /note="gene_id=mCG3627.2"
FT   mRNA            complement(join(3272546..3273682,3276740..3276829,
FT                   3281605..3281925,3282202..3282335,3283828..3283903,
FT                   3286632..3286699,3289650..3289857,3300740..3300841,
FT                   3304512..>3304614))
FT                   /gene="Gtf2a1"
FT                   /locus_tag="mCG_3627"
FT                   /product="general transcription factor II A, 1, transcript
FT                   variant mCT191219"
FT                   /note="gene_id=mCG3627.2 transcript_id=mCT191219.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(3273500..3273682,3276740..3276829,
FT                   3281605..3281925,3282202..3282335,3283828..3283903,
FT                   3286632..3286699,3289650..3289857,3300740..3300841,
FT                   3303660..3303704))
FT                   /gene="Gtf2a1"
FT                   /locus_tag="mCG_3627"
FT                   /product="general transcription factor II A, 1, transcript
FT                   variant mCT3084"
FT                   /note="gene_id=mCG3627.2 transcript_id=mCT3084.1 created on
FT                   20-JAN-2003"
FT   CDS             complement(join(3273575..3273682,3276740..3276829,
FT                   3281605..3281925,3282202..3282335,3283828..3283903,
FT                   3286632..3286699,3289650..3289857,3300740..3300841,
FT                   3303660..3303689))
FT                   /codon_start=1
FT                   /gene="Gtf2a1"
FT                   /locus_tag="mCG_3627"
FT                   /product="general transcription factor II A, 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3627.2 transcript_id=mCT3084.1
FT                   protein_id=mCP2623.2 isoform=CRA_b"
FT                   /protein_id="EDL18951.1"
FT   CDS             complement(join(3273575..3273682,3276740..3276829,
FT                   3281605..3281925,3282202..3282335,3283828..3283903,
FT                   3286632..3286699,3289650..3289857,3300740..>3300841))
FT                   /codon_start=1
FT                   /gene="Gtf2a1"
FT                   /locus_tag="mCG_3627"
FT                   /product="general transcription factor II A, 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3627.2 transcript_id=mCT191219.0
FT                   protein_id=mCP112190.0 isoform=CRA_a"
FT                   /protein_id="EDL18950.1"
FT   assembly_gap    3278807..3278826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3292033..3292052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3303409..3303540
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    3315550..3317317
FT                   /estimated_length=1768
FT                   /gap_type="unknown"
FT   assembly_gap    3335729..3335748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3348151..3348235
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            complement(3352605..>3500658)
FT                   /gene="Ston2"
FT                   /locus_tag="mCG_121573"
FT                   /note="gene_id=mCG121573.2"
FT   mRNA            complement(join(3352605..3353868,3355776..3355978,
FT                   3361287..3363125,3428044..3428241,3454560..3454835,
FT                   3457768..3458040,3500348..>3500658))
FT                   /gene="Ston2"
FT                   /locus_tag="mCG_121573"
FT                   /product="stonin 2, transcript variant mCT191247"
FT                   /note="gene_id=mCG121573.2 transcript_id=mCT191247.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(<3353522..3353653,3353794..3353868,
FT                   3355776..3355978,3361287..3363125,3428044..3428241,
FT                   3454560..3454835,3457768..3458040,3500348..3500658))
FT                   /gene="Ston2"
FT                   /locus_tag="mCG_121573"
FT                   /product="stonin 2, transcript variant mCT122779"
FT                   /note="gene_id=mCG121573.2 transcript_id=mCT122779.1
FT                   created on 23-JAN-2003"
FT   CDS             complement(join(<3353522..3353653,3353794..3353868,
FT                   3355776..3355978,3361287..3363125,3428044..3428241,
FT                   3454560..3454835,3457768..3457855))
FT                   /codon_start=1
FT                   /gene="Ston2"
FT                   /locus_tag="mCG_121573"
FT                   /product="stonin 2, isoform CRA_b"
FT                   /note="gene_id=mCG121573.2 transcript_id=mCT122779.1
FT                   protein_id=mCP50297.1 isoform=CRA_b"
FT                   /protein_id="EDL18948.1"
FT                   SAYIVAL"
FT   CDS             complement(join(3353785..3353868,3355776..3355978,
FT                   3361287..3363125,3428044..3428241,3454560..3454835,
FT                   3457768..>3457891))
FT                   /codon_start=1
FT                   /gene="Ston2"
FT                   /locus_tag="mCG_121573"
FT                   /product="stonin 2, isoform CRA_a"
FT                   /note="gene_id=mCG121573.2 transcript_id=mCT191247.0
FT                   protein_id=mCP112201.0 isoform=CRA_a"
FT                   /protein_id="EDL18947.1"
FT   assembly_gap    3355268..3355287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3374360..3374526
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   gene            <3398775..3407704
FT                   /locus_tag="mCG_145294"
FT                   /note="gene_id=mCG145294.0"
FT   mRNA            join(<3398775..3398927,3399939..3400068,3400565..3400782,
FT                   3407446..3407704)
FT                   /locus_tag="mCG_145294"
FT                   /product="mCG145294"
FT                   /note="gene_id=mCG145294.0 transcript_id=mCT184718.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<3400058..3400068,3400565..3400782,3407446..3407513)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145294"
FT                   /product="mCG145294"
FT                   /note="gene_id=mCG145294.0 transcript_id=mCT184718.0
FT                   protein_id=mCP105374.0"
FT                   /protein_id="EDL18949.1"
FT   assembly_gap    3404461..3404480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3430250..3430277
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    3434779..3434798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3440082..3440249
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    3455623..3455870
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    3461056..3461120
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    3470987..3471006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3498056..3498075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3517735..3517772
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   gene            complement(3523469..3562645)
FT                   /gene="Sel1h"
FT                   /locus_tag="mCG_121576"
FT                   /note="gene_id=mCG121576.1"
FT   mRNA            complement(join(3523469..3524261,3526081..3526209,
FT                   3528036..3528208,3528836..3528910,3529191..3529356,
FT                   3529983..3530131,3530423..3530525,3531499..3531561,
FT                   3532434..3532511,3537064..3537120,3538350..3538504,
FT                   3538827..3538908,3540035..3540094,3540182..3540235,
FT                   3544205..3544367,3545087..3545192,3546572..3546739,
FT                   3555164..3555380,3556772..3556809,3562474..3562645))
FT                   /gene="Sel1h"
FT                   /locus_tag="mCG_121576"
FT                   /product="Sel1 (suppressor of lin-12) 1 homolog (C.
FT                   elegans)"
FT                   /note="gene_id=mCG121576.1 transcript_id=mCT122782.1
FT                   created on 23-JAN-2003"
FT   CDS             complement(join(3524052..3524261,3526081..3526209,
FT                   3528036..3528208,3528836..3528910,3529191..3529356,
FT                   3529983..3530131,3530423..3530525,3531499..3531561,
FT                   3532434..3532511,3537064..3537120,3538350..3538504,
FT                   3538827..3538908,3540035..3540094,3540182..3540235,
FT                   3544205..3544367,3545087..3545192,3546572..3546739,
FT                   3555164..3555380,3556772..3556809,3562474..3562546))
FT                   /codon_start=1
FT                   /gene="Sel1h"
FT                   /locus_tag="mCG_121576"
FT                   /product="Sel1 (suppressor of lin-12) 1 homolog (C.
FT                   elegans)"
FT                   /note="gene_id=mCG121576.1 transcript_id=mCT122782.1
FT                   protein_id=mCP50513.1"
FT                   /protein_id="EDL18946.1"
FT   assembly_gap    3534212..3534404
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    3585125..3585186
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    3587476..3588410
FT                   /estimated_length=935
FT                   /gap_type="unknown"
FT   gene            complement(3604272..>3604686)
FT                   /locus_tag="mCG_50210"
FT                   /note="gene_id=mCG50210.1"
FT   mRNA            complement(3604272..>3604686)
FT                   /locus_tag="mCG_50210"
FT                   /product="mCG50210"
FT                   /note="gene_id=mCG50210.1 transcript_id=mCT50393.1 created
FT                   on 19-FEB-2003"
FT   CDS             complement(3604309..3604686)
FT                   /codon_start=1
FT                   /locus_tag="mCG_50210"
FT                   /product="mCG50210"
FT                   /note="gene_id=mCG50210.1 transcript_id=mCT50393.1
FT                   protein_id=mCP25684.0"
FT                   /protein_id="EDL18945.1"
FT   assembly_gap    3649852..3649871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3681676..3682051
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   assembly_gap    3686965..3687211
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    3770061..3770080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3827667..3827853
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    3839341..3840606
FT                   /estimated_length=1266
FT                   /gap_type="unknown"
FT   assembly_gap    3841505..3842292
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   gene            complement(<3868475..3869104)
FT                   /locus_tag="mCG_49303"
FT                   /note="gene_id=mCG49303.2"
FT   mRNA            complement(<3868475..3869104)
FT                   /locus_tag="mCG_49303"
FT                   /product="mCG49303"
FT                   /note="gene_id=mCG49303.2 transcript_id=mCT49486.2 created
FT                   on 23-JAN-2003"
FT   CDS             complement(3868475..3868969)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49303"
FT                   /product="mCG49303"
FT                   /note="gene_id=mCG49303.2 transcript_id=mCT49486.2
FT                   protein_id=mCP25660.2"
FT                   /protein_id="EDL18944.1"
FT                   K"
FT   assembly_gap    3874386..3874405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3888687..3888778
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    3903855..3904097
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    3911329..3913069
FT                   /estimated_length=1741
FT                   /gap_type="unknown"
FT   assembly_gap    3914463..3914482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3935679..3935746
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    3936900..3937774
FT                   /estimated_length=875
FT                   /gap_type="unknown"
FT   assembly_gap    3938866..3938885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3940246..3940265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3942307..3942326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3944194..3947103
FT                   /estimated_length=2910
FT                   /gap_type="unknown"
FT   assembly_gap    3949217..3949236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3957176..3957195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3975817..3975836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3998889..3998908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4002912..4002931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4008720..4008739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4011058..4011094
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    4021224..4021243
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4045255..4045274
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4047062..4047081
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4069697..4069716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4099257..4100422
FT                   /estimated_length=1166
FT                   /gap_type="unknown"
FT   assembly_gap    4122312..4122505
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    4149711..4149921
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    4221784..4221882
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    4229490..4229509
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4291011..4291397
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    4297304..4302237
FT                   /estimated_length=4934
FT                   /gap_type="unknown"
FT   assembly_gap    4329956..4329975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4332269..4332288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4336808..4336827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4339228..4339247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4359950..4359969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4361138..4361157
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4362537..4363030
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    4364779..4365374
FT                   /estimated_length=596
FT                   /gap_type="unknown"
FT   assembly_gap    4408777..4408796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4409959..4409978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4431915..4431934
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4435814..4435892
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    4437489..4438056
FT                   /estimated_length=568
FT                   /gap_type="unknown"
FT   assembly_gap    4439635..4439898
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    4441073..4441437
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    4445485..4445811
FT                   /estimated_length=327
FT                   /gap_type="unknown"
FT   assembly_gap    4447801..4448092
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    4453368..4454665
FT                   /estimated_length=1298
FT                   /gap_type="unknown"
FT   assembly_gap    4455886..4456856
FT                   /estimated_length=971
FT                   /gap_type="unknown"
FT   assembly_gap    4466783..4466802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4469513..4472645
FT                   /estimated_length=3133
FT                   /gap_type="unknown"
FT   assembly_gap    4482607..4482626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4488970..4490550
FT                   /estimated_length=1581
FT                   /gap_type="unknown"
FT   assembly_gap    4494303..4494592
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    4506743..4506762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4550922..4550941
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4553876..4560217
FT                   /estimated_length=6342
FT                   /gap_type="unknown"
FT   assembly_gap    4563387..4563464
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4581231..4582308
FT                   /estimated_length=1078
FT                   /gap_type="unknown"
FT   assembly_gap    4591438..4591765
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    4611726..4611745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4688152..4688189
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    4710335..4710354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4726993..4727012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4731203..4731525
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    4753808..4753827
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4759849..4759868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4809180..4809199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4810210..4810229
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4811682..4811701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4812842..4812861
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4814862..4815509
FT                   /estimated_length=648
FT                   /gap_type="unknown"
FT   assembly_gap    4824457..4824489
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    4897881..4897900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4911325..4911839
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    4920398..4920417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4924498..4924517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4936609..4940499
FT                   /estimated_length=3891
FT                   /gap_type="unknown"
FT   assembly_gap    4966482..4966501
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4967709..4967728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4987383..4990950
FT                   /estimated_length=3568
FT                   /gap_type="unknown"
FT   assembly_gap    5025594..5025735
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    5032994..5033434
FT                   /estimated_length=441
FT                   /gap_type="unknown"
FT   assembly_gap    5038082..5038101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5043359..5043378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5046720..5046739
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5048061..5055582
FT                   /estimated_length=7522
FT                   /gap_type="unknown"
FT   assembly_gap    5057754..5058765
FT                   /estimated_length=1012
FT                   /gap_type="unknown"
FT   assembly_gap    5059886..5060050
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    5064443..5064462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5066267..5066286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5072530..5072549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5073844..5073863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5076693..5077196
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    5091837..5091856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5095594..>5137098)
FT                   /locus_tag="mCG_145305"
FT                   /note="gene_id=mCG145305.0"
FT   mRNA            complement(join(5095594..5095886,5121642..5121746,
FT                   5122654..5122790,5136988..>5137098))
FT                   /locus_tag="mCG_145305"
FT                   /product="mCG145305"
FT                   /note="gene_id=mCG145305.0 transcript_id=mCT184729.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    5098034..5102316
FT                   /estimated_length=4283
FT                   /gap_type="unknown"
FT   assembly_gap    5104739..5105352
FT                   /estimated_length=614
FT                   /gap_type="unknown"
FT   assembly_gap    5106350..5106369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5108041..5108060
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5108947..5111542
FT                   /estimated_length=2596
FT                   /gap_type="unknown"
FT   assembly_gap    5113160..5113179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5115227..5115246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5116741..5116760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5118604..5120047
FT                   /estimated_length=1444
FT                   /gap_type="unknown"
FT   CDS             complement(join(5121731..5121746,5122654..5122790,
FT                   5136988..>5137029))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145305"
FT                   /product="mCG145305"
FT                   /note="gene_id=mCG145305.0 transcript_id=mCT184729.0
FT                   protein_id=mCP105385.0"
FT                   /protein_id="EDL18943.1"
FT   assembly_gap    5138252..5138539
FT                   /estimated_length=288
FT                   /gap_type="unknown"
FT   assembly_gap    5147776..5147823
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    5149173..5149518
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    5155417..5155436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5156507..5156526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5158373..5161834
FT                   /estimated_length=3462
FT                   /gap_type="unknown"
FT   assembly_gap    5165949..5167863
FT                   /estimated_length=1915
FT                   /gap_type="unknown"
FT   assembly_gap    5169554..5170299
FT                   /estimated_length=746
FT                   /gap_type="unknown"
FT   assembly_gap    5185888..5185907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5215554..5215573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5240691..5243084
FT                   /estimated_length=2394
FT                   /gap_type="unknown"
FT   assembly_gap    5264592..5267530
FT                   /estimated_length=2939
FT                   /gap_type="unknown"
FT   assembly_gap    5270097..5270732
FT                   /estimated_length=636
FT                   /gap_type="unknown"
FT   assembly_gap    5272586..5272677
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    5312858..5312877
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5320065..5320502
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    5323669..5323688
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5326718..5326737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5339728..5339747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5343373..5345125
FT                   /estimated_length=1753
FT                   /gap_type="unknown"
FT   assembly_gap    5385949..5385968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5406208..5406227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5408453..5412339
FT                   /estimated_length=3887
FT                   /gap_type="unknown"
FT   assembly_gap    5418481..5419008
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    5430149..5430321
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    5467798..5467817
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5492577..5492596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5509903..5509922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5540067..5540159
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    5587169..5587188
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5591860..5593986
FT                   /estimated_length=2127
FT                   /gap_type="unknown"
FT   assembly_gap    5595499..5595518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5596941..5616572
FT                   /estimated_length=19632
FT                   /gap_type="unknown"
FT   assembly_gap    5702968..5703241
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   assembly_gap    5704317..5705106
FT                   /estimated_length=790
FT                   /gap_type="unknown"
FT   assembly_gap    5705853..5708819
FT                   /estimated_length=2967
FT                   /gap_type="unknown"
FT   assembly_gap    5734514..5736400
FT                   /estimated_length=1887
FT                   /gap_type="unknown"
FT   assembly_gap    5754040..5754316
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    5761446..5761490
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    5767351..5767422
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    5819088..5819832
FT                   /estimated_length=745
FT                   /gap_type="unknown"
FT   assembly_gap    5876590..5876609
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5898322..5898341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5923307..5923326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5925868..5925887
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5938689..5938708
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5946588..5946607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5961617..5961636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5971230..5971249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5978002..5978021
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6012867..6012886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6045465..6045543
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    6046891..6046910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6054463..6054482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6105342..6108986
FT                   /estimated_length=3645
FT                   /gap_type="unknown"
FT   assembly_gap    6109791..6111169
FT                   /estimated_length=1379
FT                   /gap_type="unknown"
FT   assembly_gap    6130519..6130538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6134955..6135528
FT                   /estimated_length=574
FT                   /gap_type="unknown"
FT   assembly_gap    6149501..6149666
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    6180410..6182003
FT                   /estimated_length=1594
FT                   /gap_type="unknown"
FT   assembly_gap    6186865..6186884
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6188659..6188678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6262704..6262869
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    6284969..6285161
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    6286439..6286458
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6288040..6289301
FT                   /estimated_length=1262
FT                   /gap_type="unknown"
FT   assembly_gap    6291538..6291557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6305469..6305488
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6361266..6367985
FT                   /estimated_length=6720
FT                   /gap_type="unknown"
FT   assembly_gap    6379113..6379644
FT                   /estimated_length=532
FT                   /gap_type="unknown"
FT   assembly_gap    6382707..6382726
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6432095..6432114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6442175..6442194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6482096..6482115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6486773..6486792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6511071..6511090
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6513921..6519603
FT                   /estimated_length=5683
FT                   /gap_type="unknown"
FT   assembly_gap    6556716..6558410
FT                   /estimated_length=1695
FT                   /gap_type="unknown"
FT   assembly_gap    6573899..6574018
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    6585986..6586122
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    6619751..6619770
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6672816..6672835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6708266..6708434
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    6718750..6718769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6822593..6823222
FT                   /estimated_length=630
FT                   /gap_type="unknown"
FT   assembly_gap    6838067..6838086
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6863969..6864041
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    6868511..6868530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6882766..6882822
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    6894794..6894834
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    6911318..6911337
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6914775..6915458
FT                   /estimated_length=684
FT                   /gap_type="unknown"
FT   assembly_gap    6933722..6933741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6981361..6981440
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    6985319..6985615
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    6992177..6992196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6999412..7004907
FT                   /estimated_length=5496
FT                   /gap_type="unknown"
FT   assembly_gap    7027049..7028208
FT                   /estimated_length=1160
FT                   /gap_type="unknown"
FT   assembly_gap    7050309..7050328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7058223..7058343
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    7074096..7074782
FT                   /estimated_length=687
FT                   /gap_type="unknown"
FT   assembly_gap    7075453..7076011
FT                   /estimated_length=559
FT                   /gap_type="unknown"
FT   assembly_gap    7101721..7101872
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    7126862..7127205
FT                   /estimated_length=344
FT                   /gap_type="unknown"
FT   assembly_gap    7127655..7127694
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    7141789..7141808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7168477..7168496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7195013..7195063
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   assembly_gap    7238069..7240253
FT                   /estimated_length=2185
FT                   /gap_type="unknown"
FT   assembly_gap    7267567..7273000
FT                   /estimated_length=5434
FT                   /gap_type="unknown"
FT   assembly_gap    7296243..7296320
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    7306158..7306177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7345553..7345572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7347760..7436533
FT                   /gene="Flrt2"
FT                   /locus_tag="mCG_119917"
FT                   /note="gene_id=mCG119917.1"
FT   mRNA            join(7347760..7348140,7434015..7436533)
FT                   /gene="Flrt2"
FT                   /locus_tag="mCG_119917"
FT                   /product="fibronectin leucine rich transmembrane protein 2"
FT                   /note="gene_id=mCG119917.1 transcript_id=mCT121095.1
FT                   created on 23-JAN-2003"
FT   assembly_gap    7351670..7351744
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   CDS             7434398..7436380
FT                   /codon_start=1
FT                   /gene="Flrt2"
FT                   /locus_tag="mCG_119917"
FT                   /product="fibronectin leucine rich transmembrane protein 2"
FT                   /note="gene_id=mCG119917.1 transcript_id=mCT121095.1
FT                   protein_id=mCP50345.1"
FT                   /db_xref="GOA:Q8BLU0"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:3603594"
FT                   /db_xref="PDB:4V2C"
FT                   /db_xref="PDB:4V2D"
FT                   /db_xref="PDB:5FTT"
FT                   /db_xref="PDB:5FTU"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8BLU0"
FT                   /protein_id="EDL18942.1"
FT   assembly_gap    7457462..7457519
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    7460995..7461429
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    7480346..7484738
FT                   /estimated_length=4393
FT                   /gap_type="unknown"
FT   assembly_gap    7548146..7548271
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    7583045..7583064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7654123..7655461
FT                   /estimated_length=1339
FT                   /gap_type="unknown"
FT   assembly_gap    7689527..7689546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7700560..7701164)
FT                   /locus_tag="mCG_56657"
FT                   /note="gene_id=mCG56657.1"
FT   mRNA            complement(7700560..7701164)
FT                   /locus_tag="mCG_56657"
FT                   /product="mCG56657"
FT                   /note="gene_id=mCG56657.1 transcript_id=mCT56840.1 created
FT                   on 20-JAN-2003"
FT   CDS             complement(7700706..7701059)
FT                   /codon_start=1
FT                   /locus_tag="mCG_56657"
FT                   /product="mCG56657"
FT                   /note="gene_id=mCG56657.1 transcript_id=mCT56840.1
FT                   protein_id=mCP29626.0"
FT                   /db_xref="MGI:MGI:1916673"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DA62"
FT                   /protein_id="EDL18941.1"
FT                   HSSTESSRSSTMD"
FT   assembly_gap    7708830..7708849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7725016..7725457
FT                   /estimated_length=442
FT                   /gap_type="unknown"
FT   assembly_gap    7731905..7735037
FT                   /estimated_length=3133
FT                   /gap_type="unknown"
FT   assembly_gap    7742616..7742635
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7763350..7763369
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7776697..7776716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7782458..7782477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7792073..7792092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7793137..7793156
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7794337..7794356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7798524..7798739
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    7832694..7832713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7851252..7851271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7906077..7906096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7956366..7956431
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    8077156..8077390
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    8091779..8091798
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8135899..8135965
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    8140221..8140315
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    8155191..8155390
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    8165706..8170329
FT                   /estimated_length=4624
FT                   /gap_type="unknown"
FT   assembly_gap    8184646..8184711
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    8193821..8193840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8204830..8204849
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8214312..8217003
FT                   /estimated_length=2692
FT                   /gap_type="unknown"
FT   assembly_gap    8287414..8287433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8334328..8334380
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    8345923..8345942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8360096..8360115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8364414..8364732
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   assembly_gap    8474127..8474146
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8497502..8497560
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    8499032..8500037
FT                   /estimated_length=1006
FT                   /gap_type="unknown"
FT   assembly_gap    8502002..8502113
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    8570396..8570552
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   gene            complement(8575579..>8576378)
FT                   /locus_tag="mCG_49071"
FT                   /note="gene_id=mCG49071.1"
FT   mRNA            complement(8575579..>8576378)
FT                   /locus_tag="mCG_49071"
FT                   /product="mCG49071"
FT                   /note="gene_id=mCG49071.1 transcript_id=mCT49254.1 created
FT                   on 14-FEB-2003"
FT   CDS             complement(8575704..8576378)
FT                   /codon_start=1
FT                   /locus_tag="mCG_49071"
FT                   /product="mCG49071"
FT                   /note="gene_id=mCG49071.1 transcript_id=mCT49254.1
FT                   protein_id=mCP29671.0"
FT                   /protein_id="EDL18940.1"
FT                   TM"
FT   assembly_gap    8604191..8604210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8616035..8616286
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    8638829..8639097
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    8644613..8645794
FT                   /estimated_length=1182
FT                   /gap_type="unknown"
FT   assembly_gap    8660476..8660719
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    8693287..8697332
FT                   /estimated_length=4046
FT                   /gap_type="unknown"
FT   assembly_gap    8715469..8716394
FT                   /estimated_length=926
FT                   /gap_type="unknown"
FT   assembly_gap    8731246..8731265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8741837..8741935
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    8759680..8759803
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    8778184..8778634
FT                   /estimated_length=451
FT                   /gap_type="unknown"
FT   assembly_gap    8815365..8815384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8818017..8818036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8853674..8853693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8885211..8885230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8911135..8911154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8932658..8932828
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    8936420..8936485
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    8950401..8950420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8951555..8951799
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    8964804..8964917
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    9029634..9029904
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    9030982..9031754
FT                   /estimated_length=773
FT                   /gap_type="unknown"
FT   assembly_gap    9032756..9033495
FT                   /estimated_length=740
FT                   /gap_type="unknown"
FT   assembly_gap    9034231..9034250
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9040563..9040607
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    9050168..9050265
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    9054797..9054816
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9055886..9056561
FT                   /estimated_length=676
FT                   /gap_type="unknown"
FT   assembly_gap    9123488..9123507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9189484..9189503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9210311..9210330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9211498..9214114
FT                   /estimated_length=2617
FT                   /gap_type="unknown"
FT   assembly_gap    9215162..9215181
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9219910..9220877
FT                   /estimated_length=968
FT                   /gap_type="unknown"
FT   assembly_gap    9259581..9259726
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    9265006..9265025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9271566..9271585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9274365..9274508
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    9323110..9328789
FT                   /estimated_length=5680
FT                   /gap_type="unknown"
FT   assembly_gap    9332575..9338009
FT                   /estimated_length=5435
FT                   /gap_type="unknown"
FT   assembly_gap    9340013..9340032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9361468..9361487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9390601..9390676
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    9407482..9407586
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    9418044..9418349
FT                   /estimated_length=306
FT                   /gap_type="unknown"
FT   assembly_gap    9518625..9518799
FT                   /estimated_length=175
FT                   /gap_type="unknown"
FT   assembly_gap    9531419..9531438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9567351..9567534
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    9586094..9586328
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    9600029..9600088
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    9645326..9645345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9666776..9666795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9672979..9673362
FT                   /estimated_length=384
FT                   /gap_type="unknown"
FT   assembly_gap    9681469..9682206
FT                   /estimated_length=738
FT                   /gap_type="unknown"
FT   assembly_gap    9695700..9695719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(9715392..>9747715)
FT                   /locus_tag="mCG_146208"
FT                   /note="gene_id=mCG146208.0"
FT   mRNA            complement(join(9715392..9717866,9722917..9723022,
FT                   9747423..>9747715))
FT                   /locus_tag="mCG_146208"
FT                   /product="mCG146208"
FT                   /note="gene_id=mCG146208.0 transcript_id=mCT186311.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(9715712..>9715999)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146208"
FT                   /product="mCG146208"
FT                   /note="gene_id=mCG146208.0 transcript_id=mCT186311.0
FT                   protein_id=mCP107381.0"
FT                   /protein_id="EDL18938.1"
FT   gene            complement(<9738837..9739375)
FT                   /locus_tag="mCG_4402"
FT                   /note="gene_id=mCG4402.2"
FT   mRNA            complement(<9738837..9739375)
FT                   /locus_tag="mCG_4402"
FT                   /product="mCG4402"
FT                   /note="gene_id=mCG4402.2 transcript_id=mCT3363.2 created on
FT                   23-JAN-2003"
FT   CDS             complement(<9738837..9739241)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4402"
FT                   /product="mCG4402"
FT                   /note="gene_id=mCG4402.2 transcript_id=mCT3363.2
FT                   protein_id=mCP7058.2"
FT                   /protein_id="EDL18939.1"
FT   assembly_gap    9746859..9746878
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9754917..9754947
FT                   /estimated_length=31
FT                   /gap_type="unknown"
FT   assembly_gap    9756548..9757155
FT                   /estimated_length=608
FT                   /gap_type="unknown"
FT   assembly_gap    9759399..9759418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9760765..9760784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9761956..9761975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9775168..9775414
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    9797217..9797236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9801823..9801865
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   gene            complement(9842815..9897602)
FT                   /gene="Galc"
FT                   /locus_tag="mCG_4401"
FT                   /note="gene_id=mCG4401.1"
FT   mRNA            complement(join(9842815..9843106,9846413..9846489,
FT                   9847730..9847893,9852001..9852178,9853352..9853502,
FT                   9855270..9855356,9860799..9860888,9865364..9865491,
FT                   9869612..9869736,9872437..9872592,9880837..9880967,
FT                   9884449..9884487,9890204..9890343,9892360..9892473,
FT                   9894822..9894885,9895067..9895135,9897330..9897602))
FT                   /gene="Galc"
FT                   /locus_tag="mCG_4401"
FT                   /product="galactosylceramidase"
FT                   /note="gene_id=mCG4401.1 transcript_id=mCT3362.0 created on
FT                   20-JAN-2003"
FT   CDS             complement(join(9842960..9843106,9846413..9846489,
FT                   9847730..9847893,9852001..9852178,9853352..9853502,
FT                   9855270..9855356,9860799..9860888,9865364..9865491,
FT                   9869612..9869736,9872437..9872592,9880837..9880967,
FT                   9884449..9884487,9890204..9890343,9892360..9892473,
FT                   9894822..9894885,9895067..9895135,9897330..9897524))
FT                   /codon_start=1
FT                   /gene="Galc"
FT                   /locus_tag="mCG_4401"
FT                   /product="galactosylceramidase"
FT                   /note="gene_id=mCG4401.1 transcript_id=mCT3362.0
FT                   protein_id=mCP7099.1"
FT                   /db_xref="GOA:P54818"
FT                   /db_xref="InterPro:IPR001286"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR035394"
FT                   /db_xref="MGI:MGI:95636"
FT                   /db_xref="PDB:3ZR5"
FT                   /db_xref="PDB:3ZR6"
FT                   /db_xref="PDB:4CCC"
FT                   /db_xref="PDB:4CCD"
FT                   /db_xref="PDB:4CCE"
FT                   /db_xref="PDB:4UFH"
FT                   /db_xref="PDB:4UFI"
FT                   /db_xref="PDB:4UFJ"
FT                   /db_xref="PDB:4UFK"
FT                   /db_xref="PDB:4UFL"
FT                   /db_xref="PDB:4UFM"
FT                   /db_xref="PDB:5NXB"
FT                   /db_xref="UniProtKB/Swiss-Prot:P54818"
FT                   /protein_id="EDL18937.1"
FT   gene            9906853..9914792
FT                   /gene="Gpr65"
FT                   /locus_tag="mCG_122280"
FT                   /note="gene_id=mCG122280.0"
FT   mRNA            join(9906853..9906910,9912816..9914792)
FT                   /gene="Gpr65"
FT                   /locus_tag="mCG_122280"
FT                   /product="G-protein coupled receptor 65"
FT                   /note="gene_id=mCG122280.0 transcript_id=mCT123497.0
FT                   created on 19-SEP-2002"
FT   assembly_gap    9909115..9909134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             9913250..9914263
FT                   /codon_start=1
FT                   /gene="Gpr65"
FT                   /locus_tag="mCG_122280"
FT                   /product="G-protein coupled receptor 65"
FT                   /note="gene_id=mCG122280.0 transcript_id=mCT123497.0
FT                   protein_id=mCP50377.1"
FT                   /db_xref="GOA:A0A0R4J0Y2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR005464"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:108031"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0Y2"
FT                   /protein_id="EDL18936.1"
FT   assembly_gap    9920613..9920872
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    9926322..9926382
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    9961693..9961712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9975484..9975503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9988299..9988318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9989651..9989670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9993607..9997558
FT                   /estimated_length=3952
FT                   /gap_type="unknown"
FT   assembly_gap    10001912..10001987
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    10016903..10016922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10070748..10215710)
FT                   /gene="1700024D23Rik"
FT                   /locus_tag="mCG_22435"
FT                   /note="gene_id=mCG22435.2"
FT   mRNA            complement(join(10070748..10073455,10074220..10074362,
FT                   10078620..10078806,10127576..10127736,10133864..10133981,
FT                   10156101..10156435,10215282..10215710))
FT                   /gene="1700024D23Rik"
FT                   /locus_tag="mCG_22435"
FT                   /product="RIKEN cDNA 1700024D23, transcript variant
FT                   mCT181841"
FT                   /note="gene_id=mCG22435.2 transcript_id=mCT181841.0 created
FT                   on 07-APR-2003"
FT   mRNA            complement(join(10070748..10073455,10074220..10074362,
FT                   10078620..10078806,10127576..10127736,10133864..10133981,
FT                   10156101..10156435,10211647..10212207))
FT                   /gene="1700024D23Rik"
FT                   /locus_tag="mCG_22435"
FT                   /product="RIKEN cDNA 1700024D23, transcript variant
FT                   mCT22120"
FT                   /note="gene_id=mCG22435.2 transcript_id=mCT22120.2 created
FT                   on 07-APR-2003"
FT   mRNA            complement(join(10071858..10073455,10074220..10074362,
FT                   10078620..10078806,10127576..10127736,10133864..10133981,
FT                   10156101..10156435,10212531..>10212617))
FT                   /gene="1700024D23Rik"
FT                   /locus_tag="mCG_22435"
FT                   /product="RIKEN cDNA 1700024D23, transcript variant
FT                   mCT191237"
FT                   /note="gene_id=mCG22435.2 transcript_id=mCT191237.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(10072835..10073455,10074220..10074362,
FT                   10078620..10078806,10127576..10127736,10133864..10133981,
FT                   10156101..10156435,10215282..10215324))
FT                   /codon_start=1
FT                   /gene="1700024D23Rik"
FT                   /locus_tag="mCG_22435"
FT                   /product="RIKEN cDNA 1700024D23, isoform CRA_a"
FT                   /note="gene_id=mCG22435.2 transcript_id=mCT181841.0
FT                   protein_id=mCP104763.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8BUW1"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR003976"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="MGI:MGI:1919508"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BUW1"
FT                   /protein_id="EDL18932.1"
FT                   TDTKDQGLENNSLLEDRN"
FT   CDS             complement(join(10072835..10073455,10074220..10074362,
FT                   10078620..10078806,10127576..10127736,10133864..10133981,
FT                   10156101..10156435,10212531..>10212615))
FT                   /codon_start=1
FT                   /gene="1700024D23Rik"
FT                   /locus_tag="mCG_22435"
FT                   /product="RIKEN cDNA 1700024D23, isoform CRA_b"
FT                   /note="gene_id=mCG22435.2 transcript_id=mCT191237.0
FT                   protein_id=mCP112185.0 isoform=CRA_b"
FT                   /protein_id="EDL18933.1"
FT   CDS             complement(join(10072835..10073455,10074220..10074362,
FT                   10078620..10078806,10127576..10127736,10133864..10133981,
FT                   10156101..10156435,10211647..10211698))
FT                   /codon_start=1
FT                   /gene="1700024D23Rik"
FT                   /locus_tag="mCG_22435"
FT                   /product="RIKEN cDNA 1700024D23, isoform CRA_c"
FT                   /note="gene_id=mCG22435.2 transcript_id=mCT22120.2
FT                   protein_id=mCP7072.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3LS20"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR003976"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="MGI:MGI:1919508"
FT                   /db_xref="UniProtKB/TrEMBL:Q3LS20"
FT                   /protein_id="EDL18934.1"
FT   assembly_gap    10092065..10092198
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    10100922..10101715
FT                   /estimated_length=794
FT                   /gap_type="unknown"
FT   assembly_gap    10103645..10104349
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   assembly_gap    10110440..10110812
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   assembly_gap    10122548..10123575
FT                   /estimated_length=1028
FT                   /gap_type="unknown"
FT   assembly_gap    10135427..10135446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10146523..10146542
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10161447..10164138
FT                   /locus_tag="mCG_145296"
FT                   /note="gene_id=mCG145296.0"
FT   mRNA            join(<10161447..10161661,10161884..10161923,
FT                   10162890..10164138)
FT                   /locus_tag="mCG_145296"
FT                   /product="mCG145296"
FT                   /note="gene_id=mCG145296.0 transcript_id=mCT184720.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    10162848..10162885
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   CDS             <10162912..10163217
FT                   /codon_start=1
FT                   /locus_tag="mCG_145296"
FT                   /product="mCG145296"
FT                   /note="gene_id=mCG145296.0 transcript_id=mCT184720.0
FT                   protein_id=mCP105376.0"
FT                   /protein_id="EDL18935.1"
FT   assembly_gap    10175962..10176011
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    10251448..10251467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <10265649..10307303
FT                   /gene="Spata7"
FT                   /locus_tag="mCG_22428"
FT                   /note="gene_id=mCG22428.2"
FT   mRNA            join(<10265649..10265826,10269455..10269529,
FT                   10271716..10271811,10275058..10275105,10285840..10285973,
FT                   10295704..10296137,10297041..10297107,10299463..10299578,
FT                   10300656..10300709,10301719..10301796,10306315..10306372,
FT                   10306585..10307293)
FT                   /gene="Spata7"
FT                   /locus_tag="mCG_22428"
FT                   /product="spermatogenesis associated 7, transcript variant
FT                   mCT191274"
FT                   /note="gene_id=mCG22428.2 transcript_id=mCT191274.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(10265655..10265826,10269506..10269529,
FT                   10271716..10271811,10275058..10275105,10285840..10285973,
FT                   10295704..10296137,10297041..10297107,10299463..10299578,
FT                   10300656..10300709,10301719..10301796,10306315..10306372,
FT                   10306585..10307303)
FT                   /gene="Spata7"
FT                   /locus_tag="mCG_22428"
FT                   /product="spermatogenesis associated 7, transcript variant
FT                   mCT22113"
FT                   /note="gene_id=mCG22428.2 transcript_id=mCT22113.2 created
FT                   on 23-JAN-2003"
FT   CDS             join(<10265691..10265826,10269455..10269529,
FT                   10271716..10271811,10275058..10275105,10285840..10285973,
FT                   10295704..10296137,10297041..10297107,10299463..10299578,
FT                   10300656..10300709,10301719..10301796,10306315..10306372,
FT                   10306585..10307154)
FT                   /codon_start=1
FT                   /gene="Spata7"
FT                   /locus_tag="mCG_22428"
FT                   /product="spermatogenesis associated 7, isoform CRA_a"
FT                   /note="gene_id=mCG22428.2 transcript_id=mCT191274.0
FT                   protein_id=mCP112237.0 isoform=CRA_a"
FT                   /protein_id="EDL18930.1"
FT   CDS             join(10265808..10265826,10269506..10269529,
FT                   10271716..10271811,10275058..10275105,10285840..10285973,
FT                   10295704..10296137,10297041..10297107,10299463..10299578,
FT                   10300656..10300709,10301719..10301796,10306315..10306372,
FT                   10306585..10307154)
FT                   /codon_start=1
FT                   /gene="Spata7"
FT                   /locus_tag="mCG_22428"
FT                   /product="spermatogenesis associated 7, isoform CRA_b"
FT                   /note="gene_id=mCG22428.2 transcript_id=mCT22113.2
FT                   protein_id=mCP7105.2 isoform=CRA_b"
FT                   /protein_id="EDL18931.1"
FT   assembly_gap    10309380..10309895
FT                   /estimated_length=516
FT                   /gap_type="unknown"
FT   gene            complement(10314419..10375484)
FT                   /gene="Ptpn21"
FT                   /locus_tag="mCG_22432"
FT                   /note="gene_id=mCG22432.3"
FT   mRNA            complement(join(10314419..10316368,10316967..10317127,
FT                   10317648..10317882,10318052..10318180,10320210..10320431,
FT                   10321169..10321306,10326093..10327531,10330775..10330859,
FT                   10331460..10331520,10336734..10336813,10337964..10338051,
FT                   10342147..10342235,10343098..10343185,10346727..10346797,
FT                   10347458..10347525,10348722..10348819,10352946..10353115,
FT                   10371578..10371938,10375444..10375484))
FT                   /gene="Ptpn21"
FT                   /locus_tag="mCG_22432"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   21, transcript variant mCT191228"
FT                   /note="gene_id=mCG22432.3 transcript_id=mCT191228.1 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(10314419..10316368,10316967..10317127,
FT                   10317648..10317882,10318052..10318180,10320210..10320431,
FT                   10321169..10321306,10326093..10327531,10330775..10330859,
FT                   10331460..10331520,10336734..10336813,10337964..10338051,
FT                   10342147..10342235,10343098..10343185,10346727..10346797,
FT                   10347458..10347525,10348722..10348819,10352946..10353115,
FT                   10371578..10371938,10373112..10373417))
FT                   /gene="Ptpn21"
FT                   /locus_tag="mCG_22432"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   21, transcript variant mCT191229"
FT                   /note="gene_id=mCG22432.3 transcript_id=mCT191229.1 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(10314419..10316368,10316967..10317127,
FT                   10317648..10317882,10318052..10318180,10320210..10320431,
FT                   10321169..10321306,10326093..10327531,10330775..10330859,
FT                   10331460..10331520,10336734..10336813,10337964..10338051,
FT                   10342147..10342235,10343098..10343185,10346727..10346797,
FT                   10347458..10347525,10348722..10348819,10352946..10353115,
FT                   10371578..10371938,10372549..10372728))
FT                   /gene="Ptpn21"
FT                   /locus_tag="mCG_22432"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   21, transcript variant mCT22117"
FT                   /note="gene_id=mCG22432.3 transcript_id=mCT22117.2 created
FT                   on 09-MAR-2004"
FT   assembly_gap    10314959..10314978
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             complement(join(10316240..10316368,10316967..10317127,
FT                   10317648..10317882,10318052..10318180,10320210..10320431,
FT                   10321169..10321306,10326093..10327531,10330775..10330859,
FT                   10331460..10331520,10336734..10336813,10337964..10338051,
FT                   10342147..10342235,10343098..10343185,10346727..10346797,
FT                   10347458..10347525,10348722..10348819,10352946..10353115,
FT                   10371578..10371757))
FT                   /codon_start=1
FT                   /gene="Ptpn21"
FT                   /locus_tag="mCG_22432"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   21, isoform CRA_a"
FT                   /note="gene_id=mCG22432.3 transcript_id=mCT191228.1
FT                   protein_id=mCP112183.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:G5E8J4"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR014392"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1344406"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8J4"
FT                   /protein_id="EDL18927.1"
FT                   IQFLKSSRLI"
FT   CDS             complement(join(10316240..10316368,10316967..10317127,
FT                   10317648..10317882,10318052..10318180,10320210..10320431,
FT                   10321169..10321306,10326093..10327531,10330775..10330859,
FT                   10331460..10331520,10336734..10336813,10337964..10338051,
FT                   10342147..10342235,10343098..10343185,10346727..10346797,
FT                   10347458..10347525,10348722..10348819,10352946..10353115,
FT                   10371578..10371757))
FT                   /codon_start=1
FT                   /gene="Ptpn21"
FT                   /locus_tag="mCG_22432"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   21, isoform CRA_a"
FT                   /note="gene_id=mCG22432.3 transcript_id=mCT191229.1
FT                   protein_id=mCP112184.1 isoform=CRA_a partial"
FT                   /db_xref="GOA:G5E8J4"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR014392"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1344406"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8J4"
FT                   /protein_id="EDL18928.1"
FT                   IQFLKSSRLI"
FT   CDS             complement(join(10316240..10316368,10316967..10317127,
FT                   10317648..10317882,10318052..10318180,10320210..10320431,
FT                   10321169..10321306,10326093..10327531,10330775..10330859,
FT                   10331460..10331520,10336734..10336813,10337964..10338051,
FT                   10342147..10342235,10343098..10343185,10346727..10346797,
FT                   10347458..10347525,10348722..10348819,10352946..10353115,
FT                   10371578..10371757))
FT                   /codon_start=1
FT                   /gene="Ptpn21"
FT                   /locus_tag="mCG_22432"
FT                   /product="protein tyrosine phosphatase, non-receptor type
FT                   21, isoform CRA_a"
FT                   /note="gene_id=mCG22432.3 transcript_id=mCT22117.2
FT                   protein_id=mCP7102.3 isoform=CRA_a partial"
FT                   /db_xref="GOA:G5E8J4"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000299"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR014352"
FT                   /db_xref="InterPro:IPR014392"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR018979"
FT                   /db_xref="InterPro:IPR018980"
FT                   /db_xref="InterPro:IPR019747"
FT                   /db_xref="InterPro:IPR019748"
FT                   /db_xref="InterPro:IPR019749"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1344406"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8J4"
FT                   /protein_id="EDL18929.1"
FT                   IQFLKSSRLI"
FT   assembly_gap    10321918..10322422
FT                   /estimated_length=505
FT                   /gap_type="unknown"
FT   assembly_gap    10336966..10337171
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    10344197..10344581
FT                   /estimated_length=385
FT                   /gap_type="unknown"
FT   assembly_gap    10346439..10346460
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    10367619..10367777
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    10372052..10372071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10377763..10378071
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   gene            <10385161..>10426193
FT                   /gene="Zc3h14"
FT                   /locus_tag="mCG_122284"
FT                   /note="gene_id=mCG122284.1"
FT   mRNA            join(<10385161..10385353,10395256..10395451,
FT                   10396759..10397188,10397966..10398126,10398557..10398657,
FT                   10402070..10402225,10421828..10421948,10423163..10423299,
FT                   10423577..10423653,10423882..10423988,10424822..10425072)
FT                   /gene="Zc3h14"
FT                   /locus_tag="mCG_122284"
FT                   /product="zinc finger CCCH type containing 14, transcript
FT                   variant mCT191244"
FT                   /note="gene_id=mCG122284.1 transcript_id=mCT191244.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<10385161..10385353,10395256..10395451,
FT                   10396759..10397188,10397966..10398126,10398557..10398657,
FT                   10402070..10402225,10421828..10421948,10423163..10423299,
FT                   10423577..10423653,10423882..10423988,10424822..10424828)
FT                   /codon_start=1
FT                   /gene="Zc3h14"
FT                   /locus_tag="mCG_122284"
FT                   /product="zinc finger CCCH type containing 14, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG122284.1 transcript_id=mCT191244.0
FT                   protein_id=mCP112202.0 isoform=CRA_b"
FT                   /protein_id="EDL18925.1"
FT   mRNA            join(10385162..10385417,10391025..10391139,
FT                   10394432..10394472,10395256..10395451,10396759..10397188,
FT                   10397966..10398126,10398557..10398657,10402070..10402225,
FT                   10417354..10417513,10418294..10418526,10421828..10421948,
FT                   10423163..10423299,10426123..>10426193)
FT                   /gene="Zc3h14"
FT                   /locus_tag="mCG_122284"
FT                   /product="zinc finger CCCH type containing 14, transcript
FT                   variant mCT123501"
FT                   /note="gene_id=mCG122284.1 transcript_id=mCT123501.0
FT                   created on 23-JAN-2003"
FT   mRNA            join(<10385182..10385353,10391025..10391139,
FT                   10394432..10394472,10395256..10395451,10396759..10397188,
FT                   10397966..10398126,10398557..10398657,10402070..10402225,
FT                   10412492..10412566,10417354..10417513,10418294..10418526,
FT                   10421828..10421948,10423163..10423299,10423565..10423653,
FT                   10423882..10423988,10424822..10425994)
FT                   /gene="Zc3h14"
FT                   /locus_tag="mCG_122284"
FT                   /product="zinc finger CCCH type containing 14, transcript
FT                   variant mCT191245"
FT                   /note="gene_id=mCG122284.1 transcript_id=mCT191245.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<10385182..10385353,10391025..10391139,
FT                   10394432..10394472,10395256..10395451,10396759..10397188,
FT                   10397966..10398126,10398557..10398657,10402070..10402225,
FT                   10412492..10412566,10417354..10417513,10418294..10418526,
FT                   10421828..10421948,10423163..10423299,10423565..10423653,
FT                   10423882..10423988,10424822..10424828)
FT                   /codon_start=1
FT                   /gene="Zc3h14"
FT                   /locus_tag="mCG_122284"
FT                   /product="zinc finger CCCH type containing 14, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG122284.1 transcript_id=mCT191245.0
FT                   protein_id=mCP112203.0 isoform=CRA_c"
FT                   /protein_id="EDL18926.1"
FT                   RHALKWIRPQSSE"
FT   CDS             join(10385318..10385417,10391025..10391139,
FT                   10394432..10394472,10395256..10395451,10396759..10397188,
FT                   10397966..10398126,10398557..10398657,10402070..10402225,
FT                   10417354..10417513,10418294..10418526,10421828..10421948,
FT                   10423163..10423299,10426123..>10426193)
FT                   /codon_start=1
FT                   /gene="Zc3h14"
FT                   /locus_tag="mCG_122284"
FT                   /product="zinc finger CCCH type containing 14, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG122284.1 transcript_id=mCT123501.0
FT                   protein_id=mCP50409.1 isoform=CRA_a"
FT                   /protein_id="EDL18924.1"
FT   assembly_gap    10385578..10385767
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   gene            complement(<10428859..10475666)
FT                   /locus_tag="mCG_122281"
FT                   /note="gene_id=mCG122281.1"
FT   mRNA            complement(join(<10428859..10428959,10429550..10429703,
FT                   10430297..10430400,10430789..10430951,10432387..10432559,
FT                   10432704..10432892,10439399..10439607,10440780..10440953,
FT                   10463661..10463862,10466989..10467077,10469142..10469273,
FT                   10469354..10469506,10475525..10475666))
FT                   /locus_tag="mCG_122281"
FT                   /product="mCG122281"
FT                   /note="gene_id=mCG122281.1 transcript_id=mCT123498.1
FT                   created on 23-JAN-2003"
FT   CDS             complement(join(<10428859..10428959,10429550..10429703,
FT                   10430297..10430400,10430789..10430951,10432387..10432559,
FT                   10432704..10432892,10439399..10439607,10440780..10440953,
FT                   10463661..10463862,10466989..10467077,10469142..10469273,
FT                   10469354..10469506,10475525..10475660))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122281"
FT                   /product="mCG122281"
FT                   /note="gene_id=mCG122281.1 transcript_id=mCT123498.1
FT                   protein_id=mCP50383.1"
FT                   /protein_id="EDL18923.1"
FT   assembly_gap    10429468..10429487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10437898..10437917
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<10479899..10539745)
FT                   /locus_tag="mCG_122287"
FT                   /note="gene_id=mCG122287.1"
FT   mRNA            complement(join(<10479899..10479960,10480954..10481065,
FT                   10482237..10482439,10489665..10489765,10490891..10490984,
FT                   10494207..10494312,10497002..10497188,10498242..10498360,
FT                   10498743..10498849,10499428..10499595,10501380..10501592,
FT                   10503537..10503793,10509071..10509208,10511308..10511509,
FT                   10512811..10512946,10514431..10514616,10519093..10519161,
FT                   10520258..10520356,10525264..10525423,10539114..10539745))
FT                   /locus_tag="mCG_122287"
FT                   /product="mCG122287"
FT                   /note="gene_id=mCG122287.1 transcript_id=mCT123504.1
FT                   created on 21-FEB-2003"
FT   CDS             complement(join(<10479899..10479960,10480954..10481065,
FT                   10482237..10482439,10489665..10489765,10490891..10490984,
FT                   10494207..10494312,10497002..10497188,10498242..10498360,
FT                   10498743..10498849,10499428..10499595,10501380..10501592,
FT                   10503537..10503793,10509071..10509208,10511308..10511509,
FT                   10512811..10512946,10514431..10514616,10519093..10519161,
FT                   10520258..10520356,10525264..10525423,10539114..10539310))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122287"
FT                   /product="mCG122287"
FT                   /note="gene_id=mCG122287.1 transcript_id=mCT123504.1
FT                   protein_id=mCP50473.1"
FT                   /protein_id="EDL18922.1"
FT   assembly_gap    10481631..10481650
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10505553..10505635
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    10516171..10516190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10539746..10539834
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    10540126..10540336
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    10555470..10555489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10558802..10622724
FT                   /gene="Ttc8"
FT                   /locus_tag="mCG_22434"
FT                   /note="gene_id=mCG22434.1"
FT   mRNA            join(10558802..10559010,10580966..10581086,
FT                   10582051..10582114,10582210..10582369,10585316..10585360,
FT                   10595915..10596036,10600072..10600159,10603113..10603223,
FT                   10613242..10613381,10615274..10615448,10615724..10615846,
FT                   10621755..10622265,10622454..10622724)
FT                   /gene="Ttc8"
FT                   /locus_tag="mCG_22434"
FT                   /product="tetratricopeptide repeat domain 8"
FT                   /note="gene_id=mCG22434.1 transcript_id=mCT22119.1 created
FT                   on 06-MAR-2003"
FT   CDS             join(10558897..10559010,10580966..10581086,
FT                   10582051..10582114,10582210..10582369,10585316..10585360,
FT                   10595915..10596036,10600072..10600159,10603113..10603223,
FT                   10613242..10613381,10615274..10615448,10615724..10615846,
FT                   10621755..10621871)
FT                   /codon_start=1
FT                   /gene="Ttc8"
FT                   /locus_tag="mCG_22434"
FT                   /product="tetratricopeptide repeat domain 8"
FT                   /note="gene_id=mCG22434.1 transcript_id=mCT22119.1
FT                   protein_id=mCP7117.2"
FT                   /protein_id="EDL18921.1"
FT                   L"
FT   assembly_gap    10561611..10565583
FT                   /estimated_length=3973
FT                   /gap_type="unknown"
FT   assembly_gap    10574701..10574720
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10590333..10590394
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    10601521..10601604
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    10614322..10614341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10632583..10632664
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            10686710..10687177
FT                   /locus_tag="mCG_22431"
FT                   /note="gene_id=mCG22431.0"
FT   mRNA            10686710..10687177
FT                   /locus_tag="mCG_22431"
FT                   /product="mCG22431"
FT                   /note="gene_id=mCG22431.0 transcript_id=mCT22116.0 created
FT                   on 23-JAN-2003"
FT   CDS             10686780..10687127
FT                   /codon_start=1
FT                   /locus_tag="mCG_22431"
FT                   /product="mCG22431"
FT                   /note="gene_id=mCG22431.0 transcript_id=mCT22116.0
FT                   protein_id=mCP7100.1"
FT                   /db_xref="GOA:Q58DZ3"
FT                   /db_xref="InterPro:IPR000231"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR022991"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="MGI:MGI:98037"
FT                   /db_xref="UniProtKB/TrEMBL:Q58DZ3"
FT                   /protein_id="EDL18920.1"
FT                   IRSMPEQTGEK"
FT   assembly_gap    10722448..10722467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10745942..10746025
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   assembly_gap    10772661..10772961
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    10774516..10774535
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10787701..10789232)
FT                   /locus_tag="mCG_1048049"
FT                   /note="gene_id=mCG1048049.1"
FT   mRNA            complement(join(10787701..10788610,10788967..10789232))
FT                   /locus_tag="mCG_1048049"
FT                   /product="mCG1048049"
FT                   /note="gene_id=mCG1048049.1 transcript_id=mCT165753.1
FT                   created on 05-FEB-2003"
FT   CDS             complement(10789000..10789167)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048049"
FT                   /product="mCG1048049"
FT                   /note="gene_id=mCG1048049.1 transcript_id=mCT165753.1
FT                   protein_id=mCP50335.1"
FT                   /protein_id="EDL18919.1"
FT                   PCLPLAWGSI"
FT   assembly_gap    10799665..10799684
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10802754..10802773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10815456..10815726
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   gene            complement(10820452..11197516)
FT                   /gene="Ches1"
FT                   /locus_tag="mCG_22425"
FT                   /note="gene_id=mCG22425.2"
FT   mRNA            complement(join(10820452..10823155,10835793..10835898,
FT                   10921350..10921414,10971916..10972028,11018943..11019503,
FT                   11080356..11080440,11197407..11197516))
FT                   /gene="Ches1"
FT                   /locus_tag="mCG_22425"
FT                   /product="checkpoint suppressor 1"
FT                   /note="gene_id=mCG22425.2 transcript_id=mCT22112.3 created
FT                   on 09-APR-2003"
FT   CDS             complement(join(10822609..10823155,10835793..10835898,
FT                   10921350..10921414,10971916..10972028,11018943..11019485))
FT                   /codon_start=1
FT                   /gene="Ches1"
FT                   /locus_tag="mCG_22425"
FT                   /product="checkpoint suppressor 1"
FT                   /note="gene_id=mCG22425.2 transcript_id=mCT22112.3
FT                   protein_id=mCP7090.1"
FT                   /protein_id="EDL18916.1"
FT   assembly_gap    10854798..10855000
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    10870600..10870619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10881509..10881528
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10883323..10883342
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10884560..10884579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10885856..10885875
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10912746..10912768
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            complement(10922721..>10926733)
FT                   /locus_tag="mCG_146210"
FT                   /note="gene_id=mCG146210.0"
FT   mRNA            complement(join(10922721..10926036,10926505..10926557,
FT                   10926583..>10926733))
FT                   /locus_tag="mCG_146210"
FT                   /product="mCG146210"
FT                   /note="gene_id=mCG146210.0 transcript_id=mCT186313.0
FT                   created on 14-JUL-2003"
FT   CDS             complement(join(10925726..10926036,10926505..>10926532))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146210"
FT                   /product="mCG146210"
FT                   /note="gene_id=mCG146210.0 transcript_id=mCT186313.0
FT                   protein_id=mCP107385.0"
FT                   /protein_id="EDL18918.1"
FT                   DSQFHNLR"
FT   assembly_gap    10944316..10944335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10954809..10954930
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   assembly_gap    10962157..10962176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10970942..10971103
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   gene            <10976891..10992318
FT                   /locus_tag="mCG_146213"
FT                   /note="gene_id=mCG146213.0"
FT   mRNA            join(<10976891..10976951,10977577..10977824,
FT                   10991842..10991988,10992120..10992318)
FT                   /locus_tag="mCG_146213"
FT                   /product="mCG146213"
FT                   /note="gene_id=mCG146213.0 transcript_id=mCT186316.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<10976891..10976951,10977577..10977824,
FT                   10991842..10991988,10992120..10992185)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146213"
FT                   /product="mCG146213"
FT                   /note="gene_id=mCG146213.0 transcript_id=mCT186316.0
FT                   protein_id=mCP107384.0"
FT                   /protein_id="EDL18917.1"
FT                   SLAAWEESWD"
FT   assembly_gap    10992502..10992609
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    11004147..11004166
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11011518..11011537
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11023325..11023439
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    11035148..11035279
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    11058303..11058413
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    11080815..11080834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11116763..11116782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11119756..11119775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11121641..11121947
FT                   /estimated_length=307
FT                   /gap_type="unknown"
FT   assembly_gap    11124052..11124548
FT                   /estimated_length=497
FT                   /gap_type="unknown"
FT   assembly_gap    11125577..11126421
FT                   /estimated_length=845
FT                   /gap_type="unknown"
FT   assembly_gap    11127555..11127962
FT                   /estimated_length=408
FT                   /gap_type="unknown"
FT   assembly_gap    11131352..11131495
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    11175881..11175950
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    11197570..11198733
FT                   /estimated_length=1164
FT                   /gap_type="unknown"
FT   assembly_gap    11218466..11218535
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    11224943..11225373
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   gene            complement(11259602..11261505)
FT                   /locus_tag="mCG_147630"
FT                   /note="gene_id=mCG147630.0"
FT   mRNA            complement(join(11259602..11259858,11261136..11261505))
FT                   /locus_tag="mCG_147630"
FT                   /product="mCG147630"
FT                   /note="gene_id=mCG147630.0 transcript_id=mCT187893.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11261218..11261403)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147630"
FT                   /product="mCG147630"
FT                   /note="gene_id=mCG147630.0 transcript_id=mCT187893.0
FT                   protein_id=mCP109005.0"
FT                   /protein_id="EDL18915.1"
FT                   GRNVRARSLTRTHQRP"
FT   assembly_gap    11270220..11270239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11275568..11275655
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            11276636..11280765
FT                   /locus_tag="mCG_1048004"
FT                   /note="gene_id=mCG1048004.1"
FT   mRNA            join(11276636..11276887,11279689..11280765)
FT                   /locus_tag="mCG_1048004"
FT                   /product="mCG1048004"
FT                   /note="gene_id=mCG1048004.1 transcript_id=mCT165708.1
FT                   created on 19-FEB-2003"
FT   CDS             11279926..11280099
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048004"
FT                   /product="mCG1048004"
FT                   /note="gene_id=mCG1048004.1 transcript_id=mCT165708.1
FT                   protein_id=mCP50479.1"
FT                   /protein_id="EDL18914.1"
FT                   VSPLRSQCHLEV"
FT   assembly_gap    11281104..11281269
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    11287051..11288911
FT                   /estimated_length=1861
FT                   /gap_type="unknown"
FT   assembly_gap    11295866..11295885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11306088..11306271
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   gene            complement(11328497..11519446)
FT                   /gene="2610021K21Rik"
FT                   /locus_tag="mCG_1048003"
FT                   /note="gene_id=mCG1048003.1"
FT   mRNA            complement(join(11328497..11328654,11489759..11489849,
FT                   11490687..11490788,11513408..11513453,11517812..11517907,
FT                   11519250..11519445))
FT                   /gene="2610021K21Rik"
FT                   /locus_tag="mCG_1048003"
FT                   /product="RIKEN cDNA 2610021K21, transcript variant
FT                   mCT182066"
FT                   /note="gene_id=mCG1048003.1 transcript_id=mCT182066.0
FT                   created on 22-MAY-2003"
FT   CDS             complement(join(11328642..11328654,11489759..11489849,
FT                   11490687..11490788,11513408..11513453,11517812..11517838))
FT                   /codon_start=1
FT                   /gene="2610021K21Rik"
FT                   /locus_tag="mCG_1048003"
FT                   /product="RIKEN cDNA 2610021K21, isoform CRA_a"
FT                   /note="gene_id=mCG1048003.1 transcript_id=mCT182066.0
FT                   protein_id=mCP104988.0 isoform=CRA_a"
FT                   /protein_id="EDL18911.1"
FT   assembly_gap    11340718..11341186
FT                   /estimated_length=469
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11352938..11354510,11489759..11489849,
FT                   11490687..11490788,11513408..11513453,11517812..11517907,
FT                   11518332..11518568,11519341..11519431))
FT                   /gene="2610021K21Rik"
FT                   /locus_tag="mCG_1048003"
FT                   /product="RIKEN cDNA 2610021K21, transcript variant
FT                   mCT165707"
FT                   /note="gene_id=mCG1048003.1 transcript_id=mCT165707.1
FT                   created on 22-MAY-2003"
FT   CDS             complement(join(11354432..11354510,11489759..11489849,
FT                   11490687..11490788,11513408..11513453,11517812..11517907,
FT                   11518332..11518406))
FT                   /codon_start=1
FT                   /gene="2610021K21Rik"
FT                   /locus_tag="mCG_1048003"
FT                   /product="RIKEN cDNA 2610021K21, isoform CRA_b"
FT                   /note="gene_id=mCG1048003.1 transcript_id=mCT165707.1
FT                   protein_id=mCP50469.1 isoform=CRA_b"
FT                   /protein_id="EDL18912.1"
FT   assembly_gap    11355790..11355809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11395133..11395522
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    11396895..11397072
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    11475177..11475196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11475548..11475567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11504140..11504365
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   mRNA            complement(join(11511394..11511778,11513408..11513453,
FT                   11517812..11517907,11518332..11518568,11519341..11519446))
FT                   /gene="2610021K21Rik"
FT                   /locus_tag="mCG_1048003"
FT                   /product="RIKEN cDNA 2610021K21, transcript variant
FT                   mCT19847"
FT                   /note="gene_id=mCG1048003.1 transcript_id=mCT19847.2
FT                   created on 22-MAY-2003"
FT   CDS             complement(join(11511702..11511778,11513408..11513453,
FT                   11517812..11517907,11518332..11518406))
FT                   /codon_start=1
FT                   /gene="2610021K21Rik"
FT                   /locus_tag="mCG_1048003"
FT                   /product="RIKEN cDNA 2610021K21, isoform CRA_c"
FT                   /note="gene_id=mCG1048003.1 transcript_id=mCT19847.2
FT                   protein_id=mCP7091.2 isoform=CRA_c"
FT                   /protein_id="EDL18913.1"
FT   gene            11519566..11594045
FT                   /gene="Tdp1"
FT                   /locus_tag="mCG_14730"
FT                   /note="gene_id=mCG14730.2"
FT   mRNA            join(11519566..11519602,11529812..11530380,
FT                   11532264..11532307,11533356..11533411,11536909..11537005,
FT                   11540984..11541018,11544672..11544764,11548315..11548482,
FT                   11548919..11548997,11550231..11550416,11550911..11550959,
FT                   11552687..11552753,11554090..11554197,11573834..11573936,
FT                   11584034..11584142,11593786..11594045)
FT                   /gene="Tdp1"
FT                   /locus_tag="mCG_14730"
FT                   /product="tyrosyl-DNA phosphodiesterase 1, transcript
FT                   variant mCT19844"
FT                   /note="gene_id=mCG14730.2 transcript_id=mCT19844.2 created
FT                   on 22-MAY-2003"
FT   mRNA            join(11519575..11519602,11529812..11530380,
FT                   11532264..11532307,11533356..11533411,11536909..11537005,
FT                   11540984..11541018,11544672..11544764,11548315..11548482,
FT                   11548919..11548997,11550231..11550416,11550911..11550959,
FT                   11552687..11552753,11554090..11554197,11567795..11567823,
FT                   11573834..11573936,11584034..11584142,11593786..11593988)
FT                   /gene="Tdp1"
FT                   /locus_tag="mCG_14730"
FT                   /product="tyrosyl-DNA phosphodiesterase 1, transcript
FT                   variant mCT53860"
FT                   /note="gene_id=mCG14730.2 transcript_id=mCT53860.2 created
FT                   on 22-MAY-2003"
FT   gene            11519668..11520196
FT                   /locus_tag="mCG_147614"
FT                   /note="gene_id=mCG147614.0"
FT   mRNA            11519668..11520196
FT                   /locus_tag="mCG_147614"
FT                   /product="mCG147614"
FT                   /note="gene_id=mCG147614.0 transcript_id=mCT187877.0
FT                   created on 13-JAN-2004"
FT   CDS             11519695..11520114
FT                   /codon_start=1
FT                   /locus_tag="mCG_147614"
FT                   /product="mCG147614"
FT                   /note="gene_id=mCG147614.0 transcript_id=mCT187877.0
FT                   protein_id=mCP108988.0"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C5A5"
FT                   /protein_id="EDL18910.1"
FT   assembly_gap    11521186..11521205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11522905..11522924
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11525313..11525934
FT                   /estimated_length=622
FT                   /gap_type="unknown"
FT   assembly_gap    11528048..11528067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(11529808..11530380,11532264..11532307,
FT                   11533356..11533411,11536909..11537005,11540984..11541018,
FT                   11544672..11544764,11548315..11548482,11548919..11548997,
FT                   11550231..11550416,11550911..11550959,11552687..11552753,
FT                   11554090..11554197,11573834..11576191)
FT                   /gene="Tdp1"
FT                   /locus_tag="mCG_14730"
FT                   /product="tyrosyl-DNA phosphodiesterase 1, transcript
FT                   variant mCT182162"
FT                   /note="gene_id=mCG14730.2 transcript_id=mCT182162.0 created
FT                   on 22-MAY-2003"
FT   CDS             join(11529819..11530380,11532264..11532307,
FT                   11533356..11533411,11536909..11537005,11540984..11541018,
FT                   11544672..11544764,11548315..11548482,11548919..11548997,
FT                   11550231..11550416,11550911..11550959,11552687..11552753,
FT                   11554090..11554197,11573834..11573936,11584034..11584142,
FT                   11593786..11593859)
FT                   /codon_start=1
FT                   /gene="Tdp1"
FT                   /locus_tag="mCG_14730"
FT                   /product="tyrosyl-DNA phosphodiesterase 1, isoform CRA_b"
FT                   /note="gene_id=mCG14730.2 transcript_id=mCT19844.2
FT                   protein_id=mCP7065.2 isoform=CRA_b"
FT                   /db_xref="GOA:B8JJC1"
FT                   /db_xref="InterPro:IPR010347"
FT                   /db_xref="InterPro:IPR027415"
FT                   /db_xref="MGI:MGI:1920036"
FT                   /db_xref="UniProtKB/TrEMBL:B8JJC1"
FT                   /protein_id="EDL18908.1"
FT   CDS             join(11529819..11530380,11532264..11532307,
FT                   11533356..11533411,11536909..11537005,11540984..11541018,
FT                   11544672..11544764,11548315..11548482,11548919..11548997,
FT                   11550231..11550416,11550911..11550959,11552687..11552753,
FT                   11554090..11554197,11573834..11574029)
FT                   /codon_start=1
FT                   /gene="Tdp1"
FT                   /locus_tag="mCG_14730"
FT                   /product="tyrosyl-DNA phosphodiesterase 1, isoform CRA_a"
FT                   /note="gene_id=mCG14730.2 transcript_id=mCT182162.0
FT                   protein_id=mCP105082.0 isoform=CRA_a"
FT                   /protein_id="EDL18907.1"
FT                   LAW"
FT   CDS             join(11529819..11530380,11532264..11532307,
FT                   11533356..11533411,11536909..11537005,11540984..11541018,
FT                   11544672..11544764,11548315..11548482,11548919..11548997,
FT                   11550231..11550416,11550911..11550959,11552687..11552753,
FT                   11554090..11554197,11567795..11567823,11573834..11573889)
FT                   /codon_start=1
FT                   /gene="Tdp1"
FT                   /locus_tag="mCG_14730"
FT                   /product="tyrosyl-DNA phosphodiesterase 1, isoform CRA_c"
FT                   /note="gene_id=mCG14730.2 transcript_id=mCT53860.2
FT                   protein_id=mCP29641.2 isoform=CRA_c"
FT                   /protein_id="EDL18909.1"
FT   assembly_gap    11556250..11556295
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    11558994..11559292
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    11592083..11592252
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    11593638..11593657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11604516..11701843
FT                   /gene="Kcnk13"
FT                   /locus_tag="mCG_14732"
FT                   /note="gene_id=mCG14732.1"
FT   mRNA            join(11604516..11605109,11700170..11701843)
FT                   /gene="Kcnk13"
FT                   /locus_tag="mCG_14732"
FT                   /product="potassium channel, subfamily K, member 13"
FT                   /note="gene_id=mCG14732.1 transcript_id=mCT19846.1 created
FT                   on 20-JAN-2003"
FT   CDS             join(11604776..11605109,11700170..11701053)
FT                   /codon_start=1
FT                   /gene="Kcnk13"
FT                   /locus_tag="mCG_14732"
FT                   /product="potassium channel, subfamily K, member 13"
FT                   /note="gene_id=mCG14732.1 transcript_id=mCT19846.1
FT                   protein_id=mCP7081.2"
FT                   /db_xref="GOA:Q3TYG8"
FT                   /db_xref="InterPro:IPR003280"
FT                   /db_xref="InterPro:IPR005410"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="MGI:MGI:2384976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TYG8"
FT                   /protein_id="EDL18906.1"
FT                   ETSGDR"
FT   assembly_gap    11610778..11610797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11642610..11642778
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    11662369..11662440
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    11667103..11667199
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    11669997..11670087
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    11685855..11686148
FT                   /estimated_length=294
FT                   /gap_type="unknown"
FT   assembly_gap    11705273..11705292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11713531..11713778
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   gene            complement(11716053..11736372)
FT                   /locus_tag="mCG_147619"
FT                   /note="gene_id=mCG147619.0"
FT   mRNA            complement(join(11716053..11716669,11736182..11736372))
FT                   /locus_tag="mCG_147619"
FT                   /product="mCG147619"
FT                   /note="gene_id=mCG147619.0 transcript_id=mCT187882.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(11716435..11716632)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147619"
FT                   /product="mCG147619"
FT                   /note="gene_id=mCG147619.0 transcript_id=mCT187882.0
FT                   protein_id=mCP108995.0"
FT                   /protein_id="EDL18905.1"
FT   assembly_gap    11738102..11738272
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    11746871..11747034
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   gene            11749315..11762544
FT                   /locus_tag="mCG_122657"
FT                   /note="gene_id=mCG122657.1"
FT   mRNA            join(11749315..11749355,11751475..11751528,
FT                   11752200..11752296,11754018..11754142,11754600..11754785,
FT                   11754967..11755095,11755879..11755975,11758253..11758442,
FT                   11759167..11759318,11760173..11760327,11762238..11762544)
FT                   /locus_tag="mCG_122657"
FT                   /product="mCG122657"
FT                   /note="gene_id=mCG122657.1 transcript_id=mCT123880.1
FT                   created on 21-JAN-2003"
FT   CDS             join(11749353..11749355,11751475..11751528,
FT                   11752200..11752296,11754018..11754142,11754600..11754785,
FT                   11754967..11755095,11755879..11755975,11758253..11758442,
FT                   11759167..11759318,11760173..11760327,11762238..11762372)
FT                   /codon_start=1
FT                   /locus_tag="mCG_122657"
FT                   /product="mCG122657"
FT                   /note="gene_id=mCG122657.1 transcript_id=mCT123880.1
FT                   protein_id=mCP50247.1"
FT                   /db_xref="GOA:Q542I9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035244"
FT                   /db_xref="MGI:MGI:106054"
FT                   /db_xref="UniProtKB/TrEMBL:Q542I9"
FT                   /protein_id="EDL18904.1"
FT   gene            complement(11764630..11798757)
FT                   /locus_tag="mCG_14727"
FT                   /note="gene_id=mCG14727.1"
FT   mRNA            complement(join(11764630..11764911,11765381..11765452,
FT                   11768473..11768611,11769495..11770420,11771288..11771674,
FT                   11771740..11771762,11773514..11773669,11776785..11776905,
FT                   11779132..11779265,11781020..11781425,11782866..11783316,
FT                   11784997..11785155,11788944..11789177,11790338..11790461,
FT                   11798664..11798757))
FT                   /locus_tag="mCG_14727"
FT                   /product="mCG14727"
FT                   /note="gene_id=mCG14727.1 transcript_id=mCT19789.2 created
FT                   on 24-JAN-2003"
FT   CDS             complement(join(11764786..11764911,11765381..11765452,
FT                   11768473..11768611,11769495..11770420,11771288..11771674,
FT                   11771740..11771762,11773514..11773669,11776785..11776905,
FT                   11779132..11779265,11781020..11781425,11782866..11783316,
FT                   11784997..11785155,11788944..11789177,11790338..11790461,
FT                   11798664..11798727))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14727"
FT                   /product="mCG14727"
FT                   /note="gene_id=mCG14727.1 transcript_id=mCT19789.2
FT                   protein_id=mCP7104.2"
FT                   /protein_id="EDL18903.1"
FT                   LELLLED"
FT   assembly_gap    11769145..11769187
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    11776508..11776527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11802953..11803207
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    11807458..11807540
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    11808532..11808743
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   gene            11838622..11846503
FT                   /gene="Calm1"
FT                   /locus_tag="mCG_14729"
FT                   /note="gene_id=mCG14729.1"
FT   mRNA            join(11838622..11838904,11841581..11841611,
FT                   11842763..11842906,11844801..11844907,11845286..11845421,
FT                   11845588..11846503)
FT                   /gene="Calm1"
FT                   /locus_tag="mCG_14729"
FT                   /product="calmodulin 1"
FT                   /note="gene_id=mCG14729.1 transcript_id=mCT19843.1 created
FT                   on 21-JAN-2003"
FT   CDS             join(11838902..11838904,11841581..11841611,
FT                   11842763..11842906,11844801..11844907,11845286..11845421,
FT                   11845588..11845616)
FT                   /codon_start=1
FT                   /gene="Calm1"
FT                   /locus_tag="mCG_14729"
FT                   /product="calmodulin 1"
FT                   /note="gene_id=mCG14729.1 transcript_id=mCT19843.1
FT                   protein_id=mCP7056.1"
FT                   /protein_id="EDL18902.1"
FT   gene            11848172..11848998
FT                   /locus_tag="mCG_147631"
FT                   /note="gene_id=mCG147631.0"
FT   mRNA            join(11848172..11848195,11848235..11848998)
FT                   /locus_tag="mCG_147631"
FT                   /product="mCG147631"
FT                   /note="gene_id=mCG147631.0 transcript_id=mCT187894.0
FT                   created on 13-JAN-2004"
FT   CDS             11848342..11848503
FT                   /codon_start=1
FT                   /locus_tag="mCG_147631"
FT                   /product="mCG147631"
FT                   /note="gene_id=mCG147631.0 transcript_id=mCT187894.0
FT                   protein_id=mCP109007.0"
FT                   /protein_id="EDL18901.1"
FT                   ASWELLLE"
FT   assembly_gap    11910314..11910333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <11929397..11936536
FT                   /locus_tag="mCG_145303"
FT                   /note="gene_id=mCG145303.0"
FT   mRNA            join(<11929397..11929557,11934772..11934873,
FT                   11936076..11936536)
FT                   /locus_tag="mCG_145303"
FT                   /product="mCG145303"
FT                   /note="gene_id=mCG145303.0 transcript_id=mCT184727.0
FT                   created on 05-JUN-2003"
FT   CDS             <11936275..11936517
FT                   /codon_start=1
FT                   /locus_tag="mCG_145303"
FT                   /product="mCG145303"
FT                   /note="gene_id=mCG145303.0 transcript_id=mCT184727.0
FT                   protein_id=mCP105383.0"
FT                   /protein_id="EDL18900.1"
FT   gene            complement(11939940..>12153983)
FT                   /locus_tag="mCG_145297"
FT                   /note="gene_id=mCG145297.0"
FT   mRNA            complement(join(11939940..11940913,11964707..11964909,
FT                   11971746..11971886,11987048..11987145,11993902..11994018,
FT                   12012480..12012640,12015112..12015184,12021136..12021193,
FT                   12023162..12023279,12024871..12024975,12026126..12026209,
FT                   12042353..12042490,12045995..12046058,12054131..12054303,
FT                   12058476..12058554,12085841..12085962,12098769..12098899,
FT                   12128059..12128227,12132865..12133019,12153855..>12153983))
FT                   /locus_tag="mCG_145297"
FT                   /product="mCG145297"
FT                   /note="gene_id=mCG145297.0 transcript_id=mCT184721.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(11940692..11940913,11964707..11964909,
FT                   11971746..11971886,11987048..11987145,11993902..11994018,
FT                   12012480..12012640,12015112..12015184,12021136..12021193,
FT                   12023162..12023279,12024871..12024975,12026126..12026209,
FT                   12042353..12042490,12045995..12046058,12054131..12054303,
FT                   12058476..12058554,12085841..12085962,12098769..12098899,
FT                   12128059..12128227,12132865..12133019,12153855..>12153981))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145297"
FT                   /product="mCG145297"
FT                   /note="gene_id=mCG145297.0 transcript_id=mCT184721.0
FT                   protein_id=mCP105377.0"
FT                   /protein_id="EDL18898.1"
FT   assembly_gap    11944199..11944218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11990758..11990777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12016522..12016753
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   gene            12098173..12120993
FT                   /locus_tag="mCG_122666"
FT                   /note="gene_id=mCG122666.0"
FT   mRNA            join(12098173..12098303,12115488..12115568,
FT                   12120576..12120993)
FT                   /locus_tag="mCG_122666"
FT                   /product="mCG122666"
FT                   /note="gene_id=mCG122666.0 transcript_id=mCT123889.0
FT                   created on 24-JAN-2003"
FT   CDS             12120613..12120804
FT                   /codon_start=1
FT                   /locus_tag="mCG_122666"
FT                   /product="mCG122666"
FT                   /note="gene_id=mCG122666.0 transcript_id=mCT123889.0
FT                   protein_id=mCP50523.1"
FT                   /protein_id="EDL18899.1"
FT                   TQRPGYEDAPDLGIMVRR"
FT   assembly_gap    12124150..12124800
FT                   /estimated_length=651
FT                   /gap_type="unknown"
FT   assembly_gap    12153984..12154011
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    12171074..12171093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(12181543..>12358934)
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /note="gene_id=mCG20609.3"
FT   mRNA            complement(join(12181543..12184783,12186103..12186266,
FT                   12187376..12187535,12191566..12191844,12203944..12204114,
FT                   12207551..12207644,12208243..12208376,12208755..12208880,
FT                   12210841..12211002,12214416..12214532,12231056..12231139,
FT                   12249019..12249126,12252548..12252663,12288114..12288332,
FT                   12312345..12312416,12358593..12358840))
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /product="ribosomal protein S6 kinase, polypeptide 5,
FT                   transcript variant mCT22030"
FT                   /note="gene_id=mCG20609.3 transcript_id=mCT22030.2 created
FT                   on 21-JAN-2003"
FT   mRNA            complement(join(12182879..12184783,12186103..12186266,
FT                   12187376..12187535,12191566..12191757,12203944..12204114,
FT                   12206918..12207112,12207551..12207644,12208243..12208376,
FT                   12208755..12208880,12210841..12211002,12214416..12214566,
FT                   12228981..12229084,12231056..12231139,12249019..12249126,
FT                   12252548..12252663,12288114..12288332,12312345..12312416,
FT                   12358593..>12358840))
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /product="ribosomal protein S6 kinase, polypeptide 5,
FT                   transcript variant mCT191265"
FT                   /note="gene_id=mCG20609.3 transcript_id=mCT191265.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(12182880..12184783,12186103..12186266,
FT                   12187376..12187535,12191566..12191757,12203944..12204114,
FT                   12207551..12207644,12208243..12208376,12208755..12208880,
FT                   12210841..12211002,12214416..12214566,12228981..12229084,
FT                   12231056..12231139,12249019..12249126,12252548..12252663,
FT                   12288114..12288332,12312345..12312416,12358593..>12358934))
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /product="ribosomal protein S6 kinase, polypeptide 5,
FT                   transcript variant mCT191266"
FT                   /note="gene_id=mCG20609.3 transcript_id=mCT191266.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(12184113..12184783,12186103..12186266,
FT                   12187376..12187535,12191566..12191757,12203944..12204114,
FT                   12207551..12207644,12208243..12208376,12208755..12208880,
FT                   12210841..12211002,12214416..12214566,12228981..12229084,
FT                   12231056..12231139,12249019..12249126,12288114..12288332,
FT                   12312345..12312416,12346600..>12346906))
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /product="ribosomal protein S6 kinase, polypeptide 5,
FT                   transcript variant mCT191267"
FT                   /note="gene_id=mCG20609.3 transcript_id=mCT191267.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(12184544..12184783,12186103..12186266,
FT                   12187376..12187535,12191566..12191757,12203944..12204114,
FT                   12207551..12207644,12208243..12208376,12208755..12208880,
FT                   12210841..12211002,12214416..12214566,12228981..12229084,
FT                   12231056..12231139,12249019..12249126,12252548..12252663,
FT                   12288114..12288332,12312345..12312416,12358593..>12358860))
FT                   /codon_start=1
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /product="ribosomal protein S6 kinase, polypeptide 5,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20609.3 transcript_id=mCT191266.0
FT                   protein_id=mCP112181.0 isoform=CRA_b"
FT                   /protein_id="EDL18895.1"
FT   CDS             complement(join(12184544..12184783,12186103..12186266,
FT                   12187376..12187535,12191566..12191757,12203944..12204114,
FT                   12206918..12207112,12207551..12207644,12208243..12208376,
FT                   12208755..12208880,12210841..12211002,12214416..12214566,
FT                   12228981..12229084,12231056..12231139,12249019..12249126,
FT                   12252548..12252663,12288114..12288332,12312345..12312416,
FT                   12358593..>12358839))
FT                   /codon_start=1
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /product="ribosomal protein S6 kinase, polypeptide 5,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20609.3 transcript_id=mCT191265.0
FT                   protein_id=mCP112180.0 isoform=CRA_a"
FT                   /protein_id="EDL18894.1"
FT   CDS             complement(join(12184544..12184783,12186103..12186266,
FT                   12187376..12187535,12191566..12191844,12203944..12204114,
FT                   12207551..12207644,12208243..12208376,12208755..12208880,
FT                   12210841..12211002,12214416..12214532,12231056..12231139,
FT                   12249019..12249126,12252548..12252663,12288114..12288332,
FT                   12312345..12312416,12358593..12358692))
FT                   /codon_start=1
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /product="ribosomal protein S6 kinase, polypeptide 5,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG20609.3 transcript_id=mCT22030.2
FT                   protein_id=mCP7078.2 isoform=CRA_d"
FT                   /protein_id="EDL18897.1"
FT   CDS             complement(join(12184544..12184783,12186103..12186266,
FT                   12187376..12187535,12191566..12191757,12203944..12204114,
FT                   12207551..12207644,12208243..12208376,12208755..12208880,
FT                   12210841..12211002,12214416..12214566,12228981..12229084,
FT                   12231056..12231139,12249019..>12249126))
FT                   /codon_start=1
FT                   /gene="Rps6ka5"
FT                   /locus_tag="mCG_20609"
FT                   /product="ribosomal protein S6 kinase, polypeptide 5,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG20609.3 transcript_id=mCT191267.0
FT                   protein_id=mCP112182.0 isoform=CRA_c"
FT                   /protein_id="EDL18896.1"
FT   assembly_gap    12200290..12200309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12217116..12217309
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    12218000..12218093
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    12233782..12234158
FT                   /estimated_length=377
FT                   /gap_type="unknown"
FT   assembly_gap    12278131..12278150
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12317463..12317482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12367388..12367567
FT                   /estimated_length=180
FT                   /gap_type="unknown"
FT   assembly_gap    12368222..12368685
FT                   /estimated_length=464
FT                   /gap_type="unknown"
FT   gene            complement(12378753..12379205)
FT                   /pseudo
FT                   /locus_tag="mCG_20608"
FT                   /note="gene_id=mCG20608.0"
FT   mRNA            complement(12378753..12379205)
FT                   /pseudo
FT                   /locus_tag="mCG_20608"
FT                   /note="gene_id=mCG20608.0 transcript_id=mCT22029.0 created
FT                   on 27-MAY-2003"
FT   assembly_gap    12409644..12409663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12413414..12512091
FT                   /gene="9030617O03Rik"
FT                   /locus_tag="mCG_20604"
FT                   /note="gene_id=mCG20604.2"
FT   mRNA            join(<12413414..12413602,12463592..12463718,
FT                   12469179..12469329,12472494..12472692,12475376..12475526,
FT                   12476648..12476770,12478731..12478931,12484115..12484375,
FT                   12487223..12487322,12492940..12493088,12495550..12495669,
FT                   12506585..12506736,12510785..12512091)
FT                   /gene="9030617O03Rik"
FT                   /locus_tag="mCG_20604"
FT                   /product="RIKEN cDNA 9030617O03, transcript variant
FT                   mCT191259"
FT                   /note="gene_id=mCG20604.2 transcript_id=mCT191259.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(12413415..12413602,12420335..12420443,
FT                   12421813..12421869,12463592..12463718,12469213..12469329,
FT                   12472494..12472692,12475376..12475526,12476648..12476770,
FT                   12478731..12478931,12484115..12484375,12487223..12487322,
FT                   12492940..12493088,12495550..12495669,12498568..12498719,
FT                   12510785..12512088)
FT                   /gene="9030617O03Rik"
FT                   /locus_tag="mCG_20604"
FT                   /product="RIKEN cDNA 9030617O03, transcript variant
FT                   mCT22025"
FT                   /note="gene_id=mCG20604.2 transcript_id=mCT22025.2 created
FT                   on 21-JAN-2003"
FT   CDS             join(<12413582..12413602,12463592..12463718,
FT                   12469179..12469329,12472494..12472692,12475376..12475526,
FT                   12476648..12476770,12478731..12478931,12484115..12484375,
FT                   12487223..12487322,12492940..12493088,12495550..12495669,
FT                   12506585..12506736,12510785..12510934)
FT                   /codon_start=1
FT                   /gene="9030617O03Rik"
FT                   /locus_tag="mCG_20604"
FT                   /product="RIKEN cDNA 9030617O03, isoform CRA_a"
FT                   /note="gene_id=mCG20604.2 transcript_id=mCT191259.0
FT                   protein_id=mCP112178.0 isoform=CRA_a"
FT                   /protein_id="EDL18891.1"
FT   assembly_gap    12418045..12418064
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<12420335..12420443,12421813..12421869,
FT                   12463592..12463718,12469179..12469329,12472494..12472692,
FT                   12475376..12475526,12476648..12476770,12478731..12478931,
FT                   12484115..12484375,12487223..12487322,12492940..12493088,
FT                   12495550..12495669,12498568..12498719,12510785..12511825)
FT                   /gene="9030617O03Rik"
FT                   /locus_tag="mCG_20604"
FT                   /product="RIKEN cDNA 9030617O03, transcript variant
FT                   mCT191260"
FT                   /note="gene_id=mCG20604.2 transcript_id=mCT191260.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<12420336..12420443,12421813..12421869,
FT                   12463592..12463718,12469179..12469329,12472494..12472692,
FT                   12475376..12475526,12476648..12476770,12478731..12478931,
FT                   12484115..12484375,12487223..12487322,12492940..12493088,
FT                   12495550..12495669,12498568..12498719,12510785..12510934)
FT                   /codon_start=1
FT                   /gene="9030617O03Rik"
FT                   /locus_tag="mCG_20604"
FT                   /product="RIKEN cDNA 9030617O03, isoform CRA_b"
FT                   /note="gene_id=mCG20604.2 transcript_id=mCT191260.0
FT                   protein_id=mCP112179.0 isoform=CRA_b"
FT                   /protein_id="EDL18892.1"
FT   assembly_gap    12431810..12433527
FT                   /estimated_length=1718
FT                   /gap_type="unknown"
FT   assembly_gap    12452568..12453237
FT                   /estimated_length=670
FT                   /gap_type="unknown"
FT   CDS             join(12472585..12472692,12475376..12475526,
FT                   12476648..12476770,12478731..12478931,12484115..12484375,
FT                   12487223..12487322,12492940..12493088,12495550..12495669,
FT                   12498568..12498719,12510785..12510934)
FT                   /codon_start=1
FT                   /gene="9030617O03Rik"
FT                   /locus_tag="mCG_20604"
FT                   /product="RIKEN cDNA 9030617O03, isoform CRA_c"
FT                   /note="gene_id=mCG20604.2 transcript_id=mCT22025.2
FT                   protein_id=mCP7068.2 isoform=CRA_c"
FT                   /protein_id="EDL18893.1"
FT   assembly_gap    12489763..12489782
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12491285..12491304
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12498428..12498447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12499451..12499470
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12500694..12500713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12502844..12502863
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12515760..12515916
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   gene            complement(12516280..12547956)
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /note="gene_id=mCG51257.1"
FT   mRNA            complement(join(12516280..12519019,12527250..12527641,
FT                   12547861..12547956))
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /product="G protein-coupled receptor 68, transcript variant
FT                   mCT182222"
FT                   /note="gene_id=mCG51257.1 transcript_id=mCT182222.0 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(12516280..12519019,12527553..12527641,
FT                   12547861..12547945))
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /product="G protein-coupled receptor 68, transcript variant
FT                   mCT51440"
FT                   /note="gene_id=mCG51257.1 transcript_id=mCT51440.1 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(12516280..12519019,12527250..12527641,
FT                   12539049..12539126,12547861..12547945))
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /product="G protein-coupled receptor 68, transcript variant
FT                   mCT182223"
FT                   /note="gene_id=mCG51257.1 transcript_id=mCT182223.0 created
FT                   on 19-JUN-2003"
FT   mRNA            complement(join(12516280..12519019,12527553..12527641,
FT                   12539049..12539306))
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /product="G protein-coupled receptor 68, transcript variant
FT                   mCT182224"
FT                   /note="gene_id=mCG51257.1 transcript_id=mCT182224.0 created
FT                   on 19-JUN-2003"
FT   CDS             complement(12517793..12518920)
FT                   /codon_start=1
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /product="G protein-coupled receptor 68, isoform CRA_a"
FT                   /note="gene_id=mCG51257.1 transcript_id=mCT182222.0
FT                   protein_id=mCP105118.0 isoform=CRA_a"
FT                   /protein_id="EDL18887.1"
FT   CDS             complement(12517793..12518920)
FT                   /codon_start=1
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /product="G protein-coupled receptor 68, isoform CRA_a"
FT                   /note="gene_id=mCG51257.1 transcript_id=mCT182224.0
FT                   protein_id=mCP105119.0 isoform=CRA_a"
FT                   /protein_id="EDL18888.1"
FT   CDS             complement(12517793..12518920)
FT                   /codon_start=1
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /product="G protein-coupled receptor 68, isoform CRA_a"
FT                   /note="gene_id=mCG51257.1 transcript_id=mCT182223.0
FT                   protein_id=mCP105120.0 isoform=CRA_a"
FT                   /protein_id="EDL18889.1"
FT   CDS             complement(12517793..12518920)
FT                   /codon_start=1
FT                   /gene="Gpr68"
FT                   /locus_tag="mCG_51257"
FT                   /product="G protein-coupled receptor 68, isoform CRA_a"
FT                   /note="gene_id=mCG51257.1 transcript_id=mCT51440.1
FT                   protein_id=mCP29622.1 isoform=CRA_a"
FT                   /protein_id="EDL18890.1"
FT   assembly_gap    12523636..12523664
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    12525997..12526128
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    12529756..12529775
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12539947..12539999
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    12545704..12546383
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   gene            complement(12551286..>12668789)
FT                   /gene="0610010D24Rik"
FT                   /locus_tag="mCG_114718"
FT                   /note="gene_id=mCG114718.1"
FT   mRNA            complement(join(12551286..12553567,12556320..12556612,
FT                   12558093..12558161,12561292..12561360,12562996..12563184,
FT                   12568643..12568881,12570331..12570420,12571584..12571729,
FT                   12572947..12573133,12575414..12575557,12577618..12577895,
FT                   12578785..12578946,12579873..12580058,12580897..12581023,
FT                   12581785..12581912,12584635..12585696,12586888..12587025,
FT                   12588235..12588419,12593075..12593219,12593952..12594098,
FT                   12605574..12605732,12606015..12606096,12607444..12607628,
FT                   12608095..12608235,12610155..12610316,12611062..12611120,
FT                   12623665..12623734,12662100..12662208,12668042..12668142,
FT                   12668578..12668720))
FT                   /gene="0610010D24Rik"
FT                   /locus_tag="mCG_114718"
FT                   /product="RIKEN cDNA 0610010D24, transcript variant
FT                   mCT115814"
FT                   /note="gene_id=mCG114718.1 transcript_id=mCT115814.0
FT                   created on 21-JAN-2003"
FT   mRNA            complement(join(12552462..12553567,12556320..12556612,
FT                   12558093..12558161,12561292..12561360,12562996..12563184,
FT                   12568643..12568881,12570331..12570420,12571584..12571729,
FT                   12572947..12573133,12575414..12575557,12577618..12577895,
FT                   12578785..12578946,12579873..12580058,12580897..12581023,
FT                   12581785..12581912,12584635..12585696,12586888..12587025,
FT                   12588235..12588419,12593075..12593219,12593952..12594098,
FT                   12605574..12605732,12606015..12606096,12607444..12607628,
FT                   12608095..12608235,12610233..12610316,12611062..12611120,
FT                   12623665..12623734,12662100..12662208,12668042..12668142,
FT                   12668578..>12668789))
FT                   /gene="0610010D24Rik"
FT                   /locus_tag="mCG_114718"
FT                   /product="RIKEN cDNA 0610010D24, transcript variant
FT                   mCT191250"
FT                   /note="gene_id=mCG114718.1 transcript_id=mCT191250.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(12552572..12553567,12556320..12556612,
FT                   12558093..12558161,12561292..12561360,12562996..12563184,
FT                   12568643..12568881,12570331..12570420,12571584..12571729,
FT                   12572947..12573133,12575414..12575557,12577618..12577895,
FT                   12578785..12578946,12579873..12580058,12580897..12581023,
FT                   12581785..12581912,12584635..12585696,12586888..12587025,
FT                   12588235..12588419,12593075..12593219,12593952..12594098,
FT                   12605574..12605732,12606015..12606096,12607444..12607628,
FT                   12608095..12608235,12610233..12610316,12611062..12611120,
FT                   12623665..12623734,12662100..12662208,12668042..12668142,
FT                   12668578..>12668787))
FT                   /codon_start=1
FT                   /gene="0610010D24Rik"
FT                   /locus_tag="mCG_114718"
FT                   /product="RIKEN cDNA 0610010D24, isoform CRA_b"
FT                   /note="gene_id=mCG114718.1 transcript_id=mCT191250.0
FT                   protein_id=mCP112195.0 isoform=CRA_b"
FT                   /protein_id="EDL18884.1"
FT                   VWYEYGCV"
FT   CDS             complement(join(12552572..12553567,12556320..12556612,
FT                   12558093..12558161,12561292..12561360,12562996..12563184,
FT                   12568643..12568881,12570331..12570420,12571584..12571729,
FT                   12572947..12573133,12575414..12575557,12577618..12577895,
FT                   12578785..12578946,12579873..12580058,12580897..12581023,
FT                   12581785..12581912,12584635..12585696,12586888..12587025,
FT                   12588235..12588419,12593075..12593219,12593952..12594098,
FT                   12605574..12605732,12606015..12606096,12607444..12607628,
FT                   12608095..12608235,12610155..12610316,12611062..12611120,
FT                   12623665..12623734,12662100..12662208,12668042..12668142,
FT                   12668578..12668637))
FT                   /codon_start=1
FT                   /gene="0610010D24Rik"
FT                   /locus_tag="mCG_114718"
FT                   /product="RIKEN cDNA 0610010D24, isoform CRA_a"
FT                   /note="gene_id=mCG114718.1 transcript_id=mCT115814.0
FT                   protein_id=mCP50533.1 isoform=CRA_a"
FT                   /protein_id="EDL18883.1"
FT   assembly_gap    12557304..12557323
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12561635..12561654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <12581644..12584063
FT                   /locus_tag="mCG_146207"
FT                   /note="gene_id=mCG146207.0"
FT   mRNA            join(<12581644..12582140,12582535..12582690,
FT                   12582991..12583054,12583261..12584063)
FT                   /locus_tag="mCG_146207"
FT                   /product="mCG146207"
FT                   /note="gene_id=mCG146207.0 transcript_id=mCT186310.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<12581797..12582140,12582535..12582690,
FT                   12582991..12583054,12583261..12583278)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146207"
FT                   /product="mCG146207"
FT                   /note="gene_id=mCG146207.0 transcript_id=mCT186310.0
FT                   protein_id=mCP107380.0"
FT                   /protein_id="EDL18886.1"
FT   assembly_gap    12604913..12604932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12618642..12618855
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    12644337..12644519
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   gene            12646712..12654559
FT                   /locus_tag="mCG_147638"
FT                   /note="gene_id=mCG147638.0"
FT   mRNA            join(12646712..12646997,12654309..12654559)
FT                   /locus_tag="mCG_147638"
FT                   /product="mCG147638"
FT                   /note="gene_id=mCG147638.0 transcript_id=mCT187901.0
FT                   created on 13-JAN-2004"
FT   CDS             join(12646897..12646997,12654309..12654420)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147638"
FT                   /product="mCG147638"
FT                   /note="gene_id=mCG147638.0 transcript_id=mCT187901.0
FT                   protein_id=mCP109013.0"
FT                   /protein_id="EDL18885.1"
FT   gene            complement(12678988..12722909)
FT                   /gene="1110034C04Rik"
FT                   /locus_tag="mCG_20612"
FT                   /note="gene_id=mCG20612.2"
FT   mRNA            complement(join(12678988..12680358,12681404..12681630,
FT                   12682034..12682224,12683022..12683164,12684070..12684239,
FT                   12689247..12689405,12690921..12691023,12691118..12691249,
FT                   12693055..12693171,12695156..12695272,12695376..12695453,
FT                   12697950..12698567,12704609..12704707,12708256..12708311,
FT                   12722302..12722909))
FT                   /gene="1110034C04Rik"
FT                   /locus_tag="mCG_20612"
FT                   /product="RIKEN cDNA 1110034C04, transcript variant
FT                   mCT22033"
FT                   /note="gene_id=mCG20612.2 transcript_id=mCT22033.2 created
FT                   on 09-APR-2003"
FT   CDS             complement(join(12680248..12680358,12681404..12681630,
FT                   12682034..12682224,12683022..12683164,12684070..12684239,
FT                   12689247..12689405,12690921..12691023,12691118..12691249,
FT                   12693055..12693171,12695156..12695272,12695376..12695453,
FT                   12697950..12698567,12704609..12704707,12708256..12708311,
FT                   12722302..12722443))
FT                   /codon_start=1
FT                   /gene="1110034C04Rik"
FT                   /locus_tag="mCG_20612"
FT                   /product="RIKEN cDNA 1110034C04, isoform CRA_b"
FT                   /note="gene_id=mCG20612.2 transcript_id=mCT22033.2
FT                   protein_id=mCP7116.2 isoform=CRA_b"
FT                   /protein_id="EDL18882.1"
FT                   SKKAKFES"
FT   assembly_gap    12693601..12693620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(12696597..12698567,12704609..12704707,
FT                   12708256..12708311,12722302..12722909))
FT                   /gene="1110034C04Rik"
FT                   /locus_tag="mCG_20612"
FT                   /product="RIKEN cDNA 1110034C04, transcript variant
FT                   mCT181828"
FT                   /note="gene_id=mCG20612.2 transcript_id=mCT181828.0 created
FT                   on 09-APR-2003"
FT   CDS             complement(join(12697896..12698567,12704609..12704707,
FT                   12708256..12708311,12722302..12722443))
FT                   /codon_start=1
FT                   /gene="1110034C04Rik"
FT                   /locus_tag="mCG_20612"
FT                   /product="RIKEN cDNA 1110034C04, isoform CRA_a"
FT                   /note="gene_id=mCG20612.2 transcript_id=mCT181828.0
FT                   protein_id=mCP104750.0 isoform=CRA_a"
FT                   /protein_id="EDL18881.1"
FT   assembly_gap    12722910..12722969
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    12731596..12731615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12733052..12733071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12736107..12737781
FT                   /estimated_length=1675
FT                   /gap_type="unknown"
FT   assembly_gap    12776261..12783608
FT                   /estimated_length=7348
FT                   /gap_type="unknown"
FT   assembly_gap    12818539..12818558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12825668..12826289
FT                   /estimated_length=622
FT                   /gap_type="unknown"
FT   assembly_gap    12832914..12832976
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    12849508..12849527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12850610..12850629
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12853263..12855283
FT                   /estimated_length=2021
FT                   /gap_type="unknown"
FT   assembly_gap    12856073..12856983
FT                   /estimated_length=911
FT                   /gap_type="unknown"
FT   gene            complement(12862896..12863567)
FT                   /locus_tag="mCG_1047982"
FT                   /note="gene_id=mCG1047982.1"
FT   mRNA            complement(12862896..12863567)
FT                   /locus_tag="mCG_1047982"
FT                   /product="mCG1047982"
FT                   /note="gene_id=mCG1047982.1 transcript_id=mCT165686.1
FT                   created on 04-APR-2003"
FT   CDS             complement(12863167..12863412)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047982"
FT                   /product="mCG1047982"
FT                   /note="gene_id=mCG1047982.1 transcript_id=mCT165686.1
FT                   protein_id=mCP50154.1"
FT                   /protein_id="EDL18880.1"
FT   assembly_gap    12869495..12872927
FT                   /estimated_length=3433
FT                   /gap_type="unknown"
FT   assembly_gap    12885845..12886051
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    12898456..12899521
FT                   /estimated_length=1066
FT                   /gap_type="unknown"
FT   assembly_gap    12917967..12917992
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    12982321..12982570
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    12983786..12984874
FT                   /estimated_length=1089
FT                   /gap_type="unknown"
FT   assembly_gap    13021299..13021318
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13023362..13023381
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13028191..13028215
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            13044617..>13138377
FT                   /locus_tag="mCG_1051005"
FT                   /note="gene_id=mCG1051005.0"
FT   mRNA            join(13044617..13044737,13049275..13049353,
FT                   13052267..13052355,13055175..13055315,13058029..13058089,
FT                   13080371..13080466,13090931..13091080,13108607..13108702,
FT                   13108831..13108949,13111039..13111071,13135761..13135827,
FT                   13136413..13136459,13137029..13137178,13138219..>13138377)
FT                   /locus_tag="mCG_1051005"
FT                   /product="mCG1051005"
FT                   /note="gene_id=mCG1051005.0 transcript_id=mCT194794.0
FT                   created on 27-JAN-2005"
FT   CDS             join(13049275..13049353,13052267..13052355,
FT                   13055175..13055315,13058029..13058089,13080371..13080466,
FT                   13090931..13091080,13108607..13108702,13108831..13108949,
FT                   13111039..13111071,13135761..13135827,13136413..13136459,
FT                   13137029..13137178,13138219..>13138377)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051005"
FT                   /product="mCG1051005"
FT                   /note="gene_id=mCG1051005.0 transcript_id=mCT194794.0
FT                   protein_id=mCP115823.0"
FT                   /protein_id="EDL18879.1"
FT   assembly_gap    13068061..13068080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13086810..13086829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <13142977..13177079
FT                   /locus_tag="mCG_144679"
FT                   /note="gene_id=mCG144679.0"
FT   mRNA            join(<13142977..13143045,13156298..13156517,
FT                   13158206..13158438,13167183..13167339,13175425..13175548,
FT                   13175780..13177079)
FT                   /locus_tag="mCG_144679"
FT                   /product="mCG144679"
FT                   /note="gene_id=mCG144679.0 transcript_id=mCT184103.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<13143010..13143045,13156298..13156517,
FT                   13158206..13158363)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144679"
FT                   /product="mCG144679"
FT                   /note="gene_id=mCG144679.0 transcript_id=mCT184103.0
FT                   protein_id=mCP105373.0"
FT                   /protein_id="EDL18878.1"
FT   assembly_gap    13147137..13150957
FT                   /estimated_length=3821
FT                   /gap_type="unknown"
FT   assembly_gap    13152060..13152079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13171031..13171050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13174335..13174354
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13195483..13195553
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            13214099..13246013
FT                   /locus_tag="mCG_114720"
FT                   /note="gene_id=mCG114720.0"
FT   mRNA            join(13214099..13214428,13228976..13229037,
FT                   13232825..13232935,13244665..13244744,13245231..13245305,
FT                   13245558..13246013)
FT                   /locus_tag="mCG_114720"
FT                   /product="mCG114720"
FT                   /note="gene_id=mCG114720.0 transcript_id=mCT115816.0
FT                   created on 24-JAN-2003"
FT   CDS             join(13214173..13214428,13228976..13229037,
FT                   13232825..13232935,13244665..13244676)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114720"
FT                   /product="mCG114720"
FT                   /note="gene_id=mCG114720.0 transcript_id=mCT115816.0
FT                   protein_id=mCP50257.1"
FT                   /protein_id="EDL18877.1"
FT   assembly_gap    13216014..13216311
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    13220101..13220790
FT                   /estimated_length=690
FT                   /gap_type="unknown"
FT   assembly_gap    13239603..13240952
FT                   /estimated_length=1350
FT                   /gap_type="unknown"
FT   assembly_gap    13242505..13242524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13248501..13248704
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    13257289..13257308
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13263619..13263638
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13265634..13330702)
FT                   /gene="Mtac2d1"
FT                   /locus_tag="mCG_114722"
FT                   /note="gene_id=mCG114722.1"
FT   mRNA            complement(join(13265634..13266792,13269057..13269255,
FT                   13271042..13271241,13272789..13272903,13285603..13285794,
FT                   13298553..13298669,13308940..13309040,13309757..13309832,
FT                   13313092..13313183,13314483..13314650,13325180..13325410,
FT                   13328221..13328333,13329897..13330702))
FT                   /gene="Mtac2d1"
FT                   /locus_tag="mCG_114722"
FT                   /product="membrane targeting (tandem) C2 domain containing
FT                   1"
FT                   /note="gene_id=mCG114722.1 transcript_id=mCT115818.1
FT                   created on 21-JAN-2003"
FT   CDS             complement(join(13269145..13269255,13271042..13271241,
FT                   13272789..13272903,13285603..13285794,13298553..13298669,
FT                   13308940..13309040,13309757..13309832,13313092..13313183,
FT                   13314483..13314650,13325180..13325410,13328221..13328287))
FT                   /codon_start=1
FT                   /gene="Mtac2d1"
FT                   /locus_tag="mCG_114722"
FT                   /product="membrane targeting (tandem) C2 domain containing
FT                   1"
FT                   /note="gene_id=mCG114722.1 transcript_id=mCT115818.1
FT                   protein_id=mCP50118.1"
FT                   /db_xref="GOA:Q91XT6"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR030542"
FT                   /db_xref="MGI:MGI:1921663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91XT6"
FT                   /protein_id="EDL18876.1"
FT   assembly_gap    13307139..13307158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13333317..13333336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13347933..13348278
FT                   /estimated_length=346
FT                   /gap_type="unknown"
FT   assembly_gap    13349282..13354057
FT                   /estimated_length=4776
FT                   /gap_type="unknown"
FT   assembly_gap    13354477..13354496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13357165..13357184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13358195..13358214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13359493..13359512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13364516..13364561
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            complement(13371485..13441240)
FT                   /gene="Fbln5"
FT                   /locus_tag="mCG_21598"
FT                   /note="gene_id=mCG21598.1"
FT   mRNA            complement(join(13371485..13372448,13378801..13378996,
FT                   13382246..13382372,13383347..13383469,13386701..13386820,
FT                   13389938..13390054,13392790..13392912,13431917..13432171,
FT                   13434355..13434406,13436744..13436798,13440905..13441240))
FT                   /gene="Fbln5"
FT                   /locus_tag="mCG_21598"
FT                   /product="fibulin 5"
FT                   /note="gene_id=mCG21598.1 transcript_id=mCT19795.1 created
FT                   on 21-JAN-2003"
FT   CDS             complement(join(13372287..13372448,13378801..13378996,
FT                   13382246..13382372,13383347..13383469,13386701..13386820,
FT                   13389938..13390054,13392790..13392912,13431917..13432171,
FT                   13434355..13434406,13436744..13436798,13440905..13440921))
FT                   /codon_start=1
FT                   /gene="Fbln5"
FT                   /locus_tag="mCG_21598"
FT                   /product="fibulin 5"
FT                   /note="gene_id=mCG21598.1 transcript_id=mCT19795.1
FT                   protein_id=mCP7108.1"
FT                   /protein_id="EDL18875.1"
FT   assembly_gap    13393634..13393897
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    13396431..13396599
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    13399091..13399110
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13421317..13421336
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13427915..13428532
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   gene            complement(13458829..13542599)
FT                   /locus_tag="mCG_21601"
FT                   /note="gene_id=mCG21601.1"
FT   mRNA            complement(join(13458829..13459939,13466032..13466166,
FT                   13491572..13491671,13500849..13500952,13502349..13502512,
FT                   13506948..13507141,13507782..13507922,13512249..13515269,
FT                   13515801..13516013,13519004..13519090,13519876..13519916,
FT                   13522746..13523108,13523577..13523742,13524966..13525031,
FT                   13528149..13528427,13531557..13531667,13535079..13535140,
FT                   13542404..13542599))
FT                   /locus_tag="mCG_21601"
FT                   /product="mCG21601"
FT                   /note="gene_id=mCG21601.1 transcript_id=mCT19798.2 created
FT                   on 24-JAN-2003"
FT   CDS             complement(join(13459719..13459939,13466032..13466166,
FT                   13491572..13491671,13500849..13500952,13502349..13502512,
FT                   13506948..13507141,13507782..13507922,13512249..13515269,
FT                   13515801..13516013,13519004..13519090,13519876..13519916,
FT                   13522746..13523108,13523577..13523742,13524966..13525031,
FT                   13528149..13528427,13531557..13531667,13535079..13535140,
FT                   13542404..13542452))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21601"
FT                   /product="mCG21601"
FT                   /note="gene_id=mCG21601.1 transcript_id=mCT19798.2
FT                   protein_id=mCP7115.2"
FT                   /protein_id="EDL18874.1"
FT   assembly_gap    13463749..13463824
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    13468732..13468751
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13469670..13477931
FT                   /estimated_length=8262
FT                   /gap_type="unknown"
FT   assembly_gap    13479265..13479284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13487023..13487042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13496339..13496688
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    13518229..13518248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13536334..13536615
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    13537561..13537620
FT                   /estimated_length=60
FT                   /gap_type="unknown"
FT   assembly_gap    13546596..13546911
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   gene            13548409..13549098
FT                   /locus_tag="mCG_1048041"
FT                   /note="gene_id=mCG1048041.1"
FT   mRNA            13548409..13549098
FT                   /locus_tag="mCG_1048041"
FT                   /product="mCG1048041"
FT                   /note="gene_id=mCG1048041.1 transcript_id=mCT165745.1
FT                   created on 05-FEB-2003"
FT   CDS             13548646..13548720
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048041"
FT                   /product="mCG1048041"
FT                   /note="gene_id=mCG1048041.1 transcript_id=mCT165745.1
FT                   protein_id=mCP50090.1"
FT                   /protein_id="EDL18873.1"
FT                   /translation="MPFIFTAFALEFHIFYLYRTVFFF"
FT   gene            complement(13551656..13587897)
FT                   /gene="Mjd"
FT                   /locus_tag="mCG_21602"
FT                   /note="gene_id=mCG21602.1"
FT   mRNA            complement(join(13551656..13552711,13555990..13556087,
FT                   13562509..13562605,13563789..13563955,13566986..13567118,
FT                   13571813..13571900,13575092..13575158,13575526..13575611,
FT                   13577696..13577740,13577967..13578131,13587827..13587897))
FT                   /gene="Mjd"
FT                   /locus_tag="mCG_21602"
FT                   /product="Machado-Joseph disease (spinocerebellar ataxia 3,
FT                   olivopontocerebellar ataxia 3, autosomal dominant, ataxin
FT                   3) homolog (human)"
FT                   /note="gene_id=mCG21602.1 transcript_id=mCT19799.2 created
FT                   on 24-JAN-2003"
FT   CDS             complement(join(13552614..13552711,13555990..13556087,
FT                   13562509..13562605,13563789..13563955,13566986..13567118,
FT                   13571813..13571900,13575092..13575158,13575526..13575611,
FT                   13577696..13577740,13577967..13578131,13587827..13587850))
FT                   /codon_start=1
FT                   /gene="Mjd"
FT                   /locus_tag="mCG_21602"
FT                   /product="Machado-Joseph disease (spinocerebellar ataxia 3,
FT                   olivopontocerebellar ataxia 3, autosomal dominant, ataxin
FT                   3) homolog (human)"
FT                   /note="gene_id=mCG21602.1 transcript_id=mCT19799.2
FT                   protein_id=mCP7069.2"
FT                   /db_xref="GOA:Q546X9"
FT                   /db_xref="InterPro:IPR003903"
FT                   /db_xref="InterPro:IPR006155"
FT                   /db_xref="InterPro:IPR033865"
FT                   /db_xref="MGI:MGI:1099442"
FT                   /db_xref="UniProtKB/TrEMBL:Q546X9"
FT                   /protein_id="EDL18872.1"
FT                   SLETAKDNLKAERKK"
FT   assembly_gap    13559368..13559387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13560396..13560415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13566105..13566232
FT                   /estimated_length=128
FT                   /gap_type="unknown"
FT   gene            13605674..13633297
FT                   /gene="Cpsf2"
FT                   /locus_tag="mCG_21596"
FT                   /note="gene_id=mCG21596.1"
FT   mRNA            join(13605674..13605820,13611600..13611781,
FT                   13612863..13613022,13613107..13613212,13614908..13615037,
FT                   13616945..13617060,13618320..13618507,13619478..13619768,
FT                   13626504..13626604,13626940..13627140,13628222..13628374,
FT                   13629058..13629283,13630362..13630661,13632313..13632447,
FT                   13632814..13633297)
FT                   /gene="Cpsf2"
FT                   /locus_tag="mCG_21596"
FT                   /product="cleavage and polyadenylation specific factor 2"
FT                   /note="gene_id=mCG21596.1 transcript_id=mCT19793.1 created
FT                   on 21-JAN-2003"
FT   CDS             join(13611633..13611781,13612863..13613022,
FT                   13613107..13613212,13614908..13615037,13616945..13617060,
FT                   13618320..13618507,13619478..13619768,13626504..13626604,
FT                   13626940..13627140,13628222..13628374,13629058..13629283,
FT                   13630362..13630661,13632313..13632447,13632814..13632906)
FT                   /codon_start=1
FT                   /gene="Cpsf2"
FT                   /locus_tag="mCG_21596"
FT                   /product="cleavage and polyadenylation specific factor 2"
FT                   /note="gene_id=mCG21596.1 transcript_id=mCT19793.1
FT                   protein_id=mCP7088.1"
FT                   /protein_id="EDL18871.1"
FT   assembly_gap    13666018..13666255
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    13670765..13671621
FT                   /estimated_length=857
FT                   /gap_type="unknown"
FT   assembly_gap    13685068..13685474
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    13687750..13687769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13701003..13701022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13705875..13706074
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    13708295..13708314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13709453..13710154
FT                   /estimated_length=702
FT                   /gap_type="unknown"
FT   assembly_gap    13724666..13724685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13737905..13738057
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   gene            <13758491..13897195
FT                   /gene="Slc24a4"
FT                   /locus_tag="mCG_115376"
FT                   /note="gene_id=mCG115376.2"
FT   mRNA            join(<13758491..13759278,13761270..13761380,
FT                   13843941..13844017,13849032..13849106,13852124..13852208,
FT                   13852816..13852919,13853688..13853762,13857145..13857170,
FT                   13858977..13859030,13860432..13860517,13864763..13864932,
FT                   13869131..13869335,13884626..13884792,13890482..13890596,
FT                   13894442..13894554,13894981..13897195)
FT                   /gene="Slc24a4"
FT                   /locus_tag="mCG_115376"
FT                   /product="solute carrier family 24
FT                   (sodium/potassium/calcium exchanger), member 4, transcript
FT                   variant mCT191253"
FT                   /note="gene_id=mCG115376.2 transcript_id=mCT191253.0
FT                   created on 09-MAR-2004"
FT   mRNA            join(13758931..13759278,13761270..13761380,
FT                   13843941..13844077,13849032..13849106,13852124..13852208,
FT                   13852816..13852919,13853688..13853762,13857145..13857170,
FT                   13860432..13860574,13884626..13884792,13890482..13890596,
FT                   13894442..13894554,13894981..13895046,13896449..13897193)
FT                   /gene="Slc24a4"
FT                   /locus_tag="mCG_115376"
FT                   /product="solute carrier family 24
FT                   (sodium/potassium/calcium exchanger), member 4, transcript
FT                   variant mCT116479"
FT                   /note="gene_id=mCG115376.2 transcript_id=mCT116479.1
FT                   created on 21-JAN-2003"
FT   CDS             join(<13759110..13759278,13761270..13761380,
FT                   13843941..13844017,13849032..13849106,13852124..13852208,
FT                   13852816..13852919,13853688..13853762,13857145..13857170,
FT                   13858977..13859030,13860432..13860517,13864763..13864932,
FT                   13869131..13869335,13884626..13884792,13890482..13890596,
FT                   13894442..13894554,13894981..13895082)
FT                   /codon_start=1
FT                   /gene="Slc24a4"
FT                   /locus_tag="mCG_115376"
FT                   /product="solute carrier family 24
FT                   (sodium/potassium/calcium exchanger), member 4, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG115376.2 transcript_id=mCT191253.0
FT                   protein_id=mCP112198.0 isoform=CRA_c"
FT                   /protein_id="EDL18870.1"
FT                   P"
FT   CDS             join(13759149..13759278,13761270..13761380,
FT                   13843941..13844077,13849032..13849106,13852124..13852208,
FT                   13852816..13852919,13853688..13853762,13857145..13857170,
FT                   13860432..13860574,13884626..13884792,13890482..13890596,
FT                   13894442..13894554,13894981..13895046,13896449..13896601)
FT                   /codon_start=1
FT                   /gene="Slc24a4"
FT                   /locus_tag="mCG_115376"
FT                   /product="solute carrier family 24
FT                   (sodium/potassium/calcium exchanger), member 4, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115376.2 transcript_id=mCT116479.1
FT                   protein_id=mCP50275.1 isoform=CRA_a"
FT                   /protein_id="EDL18868.1"
FT   mRNA            join(<13759178..13759278,13761270..13761380,
FT                   13843941..13844017,13849032..13849106,13852124..13852208,
FT                   13852816..13852919,13853688..13853762,13857145..13857170,
FT                   13858977..13859030,13860432..13860574,13864763..13864932,
FT                   13869131..13869335,13884626..13884792,13890482..13890596,
FT                   13894442..13894554,13894981..13895046,13896449..13896853)
FT                   /gene="Slc24a4"
FT                   /locus_tag="mCG_115376"
FT                   /product="solute carrier family 24
FT                   (sodium/potassium/calcium exchanger), member 4, transcript
FT                   variant mCT191252"
FT                   /note="gene_id=mCG115376.2 transcript_id=mCT191252.0
FT                   created on 09-MAR-2004"
FT   CDS             join(<13759179..13759278,13761270..13761380,
FT                   13843941..13844017,13849032..13849106,13852124..13852208,
FT                   13852816..13852919,13853688..13853762,13857145..13857170,
FT                   13858977..13859030,13860432..13860574,13864763..13864932,
FT                   13869131..13869335,13884626..13884792,13890482..13890596,
FT                   13894442..13894554,13894981..13895046,13896449..13896601)
FT                   /codon_start=1
FT                   /gene="Slc24a4"
FT                   /locus_tag="mCG_115376"
FT                   /product="solute carrier family 24
FT                   (sodium/potassium/calcium exchanger), member 4, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG115376.2 transcript_id=mCT191252.0
FT                   protein_id=mCP112197.0 isoform=CRA_b"
FT                   /protein_id="EDL18869.1"
FT   assembly_gap    13772745..13772765
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    13819709..13819728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13835980..13835999
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13868491..13868526
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    13874485..13874915
FT                   /estimated_length=431
FT                   /gap_type="unknown"
FT   assembly_gap    13899657..13899676
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13913358..14021084
FT                   /gene="Rin3"
FT                   /locus_tag="mCG_115375"
FT                   /note="gene_id=mCG115375.1"
FT   mRNA            join(13913358..13913455,13955836..13955954,
FT                   13981008..13981080,13988816..13988907,13998475..13999959,
FT                   14003681..14003989,14012786..14012917,14017789..14017952,
FT                   14020052..14021084)
FT                   /gene="Rin3"
FT                   /locus_tag="mCG_115375"
FT                   /product="Ras and Rab interactor 3"
FT                   /note="gene_id=mCG115375.1 transcript_id=mCT116478.1
FT                   created on 24-JAN-2003"
FT   CDS             join(13913415..13913455,13955836..13955954,
FT                   13981008..13981080,13988816..13988907,13998475..13999959,
FT                   14003681..14003989,14012786..14012917,14017789..14017952,
FT                   14020052..14020372)
FT                   /codon_start=1
FT                   /gene="Rin3"
FT                   /locus_tag="mCG_115375"
FT                   /product="Ras and Rab interactor 3"
FT                   /note="gene_id=mCG115375.1 transcript_id=mCT116478.1
FT                   protein_id=mCP50268.1"
FT                   /protein_id="EDL18867.1"
FT   assembly_gap    13929255..13929296
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    13936279..13936461
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    13942927..13946361
FT                   /estimated_length=3435
FT                   /gap_type="unknown"
FT   assembly_gap    13947316..13947534
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    14007482..14007920
FT                   /estimated_length=439
FT                   /gap_type="unknown"
FT   gene            complement(14024258..14060440)
FT                   /gene="Lgmn"
FT                   /locus_tag="mCG_115373"
FT                   /note="gene_id=mCG115373.1"
FT   mRNA            complement(join(14024258..14024606,14025885..14025990,
FT                   14028356..14028471,14037047..14037146,14047175..14047345,
FT                   14060374..14060417))
FT                   /gene="Lgmn"
FT                   /locus_tag="mCG_115373"
FT                   /product="legumain, transcript variant mCT171176"
FT                   /note="gene_id=mCG115373.1 transcript_id=mCT171176.0
FT                   created on 25-JUL-2002"
FT   mRNA            complement(join(14024275..14024788,14025018..14025085,
FT                   14025820..14025990,14028359..14028559,14030081..14030170,
FT                   14030314..14030432,14032158..14032224,14032943..14033005,
FT                   14033700..14033775,14034533..14034618,14036083..14036164,
FT                   14037049..14037146,14047175..14047345,14060374..14060440))
FT                   /gene="Lgmn"
FT                   /locus_tag="mCG_115373"
FT                   /product="legumain, transcript variant mCT116476"
FT                   /note="gene_id=mCG115373.1 transcript_id=mCT116476.0
FT                   created on 25-JUL-2002"
FT   CDS             complement(join(14024440..14024606,14025885..14025990,
FT                   14028356..14028471,14037047..14037146,14047175..14047318))
FT                   /codon_start=1
FT                   /gene="Lgmn"
FT                   /locus_tag="mCG_115373"
FT                   /product="legumain, isoform CRA_b"
FT                   /note="gene_id=mCG115373.1 transcript_id=mCT171176.0
FT                   protein_id=mCP94094.0 isoform=CRA_b"
FT                   /protein_id="EDL18866.1"
FT   CDS             complement(join(14024746..14024788,14025018..14025085,
FT                   14025820..14025990,14028359..14028559,14030081..14030170,
FT                   14030314..14030432,14032158..14032224,14032943..14033005,
FT                   14033700..14033775,14034533..14034618,14036083..14036164,
FT                   14037049..14037146,14047175..14047318))
FT                   /codon_start=1
FT                   /gene="Lgmn"
FT                   /locus_tag="mCG_115373"
FT                   /product="legumain, isoform CRA_a"
FT                   /note="gene_id=mCG115373.1 transcript_id=mCT116476.0
FT                   protein_id=mCP50546.1 isoform=CRA_a"
FT                   /db_xref="GOA:A2RTI3"
FT                   /db_xref="InterPro:IPR001096"
FT                   /db_xref="MGI:MGI:1330838"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTI3"
FT                   /protein_id="EDL18865.1"
FT   assembly_gap    14030665..14030794
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    14050488..14052415
FT                   /estimated_length=1928
FT                   /gap_type="unknown"
FT   assembly_gap    14068259..14068419
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    14072251..14072426
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    14075602..14075621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14077293..14077312
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14079503..14079522
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14080979..14080998
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14084761..14084780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14086151..14086170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14091298..14091317
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14092883..14121531
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /note="gene_id=mCG18590.1"
FT   mRNA            join(14092883..14093595,14095747..14096314,
FT                   14098293..14098520,14099916..14100135,14100542..14100665,
FT                   14103345..14103548,14108156..14108326,14110873..14111001,
FT                   14113173..14113271,14119326..14119389,14121074..14121531)
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /product="golgi autoantigen, golgin subfamily a, 5,
FT                   transcript variant mCT171201"
FT                   /note="gene_id=mCG18590.1 transcript_id=mCT171201.0 created
FT                   on 18-MAR-2003"
FT   mRNA            join(<14092883..14093113,14095747..14096314,
FT                   14098293..14098520,14099916..14100135,14100542..14100665,
FT                   14103345..14103548,14108156..14108326,14110873..14111001,
FT                   14113173..14113271,14115768..14115993,14117506..14117611,
FT                   14119326..14119389,14121074..14121531)
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /product="golgi autoantigen, golgin subfamily a, 5,
FT                   transcript variant mCT191230"
FT                   /note="gene_id=mCG18590.1 transcript_id=mCT191230.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<14092935..14093731,14095747..14096314,
FT                   14098293..14098520,14099916..14100135,14100542..14100665,
FT                   14103345..14103548,14108156..14108326,14110873..14111001,
FT                   14113173..14113271,14115768..14115993,14117506..14117611,
FT                   14119326..14119389,14121074..14121531)
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /product="golgi autoantigen, golgin subfamily a, 5,
FT                   transcript variant mCT191231"
FT                   /note="gene_id=mCG18590.1 transcript_id=mCT191231.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(14092935..14093595,14095747..14096314,
FT                   14098293..14098520,14099916..14100135,14100542..14100665,
FT                   14103345..14103548,14108156..14108326,14110873..14111001,
FT                   14113173..14113271,14115768..14115993,14117506..14117611,
FT                   14119326..14119389,14121074..14121531)
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /product="golgi autoantigen, golgin subfamily a, 5,
FT                   transcript variant mCT14732"
FT                   /note="gene_id=mCG18590.1 transcript_id=mCT14732.2 created
FT                   on 18-MAR-2003"
FT   CDS             join(<14095759..14096314,14098293..14098520,
FT                   14099916..14100135,14100542..14100665,14103345..14103548,
FT                   14108156..14108326,14110873..14111001,14113173..14113271,
FT                   14115768..14115993,14117506..14117611,14119326..14119389,
FT                   14121074..14121154)
FT                   /codon_start=1
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /product="golgi autoantigen, golgin subfamily a, 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18590.1 transcript_id=mCT191230.0
FT                   protein_id=mCP112225.0 isoform=CRA_a"
FT                   /protein_id="EDL18861.1"
FT   CDS             join(<14095759..14096314,14098293..14098520,
FT                   14099916..14100135,14100542..14100665,14103345..14103548,
FT                   14108156..14108326,14110873..14111001,14113173..14113271,
FT                   14115768..14115993,14117506..14117611,14119326..14119389,
FT                   14121074..14121154)
FT                   /codon_start=1
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /product="golgi autoantigen, golgin subfamily a, 5, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18590.1 transcript_id=mCT191231.0
FT                   protein_id=mCP112226.0 isoform=CRA_a"
FT                   /protein_id="EDL18862.1"
FT   CDS             join(14095777..14096314,14098293..14098520,
FT                   14099916..14100135,14100542..14100665,14103345..14103548,
FT                   14108156..14108326,14110873..14111001,14113173..14113271,
FT                   14115768..14115993,14117506..14117611,14119326..14119389,
FT                   14121074..14121154)
FT                   /codon_start=1
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /product="golgi autoantigen, golgin subfamily a, 5, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18590.1 transcript_id=mCT14732.2
FT                   protein_id=mCP7070.2 isoform=CRA_b"
FT                   /protein_id="EDL18863.1"
FT   CDS             join(14095777..14096314,14098293..14098520,
FT                   14099916..14100135,14100542..14100665,14103345..14103548,
FT                   14108156..14108326,14110873..14111001,14113173..14113271,
FT                   14119326..14119389,14121074..14121135)
FT                   /codon_start=1
FT                   /gene="Golga5"
FT                   /locus_tag="mCG_18590"
FT                   /product="golgi autoantigen, golgin subfamily a, 5, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18590.1 transcript_id=mCT171201.0
FT                   protein_id=mCP94119.0 isoform=CRA_c"
FT                   /protein_id="EDL18864.1"
FT   assembly_gap    14140928..14141095
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    14154061..14154080
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14161580..14161824
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    14165053..14165404
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    14166586..14167071
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    14171415..14171434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14181707..14191786
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /note="gene_id=mCG18587.1"
FT   mRNA            join(14181707..14181908,14182623..14182669,
FT                   14185198..14185291,14186021..14186089,14188083..14188262,
FT                   14188426..14188842,14189356..14189831,14191369..14191786)
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /product="chromogranin A, transcript variant mCT14729"
FT                   /note="gene_id=mCG18587.1 transcript_id=mCT14729.1 created
FT                   on 18-MAR-2003"
FT   mRNA            join(14181707..14181908,14182623..14182669,
FT                   14185198..14185291,14186021..14186089,14188083..14188161,
FT                   14189576..14189811,14191369..14191786)
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /product="chromogranin A, transcript variant mCT171200"
FT                   /note="gene_id=mCG18587.1 transcript_id=mCT171200.1 created
FT                   on 18-MAR-2003"
FT   mRNA            join(<14181707..14181908,14182623..14182669,
FT                   14185198..14185291,14186021..14186089,14188106..14188262,
FT                   14188426..14188842,14189356..14189831,14191369..14191786)
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /product="chromogranin A, transcript variant mCT191275"
FT                   /note="gene_id=mCG18587.1 transcript_id=mCT191275.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(14181707..14181908,14182623..14182669,
FT                   14185198..14185330,14188047..14188167,14188190..14188262,
FT                   14188425..14188842,14189356..14189831,14191369..14191765)
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /product="chromogranin A, transcript variant mCT171199"
FT                   /note="gene_id=mCG18587.1 transcript_id=mCT171199.1 created
FT                   on 18-MAR-2003"
FT   CDS             join(14181863..14181908,14182623..14182669,
FT                   14185198..14185291,14186021..14186089,14188083..14188161,
FT                   14189576..14189811,14191369..14191604)
FT                   /codon_start=1
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /product="chromogranin A, isoform CRA_b"
FT                   /note="gene_id=mCG18587.1 transcript_id=mCT171200.1
FT                   protein_id=mCP94118.1 isoform=CRA_b"
FT                   /protein_id="EDL18858.1"
FT   CDS             join(14181863..14181908,14182623..14182669,
FT                   14185198..14185330,14188047..14188167,14188190..14188262,
FT                   14188425..14188842,14189356..14189831,14191369..14191452)
FT                   /codon_start=1
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /product="chromogranin A, isoform CRA_d"
FT                   /note="gene_id=mCG18587.1 transcript_id=mCT171199.1
FT                   protein_id=mCP94117.1 isoform=CRA_d"
FT                   /protein_id="EDL18860.1"
FT                   LQALRRG"
FT   CDS             join(14181863..14181908,14182623..14182669,
FT                   14185198..14185291,14186021..14186089,14188083..14188262,
FT                   14188426..14188842,14189356..14189831,14191369..14191452)
FT                   /codon_start=1
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /product="chromogranin A, isoform CRA_a"
FT                   /note="gene_id=mCG18587.1 transcript_id=mCT14729.1
FT                   protein_id=mCP7064.1 isoform=CRA_a"
FT                   /protein_id="EDL18857.1"
FT                   KVAHQLQALRRG"
FT   CDS             join(<14186063..14186089,14188106..14188262,
FT                   14188426..14188842,14189356..14189831,14191369..14191452)
FT                   /codon_start=1
FT                   /gene="Chga"
FT                   /locus_tag="mCG_18587"
FT                   /product="chromogranin A, isoform CRA_c"
FT                   /note="gene_id=mCG18587.1 transcript_id=mCT191275.0
FT                   protein_id=mCP112236.0 isoform=CRA_c"
FT                   /protein_id="EDL18859.1"
FT   assembly_gap    14194205..14194224
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14196640..14331961)
FT                   /gene="Itpk1"
FT                   /locus_tag="mCG_18584"
FT                   /note="gene_id=mCG18584.1"
FT   mRNA            complement(join(14196640..14197298,14200736..14200898,
FT                   14205919..14205986,14211101..14211266,14215259..14215368,
FT                   14232960..14233077,14250251..14250376,14302526..14302550,
FT                   14331812..14331961))
FT                   /gene="Itpk1"
FT                   /locus_tag="mCG_18584"
FT                   /product="inositol 1,3,4-triphosphate 5/6 kinase,
FT                   transcript variant mCT14726"
FT                   /note="gene_id=mCG18584.1 transcript_id=mCT14726.1 created
FT                   on 24-JAN-2003"
FT   CDS             complement(join(14196940..14197298,14200736..14200898,
FT                   14205919..14205986,14211101..14211266,14215259..14215368,
FT                   14232960..14233077,14250251..14250376,14302526..14302550,
FT                   14331812..14331906))
FT                   /codon_start=1
FT                   /gene="Itpk1"
FT                   /locus_tag="mCG_18584"
FT                   /product="inositol 1,3,4-triphosphate 5/6 kinase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18584.1 transcript_id=mCT14726.1
FT                   protein_id=mCP7085.2 isoform=CRA_a"
FT                   /protein_id="EDL18855.1"
FT                   ASLATKASSQ"
FT   mRNA            complement(join(<14205919..14205986,14211101..14211266,
FT                   14214710..14214750,14215270..14215368,14232960..14233077,
FT                   14250251..14250376,14302526..14302550,14331812..>14331940))
FT                   /gene="Itpk1"
FT                   /locus_tag="mCG_18584"
FT                   /product="inositol 1,3,4-triphosphate 5/6 kinase,
FT                   transcript variant mCT191271"
FT                   /note="gene_id=mCG18584.1 transcript_id=mCT191271.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(<14205919..14205986,14211101..14211266,
FT                   14214710..14214750,14215270..14215368,14232960..14233077,
FT                   14250251..14250376,14302526..14302550,14331812..>14331939))
FT                   /codon_start=1
FT                   /gene="Itpk1"
FT                   /locus_tag="mCG_18584"
FT                   /product="inositol 1,3,4-triphosphate 5/6 kinase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18584.1 transcript_id=mCT191271.0
FT                   protein_id=mCP112235.0 isoform=CRA_b"
FT                   /protein_id="EDL18856.1"
FT   assembly_gap    14221936..14222048
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    14242419..14242472
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    14269230..14269249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14275814..14276155
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    14277030..14277610
FT                   /estimated_length=581
FT                   /gap_type="unknown"
FT   assembly_gap    14287143..14287349
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    14305557..14305602
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    14332026..14332239
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    14341425..14341444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14343395..14343414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14350420..14351508
FT                   /estimated_length=1089
FT                   /gap_type="unknown"
FT   assembly_gap    14352936..14353171
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    14359234..14359253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14363421..14363440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14371468..14388422)
FT                   /gene="Moap1"
FT                   /locus_tag="mCG_18585"
FT                   /note="gene_id=mCG18585.1"
FT   mRNA            complement(join(14371468..14373144,14387290..14388422))
FT                   /gene="Moap1"
FT                   /locus_tag="mCG_18585"
FT                   /product="modulator of apoptosis 1, transcript variant
FT                   mCT14727"
FT                   /note="gene_id=mCG18585.1 transcript_id=mCT14727.1 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(14371486..14373144,14373293..14373395))
FT                   /gene="Moap1"
FT                   /locus_tag="mCG_18585"
FT                   /product="modulator of apoptosis 1, transcript variant
FT                   mCT171198"
FT                   /note="gene_id=mCG18585.1 transcript_id=mCT171198.0 created
FT                   on 24-JUL-2002"
FT   CDS             complement(14371980..14373038)
FT                   /codon_start=1
FT                   /gene="Moap1"
FT                   /locus_tag="mCG_18585"
FT                   /product="modulator of apoptosis 1, isoform CRA_a"
FT                   /note="gene_id=mCG18585.1 transcript_id=mCT14727.1
FT                   protein_id=mCP7063.0 isoform=CRA_a"
FT                   /protein_id="EDL18853.1"
FT                   VLLQAELEGYCT"
FT   CDS             complement(14371980..14373038)
FT                   /codon_start=1
FT                   /gene="Moap1"
FT                   /locus_tag="mCG_18585"
FT                   /product="modulator of apoptosis 1, isoform CRA_a"
FT                   /note="gene_id=mCG18585.1 transcript_id=mCT171198.0
FT                   protein_id=mCP94116.0 isoform=CRA_a"
FT                   /protein_id="EDL18854.1"
FT                   VLLQAELEGYCT"
FT   gene            14387744..14407608
FT                   /gene="5730410I19Rik"
FT                   /locus_tag="mCG_18591"
FT                   /note="gene_id=mCG18591.1"
FT   mRNA            join(14387744..14387927,14391120..14391253,
FT                   14391670..14391730,14393207..14393302,14395557..14395610,
FT                   14395995..14396100,14397819..14398027,14399077..14399226,
FT                   14399764..14399926,14401202..14401263,14405596..14407608)
FT                   /gene="5730410I19Rik"
FT                   /locus_tag="mCG_18591"
FT                   /product="RIKEN cDNA 5730410I19"
FT                   /note="gene_id=mCG18591.1 transcript_id=mCT14733.2 created
FT                   on 24-JAN-2003"
FT   CDS             join(14387778..14387927,14391120..14391253,
FT                   14391670..14391730,14393207..14393302,14395557..14395610,
FT                   14395995..14396100,14397819..14398027,14399077..14399226,
FT                   14399764..14399926,14401202..14401263,14405596..14405688)
FT                   /codon_start=1
FT                   /gene="5730410I19Rik"
FT                   /locus_tag="mCG_18591"
FT                   /product="RIKEN cDNA 5730410I19"
FT                   /note="gene_id=mCG18591.1 transcript_id=mCT14733.2
FT                   protein_id=mCP7061.2"
FT                   /db_xref="GOA:Q52KC0"
FT                   /db_xref="InterPro:IPR003126"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="MGI:MGI:1913872"
FT                   /db_xref="UniProtKB/TrEMBL:Q52KC0"
FT                   /protein_id="EDL18852.1"
FT   assembly_gap    14398550..14398815
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    14403378..14403410
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            complement(14413990..14468553)
FT                   /gene="Btbd7"
FT                   /locus_tag="mCG_18579"
FT                   /note="gene_id=mCG18579.1"
FT   mRNA            complement(join(14413990..14415834,14420607..14420785,
FT                   14423648..14423837,14425119..14425262,14437754..14437914,
FT                   14440974..14441049,14442489..14442697,14467473..14468553))
FT                   /gene="Btbd7"
FT                   /locus_tag="mCG_18579"
FT                   /product="BTB (POZ) domain containing 7"
FT                   /note="gene_id=mCG18579.1 transcript_id=mCT14721.1 created
FT                   on 30-JAN-2003"
FT   CDS             complement(join(14415013..14415834,14420607..14420785,
FT                   14423648..14423837,14425119..14425262,14437754..14437914,
FT                   14440974..14441049,14442489..14442697,14467473..14468379))
FT                   /codon_start=1
FT                   /gene="Btbd7"
FT                   /locus_tag="mCG_18579"
FT                   /product="BTB (POZ) domain containing 7"
FT                   /note="gene_id=mCG18579.1 transcript_id=mCT14721.1
FT                   protein_id=mCP7111.2"
FT                   /protein_id="EDL18851.1"
FT   assembly_gap    14424488..14424507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14427102..14427169
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    14435694..14435713
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14475270..14477179
FT                   /estimated_length=1910
FT                   /gap_type="unknown"
FT   gene            complement(14496310..14497111)
FT                   /locus_tag="mCG_18582"
FT                   /note="gene_id=mCG18582.2"
FT   mRNA            complement(14496310..14497111)
FT                   /locus_tag="mCG_18582"
FT                   /product="mCG18582"
FT                   /note="gene_id=mCG18582.2 transcript_id=mCT14724.2 created
FT                   on 19-FEB-2003"
FT   CDS             complement(14496350..14496904)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18582"
FT                   /product="mCG18582"
FT                   /note="gene_id=mCG18582.2 transcript_id=mCT14724.2
FT                   protein_id=mCP7080.2"
FT                   /protein_id="EDL18850.1"
FT   assembly_gap    14507857..14508310
FT                   /estimated_length=454
FT                   /gap_type="unknown"
FT   gene            14529052..14530293
FT                   /locus_tag="mCG_115382"
FT                   /note="gene_id=mCG115382.0"
FT   mRNA            join(14529052..14529248,14530002..14530293)
FT                   /locus_tag="mCG_115382"
FT                   /product="mCG115382"
FT                   /note="gene_id=mCG115382.0 transcript_id=mCT116485.0
FT                   created on 24-JAN-2003"
FT   CDS             join(14529123..14529248,14530002..14530094)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115382"
FT                   /product="mCG115382"
FT                   /note="gene_id=mCG115382.0 transcript_id=mCT116485.0
FT                   protein_id=mCP50547.1"
FT                   /protein_id="EDL18849.1"
FT   assembly_gap    14536334..14536382
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    14565712..14565731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14579156..14579427
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    14583116..14583135
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14593920..14593939
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14614269..14614288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<14657408..14657888)
FT                   /locus_tag="mCG_1047981"
FT                   /note="gene_id=mCG1047981.1"
FT   mRNA            complement(<14657408..14657888)
FT                   /locus_tag="mCG_1047981"
FT                   /product="mCG1047981"
FT                   /note="gene_id=mCG1047981.1 transcript_id=mCT165685.1
FT                   created on 04-FEB-2003"
FT   CDS             complement(<14657408..14657861)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047981"
FT                   /product="mCG1047981"
FT                   /note="gene_id=mCG1047981.1 transcript_id=mCT165685.1
FT                   protein_id=mCP50149.1"
FT                   /protein_id="EDL18848.1"
FT   assembly_gap    14665388..14665407
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14673236..14673255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14675847..14675876
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   gene            14688384..14813370
FT                   /locus_tag="mCG_18581"
FT                   /note="gene_id=mCG18581.2"
FT   mRNA            join(14688384..14688853,14690649..14690820,
FT                   14692408..14692638,14699321..14699515,14708134..14708361,
FT                   14717889..14718037,14721280..14721437,14721896..14722077,
FT                   14723458..14723659,14724224..14724403,14725817..14725882,
FT                   14733875..14734161,14737382..14737564,14737882..14738044,
FT                   14741288..14742508,14751786..14751893,14755059..14755175,
FT                   14757679..14757762,14761006..14761108,14763855..14763995,
FT                   14765120..14765158,14771133..14771245,14771340..14771425,
FT                   14771948..14772121,14775664..14775732,14778333..14778443,
FT                   14785833..14785937,14795003..14795092,14797648..14797823,
FT                   14798940..14799126,14800945..14801142,14802826..14802903,
FT                   14811534..14811575,14812784..14813370)
FT                   /locus_tag="mCG_18581"
FT                   /product="mCG18581, transcript variant mCT14723"
FT                   /note="gene_id=mCG18581.2 transcript_id=mCT14723.2 created
FT                   on 24-JAN-2003"
FT   CDS             join(14692468..14692638,14699321..14699515,
FT                   14708134..14708361,14717889..14718037,14721280..14721437,
FT                   14721896..14722077,14723458..14723659,14724224..14724403,
FT                   14725817..14725882,14733875..14734161,14737382..14737564,
FT                   14737882..14738044,14741288..14742508,14751786..14751893,
FT                   14755059..14755175,14757679..14757762,14761006..14761108,
FT                   14763855..14763995,14765120..14765158,14771133..14771245,
FT                   14771340..14771425,14771948..14772121,14775664..14775732,
FT                   14778333..14778443,14785833..14785937,14795003..14795092,
FT                   14797648..14797823,14798940..14799126,14800945..14801142,
FT                   14802826..14802903,14811534..14811575,14812784..14812984)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18581"
FT                   /product="mCG18581, isoform CRA_b"
FT                   /note="gene_id=mCG18581.2 transcript_id=mCT14723.2
FT                   protein_id=mCP7060.2 isoform=CRA_b"
FT                   /protein_id="EDL18847.1"
FT   mRNA            join(<14704061..14704276,14708134..14708361,
FT                   14712764..14712905,14717715..14717794,14717889..14718037,
FT                   14721280..14721437,14721896..14722077,14723458..14723659,
FT                   14724224..14724403,14733875..14734161,14737382..14737564,
FT                   14737882..14738044,14741288..14742508,14751786..14751893,
FT                   14757679..14757762,14761006..14761108,14763855..14763995,
FT                   14765120..14765158,14771133..14771245,14771340..14771425,
FT                   14771948..14772121,14775664..14775732,14778333..14778443,
FT                   14785833..14785937,14791186..14791263,14795003..14795092,
FT                   14797648..14797823,14798940..14799126,14800945..14801142,
FT                   14802826..14802903,14811534..14811575,14812784..14813214)
FT                   /locus_tag="mCG_18581"
FT                   /product="mCG18581, transcript variant mCT191263"
FT                   /note="gene_id=mCG18581.2 transcript_id=mCT191263.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<14704061..14704276,14708134..14708361,
FT                   14712764..14712905,14717715..14717794,14717889..14718037,
FT                   14721280..14721437,14721896..14722077,14723458..14723659,
FT                   14724224..14724403,14733875..14734161,14737382..14737564,
FT                   14737882..14738044,14741288..14742508,14751786..14751893,
FT                   14757679..14757762,14761006..14761108,14763855..14763995,
FT                   14765120..14765158,14771133..14771245,14771340..14771425,
FT                   14771948..14772121,14775664..14775732,14778333..14778443,
FT                   14785833..14785937,14791186..14791263,14795003..14795092,
FT                   14797648..14797823,14798940..14799126,14800945..14801142,
FT                   14802826..14802903,14811534..14811575,14812784..14812984)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18581"
FT                   /product="mCG18581, isoform CRA_a"
FT                   /note="gene_id=mCG18581.2 transcript_id=mCT191263.0
FT                   protein_id=mCP112224.0 isoform=CRA_a"
FT                   /protein_id="EDL18846.1"
FT   assembly_gap    14709263..14709284
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    14745636..14746839
FT                   /estimated_length=1204
FT                   /gap_type="unknown"
FT   assembly_gap    14783341..14783360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14785401..14785511
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   gene            complement(14826279..>14871751)
FT                   /locus_tag="mCG_18593"
FT                   /note="gene_id=mCG18593.2"
FT   mRNA            complement(join(14826279..14826722,14831980..14832082,
FT                   14865189..14865324,14870943..14871065,14871678..14871751))
FT                   /locus_tag="mCG_18593"
FT                   /product="mCG18593, transcript variant mCT14757"
FT                   /note="gene_id=mCG18593.2 transcript_id=mCT14757.2 created
FT                   on 21-JAN-2003"
FT   mRNA            complement(join(14826279..14826722,14831980..14832109,
FT                   14865189..14865324,14870943..14871065,14871678..>14871751))
FT                   /locus_tag="mCG_18593"
FT                   /product="mCG18593, transcript variant mCT191239"
FT                   /note="gene_id=mCG18593.2 transcript_id=mCT191239.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(14826279..14826722,14829064..14829234,
FT                   14831980..14832109,14865189..14865324,14870943..14871065,
FT                   14871678..>14871751))
FT                   /locus_tag="mCG_18593"
FT                   /product="mCG18593, transcript variant mCT191238"
FT                   /note="gene_id=mCG18593.2 transcript_id=mCT191238.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(14826620..14826722,14831980..14832109,
FT                   14865189..14865324,14870943..14871065,14871678..>14871749))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18593"
FT                   /product="mCG18593, isoform CRA_b"
FT                   /note="gene_id=mCG18593.2 transcript_id=mCT191239.0
FT                   protein_id=mCP112169.0 isoform=CRA_b"
FT                   /protein_id="EDL18844.1"
FT   CDS             complement(join(14826620..14826722,14831980..14832082,
FT                   14865189..14865324,14870943..14871035))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18593"
FT                   /product="mCG18593, isoform CRA_c"
FT                   /note="gene_id=mCG18593.2 transcript_id=mCT14757.2
FT                   protein_id=mCP7092.2 isoform=CRA_c"
FT                   /protein_id="EDL18845.1"
FT   assembly_gap    14827318..14827381
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   CDS             complement(join(14829219..14829234,14831980..14832109,
FT                   14865189..14865324,14870943..14871065,14871678..>14871749))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18593"
FT                   /product="mCG18593, isoform CRA_a"
FT                   /note="gene_id=mCG18593.2 transcript_id=mCT191238.0
FT                   protein_id=mCP112227.0 isoform=CRA_a"
FT                   /protein_id="EDL18843.1"
FT   assembly_gap    14839201..14839574
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    14890346..14890365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14893359..14894196
FT                   /estimated_length=838
FT                   /gap_type="unknown"
FT   assembly_gap    14923970..14924073
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    14936166..14936189
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    14941320..14941369
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   gene            complement(14941832..>14944235)
FT                   /locus_tag="mCG_144677"
FT                   /note="gene_id=mCG144677.0"
FT   mRNA            complement(join(14941832..14942068,14942191..14942408,
FT                   14943979..>14944235))
FT                   /locus_tag="mCG_144677"
FT                   /product="mCG144677"
FT                   /note="gene_id=mCG144677.0 transcript_id=mCT184101.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(14942403..14942408,14943979..>14944233))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144677"
FT                   /product="mCG144677"
FT                   /note="gene_id=mCG144677.0 transcript_id=mCT184101.0
FT                   protein_id=mCP105371.0"
FT                   /protein_id="EDL18842.1"
FT   assembly_gap    14944806..14944974
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   gene            complement(14950740..14985234)
FT                   /gene="Asb2"
FT                   /locus_tag="mCG_18588"
FT                   /note="gene_id=mCG18588.1"
FT   mRNA            complement(join(14950740..14951269,14953362..14953515,
FT                   14954652..14955213,14959944..14960115,14962891..14963136,
FT                   14964448..14964603,14965409..14965575,14967662..14967766,
FT                   14974885..14975161,14984917..14985234))
FT                   /gene="Asb2"
FT                   /locus_tag="mCG_18588"
FT                   /product="ankyrin repeat and SOCS box-containing protein 2"
FT                   /note="gene_id=mCG18588.1 transcript_id=mCT14730.2 created
FT                   on 21-JAN-2003"
FT   CDS             complement(join(14951133..14951269,14953362..14953515,
FT                   14954652..14955213,14959944..14960115,14962891..14963136,
FT                   14964448..14964603,14965409..14965575,14967662..14967766,
FT                   14974885..14975090))
FT                   /codon_start=1
FT                   /gene="Asb2"
FT                   /locus_tag="mCG_18588"
FT                   /product="ankyrin repeat and SOCS box-containing protein 2"
FT                   /note="gene_id=mCG18588.1 transcript_id=mCT14730.2
FT                   protein_id=mCP7107.1"
FT                   /protein_id="EDL18841.1"
FT   assembly_gap    14967018..14967052
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    15015528..15015594
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            <15017986..15035648
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /note="gene_id=mCG18580.2"
FT   mRNA            join(<15017986..15018178,15021802..15022228,
FT                   15029501..15029596,15030254..15030372,15032122..15032206,
FT                   15032539..15032733,15033531..15035644)
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2,
FT                   transcript variant mCT191261"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT191261.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<15017986..15018066,15030293..15030372,
FT                   15032122..15032206,15032539..15032637,15033531..15034243)
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2,
FT                   transcript variant mCT171196"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT171196.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(<15017986..15018066,15030293..15030372,
FT                   15032122..15032206,15032539..15032637,15033531..15033737)
FT                   /codon_start=1
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT171196.0
FT                   protein_id=mCP94115.0 isoform=CRA_e"
FT                   /protein_id="EDL18840.1"
FT   mRNA            join(15018009..15018178,15029501..15029596,
FT                   15030254..15030372,15032122..15032206,15032539..15032733,
FT                   15033531..15035648)
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2,
FT                   transcript variant mCT14722"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT14722.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(<15018071..15018178,15029501..15029596,
FT                   15030254..15030372,15032122..15032733,15033531..15035642)
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2,
FT                   transcript variant mCT191262"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT191262.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<15018071..15018178,15029501..15029596,
FT                   15030254..15030372,15032122..15032452)
FT                   /codon_start=1
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT191262.0
FT                   protein_id=mCP112223.0 isoform=CRA_c"
FT                   /protein_id="EDL18838.1"
FT   CDS             join(15018176..15018178,15029501..15029596,
FT                   15030254..15030372,15032122..15032206,15032539..15032733,
FT                   15033531..15033737)
FT                   /codon_start=1
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT14722.0
FT                   protein_id=mCP7052.1 isoform=CRA_d"
FT                   /protein_id="EDL18839.1"
FT                   SHYNILYAAEKH"
FT   CDS             join(<15021917..15022228,15029501..15029596,
FT                   15030254..15030372,15032122..15032206,15032539..15032733,
FT                   15033531..15033737)
FT                   /codon_start=1
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT191261.0
FT                   protein_id=mCP112222.0 isoform=CRA_b"
FT                   /protein_id="EDL18837.1"
FT   mRNA            join(<15023204..15023282,15029501..15029596,
FT                   15030254..15030372,15032122..15032206,15032539..15032733,
FT                   15033531..15034018,15034147..15034563)
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2,
FT                   transcript variant mCT171197"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT171197.0 created
FT                   on 24-JUL-2002"
FT   CDS             join(<15023256..15023282,15029501..15029596,
FT                   15030254..15030372,15032122..15032206,15032539..15032733,
FT                   15033531..15033737)
FT                   /codon_start=1
FT                   /gene="Otub2"
FT                   /locus_tag="mCG_18580"
FT                   /product="OTU domain, ubiquitin aldehyde binding 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG18580.2 transcript_id=mCT171197.0
FT                   protein_id=mCP94114.0 isoform=CRA_a"
FT                   /protein_id="EDL18836.1"
FT   gene            complement(15036127..15055152)
FT                   /gene="Ddx24"
FT                   /locus_tag="mCG_18595"
FT                   /note="gene_id=mCG18595.1"
FT   mRNA            complement(join(15036127..15037127,15037287..15037782,
FT                   15039233..15039362,15040434..15040622,15045501..15045576,
FT                   15046583..15047098,15047369..15047522,15048267..15048788,
FT                   15053177..15053902,15055084..15055152))
FT                   /gene="Ddx24"
FT                   /locus_tag="mCG_18595"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 24,
FT                   transcript variant mCT14759"
FT                   /note="gene_id=mCG18595.1 transcript_id=mCT14759.1 created
FT                   on 24-JUL-2002"
FT   mRNA            complement(join(15037289..15037782,15039233..15039362,
FT                   15040434..15040622,15045501..15045576,15046583..15047098,
FT                   15047369..15047522,15048267..15048788,15053177..15053902,
FT                   15054831..>15055085))
FT                   /gene="Ddx24"
FT                   /locus_tag="mCG_18595"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 24,
FT                   transcript variant mCT191246"
FT                   /note="gene_id=mCG18595.1 transcript_id=mCT191246.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(15037517..15037782,15039233..15039362,
FT                   15040434..15040622,15045501..15045576,15046583..15047098,
FT                   15047369..15047522,15048267..15048788,15053177..15053902,
FT                   15054831..>15055083))
FT                   /codon_start=1
FT                   /gene="Ddx24"
FT                   /locus_tag="mCG_18595"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 24,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18595.1 transcript_id=mCT191246.0
FT                   protein_id=mCP112174.0 isoform=CRA_a"
FT                   /protein_id="EDL18834.1"
FT                   EPRAPPQPGSSTS"
FT   CDS             complement(join(15037517..15037782,15039233..15039362,
FT                   15040434..15040622,15045501..15045576,15046583..15047098,
FT                   15047369..15047522,15048267..15048788,15053177..15053897))
FT                   /codon_start=1
FT                   /gene="Ddx24"
FT                   /locus_tag="mCG_18595"
FT                   /product="DEAD (Asp-Glu-Ala-Asp) box polypeptide 24,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18595.1 transcript_id=mCT14759.1
FT                   protein_id=mCP7112.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9ESV0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1351337"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ESV0"
FT                   /protein_id="EDL18835.1"
FT   gene            15063509..15069553
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /note="gene_id=mCG18594.1"
FT   mRNA            join(15063509..15063655,15064727..15064878,
FT                   15065868..15065987,15066699..15066833,15066985..15067014,
FT                   15068710..15068871,15069221..15069553)
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   transcript variant mCT14758"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT14758.2 created
FT                   on 24-JAN-2003"
FT   mRNA            join(<15063516..15063655,15064727..15064878,
FT                   15065868..15065987,15066699..15066833,15066985..15067014,
FT                   15068710..15068871,15069263..15069516)
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   transcript variant mCT191240"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT191240.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<15063516..15063655,15064727..15064878,
FT                   15065868..15065987,15066699..15066833,15068710..15068871,
FT                   15069263..15069516)
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   transcript variant mCT191241"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT191241.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<15063516..15063655,15064727..15064878,
FT                   15065868..15065987,15068710..15068871,15069263..15069516)
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   transcript variant mCT191242"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT191242.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<15063555..15063655,15064727..15064878,
FT                   15065868..15065987,15066985..15067014,15068710..15068871,
FT                   15069263..15069545)
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   transcript variant mCT191243"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT191243.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(15063577..15063655,15064727..15064878,
FT                   15065868..15065987,15066759..15066833,15066985..15067014,
FT                   15068710..15068871,15069263..>15069372)
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   transcript variant mCT179049"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT179049.0 created
FT                   on 24-JAN-2003"
FT   CDS             join(<15064752..15064878,15065868..15065987,
FT                   15066699..15066833,15066985..15067014,15068710..15068871,
FT                   15069263..15069480)
FT                   /codon_start=1
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT191240.0
FT                   protein_id=mCP112170.0 isoform=CRA_c"
FT                   /protein_id="EDL18830.1"
FT   CDS             join(<15064752..15064878,15065868..15065987,
FT                   15066699..15066833,15068710..15068871,15069263..15069480)
FT                   /codon_start=1
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT191241.0
FT                   protein_id=mCP112171.0 isoform=CRA_d"
FT                   /protein_id="EDL18831.1"
FT   CDS             join(<15064752..15064878,15065868..15065987,
FT                   15066985..15067014,15068710..15068871,15069263..15069480)
FT                   /codon_start=1
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   isoform CRA_f"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT191243.0
FT                   protein_id=mCP112173.0 isoform=CRA_f"
FT                   /protein_id="EDL18833.1"
FT   CDS             join(<15064752..15064878,15065868..15065987,
FT                   15068710..15068871,15069263..15069480)
FT                   /codon_start=1
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   isoform CRA_e"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT191242.0
FT                   protein_id=mCP112172.0 isoform=CRA_e"
FT                   /protein_id="EDL18832.1"
FT   CDS             join(15064761..15064878,15065868..15065987,
FT                   15066699..15066833,15066985..15067014,15068710..15068871,
FT                   15069221..15069480)
FT                   /codon_start=1
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT14758.2
FT                   protein_id=mCP7101.2 isoform=CRA_a"
FT                   /protein_id="EDL18828.1"
FT   CDS             join(15064761..15064878,15065868..15065987,
FT                   15066759..15066833,15066985..15067014,15068710..15068871,
FT                   15069263..>15069372)
FT                   /codon_start=1
FT                   /gene="D12Ertd647e"
FT                   /locus_tag="mCG_18594"
FT                   /product="DNA segment, Chr 12, ERATO Doi 647, expressed,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG18594.1 transcript_id=mCT179049.0
FT                   protein_id=mCP101971.0 isoform=CRA_b"
FT                   /protein_id="EDL18829.1"
FT   gene            complement(15071471..15072968)
FT                   /locus_tag="mCG_18586"
FT                   /note="gene_id=mCG18586.1"
FT   mRNA            complement(join(15071471..15071692,15072141..15072302,
FT                   15072791..15072820,15072936..15072968))
FT                   /locus_tag="mCG_18586"
FT                   /product="mCG18586"
FT                   /note="gene_id=mCG18586.1 transcript_id=mCT14728.1 created
FT                   on 30-JAN-2003"
FT   CDS             complement(join(15071619..15071692,15072141..15072302,
FT                   15072791..15072820,15072936..15072942))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18586"
FT                   /product="mCG18586"
FT                   /note="gene_id=mCG18586.1 transcript_id=mCT14728.1
FT                   protein_id=mCP7098.2"
FT                   /db_xref="GOA:Q8R412"
FT                   /db_xref="InterPro:IPR009311"
FT                   /db_xref="MGI:MGI:1924183"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R412"
FT                   /protein_id="EDL18827.1"
FT   assembly_gap    15073970..15074111
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    15076545..15076564
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15080203..15086528)
FT                   /locus_tag="mCG_18592"
FT                   /note="gene_id=mCG18592.1"
FT   mRNA            complement(join(15080203..15080656,15081110..15081271,
FT                   15081775..15081804,15085026..15085208,15085662..15085823,
FT                   15086319..15086348,15086457..15086528))
FT                   /locus_tag="mCG_18592"
FT                   /product="mCG18592"
FT                   /note="gene_id=mCG18592.1 transcript_id=mCT14734.1 created
FT                   on 21-JAN-2003"
FT   CDS             complement(join(15080379..15080656,15081110..15081271,
FT                   15081775..15081804,15085026..15085208,15085662..15085823,
FT                   15086319..15086348,15086457..15086463))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18592"
FT                   /product="mCG18592"
FT                   /note="gene_id=mCG18592.1 transcript_id=mCT14734.1
FT                   protein_id=mCP7089.2"
FT                   /db_xref="GOA:Q8VC49"
FT                   /db_xref="InterPro:IPR009311"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="MGI:MGI:1916390"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VC49"
FT                   /protein_id="EDL18826.1"
FT                   EK"
FT   assembly_gap    15093517..15095443
FT                   /estimated_length=1927
FT                   /gap_type="unknown"
FT   assembly_gap    15161172..15161276
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            <15161367..15242572
FT                   /gene="8430415E04Rik"
FT                   /locus_tag="mCG_8143"
FT                   /note="gene_id=mCG8143.2"
FT   mRNA            join(<15161367..15161546,15162875..15162948,
FT                   15187161..15187263,15205079..15205226,15205633..15205706,
FT                   15207790..15207896,15210177..15210284,15212854..15212975,
FT                   15214505..15214627,15215749..15215918,15216235..15216354,
FT                   15219577..15219654,15220325..15220408,15221798..15221980,
FT                   15225130..15225235,15226840..15226987,15229103..15229247,
FT                   15230102..15230143,15230227..15230301,15231690..15231759,
FT                   15232711..15232797,15233706..15233799,15235640..15235710,
FT                   15239272..15239419,15241547..15242488)
FT                   /gene="8430415E04Rik"
FT                   /locus_tag="mCG_8143"
FT                   /product="RIKEN cDNA 8430415E04, transcript variant
FT                   mCT191268"
FT                   /note="gene_id=mCG8143.2 transcript_id=mCT191268.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<15161367..15161546,15162875..15162948,
FT                   15187161..15187263,15205079..15205226,15205633..15205706,
FT                   15207790..15207896,15210177..15210284,15212854..15212975,
FT                   15214505..15214627,15215749..15215918,15216235..15216354,
FT                   15219577..15219654,15220325..15220408,15221798..15221980,
FT                   15225130..15225235,15226840..15226987,15229103..15229247,
FT                   15230102..15230143,15230227..15230301,15231690..15231759,
FT                   15232711..15232797,15233706..15233799,15235640..15235710,
FT                   15239272..15239419,15241547..15241571)
FT                   /codon_start=1
FT                   /gene="8430415E04Rik"
FT                   /locus_tag="mCG_8143"
FT                   /product="RIKEN cDNA 8430415E04, isoform CRA_a"
FT                   /note="gene_id=mCG8143.2 transcript_id=mCT191268.0
FT                   protein_id=mCP112192.0 isoform=CRA_a"
FT                   /protein_id="EDL18824.1"
FT   mRNA            join(15161368..15161546,15162875..15162948,
FT                   15187161..15187263,15205079..15205226,15205633..15205706,
FT                   15207790..15207896,15210177..15210284,15212854..15212975,
FT                   15215749..15215918,15216235..15216354,15219577..15219654,
FT                   15220325..15220408,15221798..15221980,15225130..15225235,
FT                   15226840..15226987,15229103..15229247,15230102..15230143,
FT                   15230227..15230301,15231690..15231759,15232711..15232797,
FT                   15233706..15233799,15235640..15235710,15239272..15239358,
FT                   15241547..15242572)
FT                   /gene="8430415E04Rik"
FT                   /locus_tag="mCG_8143"
FT                   /product="RIKEN cDNA 8430415E04, transcript variant
FT                   mCT7723"
FT                   /note="gene_id=mCG8143.2 transcript_id=mCT7723.2 created on
FT                   30-JAN-2003"
FT   CDS             join(15161424..15161546,15162875..15162948,
FT                   15187161..15187263,15205079..15205226,15205633..15205706,
FT                   15207790..15207896,15210177..15210284,15212854..15212975,
FT                   15215749..15215918,15216235..15216354,15219577..15219654,
FT                   15220325..15220408,15221798..15221980,15225130..15225235,
FT                   15226840..15226987,15229103..15229247,15230102..15230143,
FT                   15230227..15230301,15231690..15231759,15232711..15232797,
FT                   15233706..15233799,15235640..15235710,15239272..15239358,
FT                   15241547..15241587)
FT                   /codon_start=1
FT                   /gene="8430415E04Rik"
FT                   /locus_tag="mCG_8143"
FT                   /product="RIKEN cDNA 8430415E04, isoform CRA_b"
FT                   /note="gene_id=mCG8143.2 transcript_id=mCT7723.2
FT                   protein_id=mCP11169.2 isoform=CRA_b"
FT                   /protein_id="EDL18825.1"
FT                   ILKSTAW"
FT   assembly_gap    15188365..15188384
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15222958..15223544
FT                   /estimated_length=587
FT                   /gap_type="unknown"
FT   assembly_gap    15245033..15245234
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   gene            complement(15245500..>15260273)
FT                   /gene="Serpina10"
FT                   /locus_tag="mCG_142436"
FT                   /note="gene_id=mCG142436.1"
FT   mRNA            complement(join(15245500..15245851,15253161..15253311,
FT                   15255439..15255712,15257058..15257826,15260213..>15260273))
FT                   /gene="Serpina10"
FT                   /locus_tag="mCG_142436"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 10,
FT                   transcript variant mCT191279"
FT                   /note="gene_id=mCG142436.1 transcript_id=mCT191279.0
FT                   created on 09-MAR-2004"
FT   mRNA            complement(join(15245500..15245851,15253161..15253311,
FT                   15255439..15255550,15257058..15257826,15260213..15260250))
FT                   /gene="Serpina10"
FT                   /locus_tag="mCG_142436"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 10,
FT                   transcript variant mCT180474"
FT                   /note="gene_id=mCG142436.1 transcript_id=mCT180474.0
FT                   created on 11-FEB-2003"
FT   CDS             complement(join(15245660..15245851,15253161..15253311,
FT                   15255439..15255712,15257058..15257826,15260213..>15260272))
FT                   /codon_start=1
FT                   /gene="Serpina10"
FT                   /locus_tag="mCG_142436"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 10, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG142436.1 transcript_id=mCT191279.0
FT                   protein_id=mCP112232.0 isoform=CRA_a"
FT                   /protein_id="EDL18822.1"
FT   CDS             complement(join(15245660..15245851,15253161..15253311,
FT                   15255439..15255550,15257058..15257787))
FT                   /codon_start=1
FT                   /gene="Serpina10"
FT                   /locus_tag="mCG_142436"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 10, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG142436.1 transcript_id=mCT180474.0
FT                   protein_id=mCP103396.0 isoform=CRA_b"
FT                   /protein_id="EDL18823.1"
FT   assembly_gap    15252397..15252416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15275461..15285924)
FT                   /gene="Serpina6"
FT                   /locus_tag="mCG_8141"
FT                   /note="gene_id=mCG8141.1"
FT   mRNA            complement(join(15275461..15275860,15277407..15277551,
FT                   15280543..15280813,15282750..15283360,15285890..15285924))
FT                   /gene="Serpina6"
FT                   /locus_tag="mCG_8141"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 6"
FT                   /note="gene_id=mCG8141.1 transcript_id=mCT7721.0 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(15275675..15275860,15277407..15277551,
FT                   15280543..15280813,15282750..15283341))
FT                   /codon_start=1
FT                   /gene="Serpina6"
FT                   /locus_tag="mCG_8141"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 6"
FT                   /note="gene_id=mCG8141.1 transcript_id=mCT7721.0
FT                   protein_id=mCP11167.1"
FT                   /protein_id="EDL18821.1"
FT   assembly_gap    15278023..15278115
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   gene            complement(15318338..15323419)
FT                   /gene="Serpina1f"
FT                   /locus_tag="mCG_8142"
FT                   /note="gene_id=mCG8142.1"
FT   mRNA            complement(join(15318338..15318621,15319466..15319610,
FT                   15320444..15320717,15322095..15322723,15323298..15323419))
FT                   /gene="Serpina1f"
FT                   /locus_tag="mCG_8142"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 1f"
FT                   /note="gene_id=mCG8142.1 transcript_id=mCT7722.1 created on
FT                   24-JAN-2003"
FT   CDS             complement(join(15318433..15318621,15319466..15319610,
FT                   15320444..15320717,15322095..15322722))
FT                   /codon_start=1
FT                   /gene="Serpina1f"
FT                   /locus_tag="mCG_8142"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 1f"
FT                   /note="gene_id=mCG8142.1 transcript_id=mCT7722.1
FT                   protein_id=mCP11168.2"
FT                   /db_xref="GOA:G3X9Z5"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:1915598"
FT                   /db_xref="UniProtKB/TrEMBL:G3X9Z5"
FT                   /protein_id="EDL18820.1"
FT                   PLFLGRVVNPQN"
FT   assembly_gap    15328482..15328633
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    15340703..15340722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15344272..15344572
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    15348379..15349326
FT                   /estimated_length=948
FT                   /gap_type="unknown"
FT   assembly_gap    15357462..15360743
FT                   /estimated_length=3282
FT                   /gap_type="unknown"
FT   gene            complement(15360744..15367448)
FT                   /locus_tag="mCG_131454"
FT                   /note="gene_id=mCG131454.2"
FT   mRNA            complement(join(15360744..15361244,15367218..15367448))
FT                   /locus_tag="mCG_131454"
FT                   /product="mCG131454"
FT                   /note="gene_id=mCG131454.2 transcript_id=mCT132789.2
FT                   created on 01-DEC-2004"
FT   CDS             complement(15360962..15361240)
FT                   /codon_start=1
FT                   /locus_tag="mCG_131454"
FT                   /product="mCG131454"
FT                   /note="gene_id=mCG131454.2 transcript_id=mCT132789.2
FT                   protein_id=mCP50151.2"
FT                   /protein_id="EDL18819.1"
FT   assembly_gap    15362367..15363090
FT                   /estimated_length=724
FT                   /gap_type="unknown"
FT   assembly_gap    15365893..15366772
FT                   /estimated_length=880
FT                   /gap_type="unknown"
FT   assembly_gap    15368848..15372397
FT                   /estimated_length=3550
FT                   /gap_type="unknown"
FT   assembly_gap    15374193..15374574
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   assembly_gap    15377904..15377923
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15379271..15379290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15380490..15410665
FT                   /estimated_length=30176
FT                   /gap_type="unknown"
FT   assembly_gap    15411852..15411871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15414434..15414920
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    15421108..15421936
FT                   /estimated_length=829
FT                   /gap_type="unknown"
FT   assembly_gap    15424561..15425614
FT                   /estimated_length=1054
FT                   /gap_type="unknown"
FT   assembly_gap    15431158..15432707
FT                   /estimated_length=1550
FT                   /gap_type="unknown"
FT   assembly_gap    15437733..15437752
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15440976..15440995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15442475..15442494
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15445175..15445536
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   gene            complement(15446342..15450688)
FT                   /locus_tag="mCG_1051006"
FT                   /note="gene_id=mCG1051006.0"
FT   mRNA            complement(join(15446342..15446618,15447458..15447608,
FT                   15448494..15448764,15450225..15450688))
FT                   /locus_tag="mCG_1051006"
FT                   /product="mCG1051006"
FT                   /note="gene_id=mCG1051006.0 transcript_id=mCT194795.0
FT                   created on 27-JAN-2005"
FT   CDS             complement(join(15446427..15446618,15447458..15447608,
FT                   15448494..15448681))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051006"
FT                   /product="mCG1051006"
FT                   /note="gene_id=mCG1051006.0 transcript_id=mCT194795.0
FT                   protein_id=mCP115824.0"
FT                   /protein_id="EDL18818.1"
FT                   PIFLGKVVDPTHK"
FT   assembly_gap    15447097..15447165
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    15450689..15452156
FT                   /estimated_length=1468
FT                   /gap_type="unknown"
FT   assembly_gap    15462697..15462716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<15463102..>15471187)
FT                   /locus_tag="mCG_131455"
FT                   /note="gene_id=mCG131455.0"
FT   mRNA            complement(join(<15463102..15463296,15464014..15464106,
FT                   15464533..15464690,15470539..>15471187))
FT                   /locus_tag="mCG_131455"
FT                   /product="mCG131455"
FT                   /note="gene_id=mCG131455.0 transcript_id=mCT132790.0
FT                   created on 30-JAN-2003"
FT   CDS             complement(join(15463102..15463296,15464014..15464106,
FT                   15464533..15464690,15470539..15471187))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131455"
FT                   /product="mCG131455"
FT                   /note="gene_id=mCG131455.0 transcript_id=mCT132790.0
FT                   protein_id=mCP50157.0"
FT                   /protein_id="EDL18817.1"
FT   assembly_gap    15468761..15469629
FT                   /estimated_length=869
FT                   /gap_type="unknown"
FT   assembly_gap    15472804..15472823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15474104..15474329
FT                   /estimated_length=226
FT                   /gap_type="unknown"
FT   assembly_gap    15475688..15476222
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   assembly_gap    15477536..15478866
FT                   /estimated_length=1331
FT                   /gap_type="unknown"
FT   assembly_gap    15480507..15511281
FT                   /estimated_length=30775
FT                   /gap_type="unknown"
FT   assembly_gap    15516352..15516583
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    15518889..15519271
FT                   /estimated_length=383
FT                   /gap_type="unknown"
FT   assembly_gap    15520896..15521099
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    15525085..15525104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15525974..>15529776)
FT                   /locus_tag="mCG_131451"
FT                   /note="gene_id=mCG131451.0"
FT   mRNA            complement(join(15525974..15526249,15526949..15527099,
FT                   15527985..15528255,15529706..>15529776))
FT                   /locus_tag="mCG_131451"
FT                   /product="mCG131451"
FT                   /note="gene_id=mCG131451.0 transcript_id=mCT132786.1
FT                   created on 01-DEC-2004"
FT   CDS             complement(join(15526058..15526249,15526949..15527099,
FT                   15527985..15528255,15529706..>15529760))
FT                   /codon_start=1
FT                   /locus_tag="mCG_131451"
FT                   /product="mCG131451"
FT                   /note="gene_id=mCG131451.0 transcript_id=mCT132786.1
FT                   protein_id=mCP50401.2"
FT                   /protein_id="EDL18816.1"
FT                   "
FT   assembly_gap    15526255..15526419
FT                   /estimated_length=165
FT                   /gap_type="unknown"
FT   assembly_gap    15529777..15531748
FT                   /estimated_length=1972
FT                   /gap_type="unknown"
FT   assembly_gap    15540298..15541075
FT                   /estimated_length=778
FT                   /gap_type="unknown"
FT   assembly_gap    15542633..15544664
FT                   /estimated_length=2032
FT                   /gap_type="unknown"
FT   assembly_gap    15546285..15546445
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    15547767..15548244
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   gene            complement(15549474..15588282)
FT                   /locus_tag="mCG_117393"
FT                   /note="gene_id=mCG117393.1"
FT   mRNA            complement(join(15549474..15549585,15578472..15578594,
FT                   15580058..15580689,15586132..15586154))
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, transcript variant mCT171240"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT171240.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(15549500..15549585,15578472..15578594,
FT                   15580058..15580685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, isoform CRA_d"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT171240.0
FT                   protein_id=mCP94158.0 isoform=CRA_d"
FT                   /protein_id="EDL18814.1"
FT   assembly_gap    15549984..15551083
FT                   /estimated_length=1100
FT                   /gap_type="unknown"
FT   assembly_gap    15556900..15559758
FT                   /estimated_length=2859
FT                   /gap_type="unknown"
FT   assembly_gap    15560934..15561592
FT                   /estimated_length=659
FT                   /gap_type="unknown"
FT   assembly_gap    15570562..15571014
FT                   /estimated_length=453
FT                   /gap_type="unknown"
FT   mRNA            complement(join(15576182..15576460,15577291..15577441,
FT                   15578324..15578448,15580299..15580689,15588009..15588282))
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, transcript variant mCT118539"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT118539.1
FT                   created on 24-JUL-2002"
FT   mRNA            complement(join(15576182..15576460,15577291..15577441,
FT                   15578324..15578594,15580058..15580689,15588009..15588133))
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, transcript variant mCT118531"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT118531.1
FT                   created on 24-JUL-2002"
FT   mRNA            complement(join(15576182..15576460,15577291..15577441,
FT                   15578324..15578594,15580058..15580689,15586135..15586160))
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, transcript variant mCT118538"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT118538.0
FT                   created on 24-JUL-2002"
FT   mRNA            complement(join(15576185..15576460,15577291..15577441,
FT                   15578324..15578594,15580058..15580691,15581396..15581623,
FT                   15586150..15586180))
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, transcript variant mCT118530"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT118530.1
FT                   created on 24-JUL-2002"
FT   mRNA            complement(join(15576185..15576350,15578571..15578594,
FT                   15580058..15580689,15583043..15583257,15586132..15586155))
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, transcript variant mCT171241"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT171241.0
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(15576269..15576460,15577291..15577441,
FT                   15578324..15578448,15580299..15580685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, isoform CRA_b"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT118539.1
FT                   protein_id=mCP50539.1 isoform=CRA_b"
FT                   /protein_id="EDL18812.1"
FT                   THK"
FT   CDS             complement(join(15576269..15576460,15577291..15577441,
FT                   15578324..15578594,15580058..15580685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, isoform CRA_a"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT118530.1
FT                   protein_id=mCP50492.1 isoform=CRA_a"
FT                   /protein_id="EDL18810.1"
FT                   SPLFVGKVVDPTHK"
FT   CDS             complement(join(15576269..15576460,15577291..15577441,
FT                   15578324..15578594,15580058..15580685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, isoform CRA_a"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT118531.1
FT                   protein_id=mCP50496.1 isoform=CRA_a"
FT                   /protein_id="EDL18811.1"
FT                   SPLFVGKVVDPTHK"
FT   CDS             complement(join(15576269..15576460,15577291..15577441,
FT                   15578324..15578594,15580058..15580685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, isoform CRA_a"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT118538.0
FT                   protein_id=mCP50538.1 isoform=CRA_a"
FT                   /protein_id="EDL18815.1"
FT                   SPLFVGKVVDPTHK"
FT   CDS             complement(join(15576334..15576350,15578571..15578594,
FT                   15580058..15580685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117393"
FT                   /product="mCG117393, isoform CRA_c"
FT                   /note="gene_id=mCG117393.1 transcript_id=mCT171241.0
FT                   protein_id=mCP94159.0 isoform=CRA_c"
FT                   /protein_id="EDL18813.1"
FT                   "
FT   assembly_gap    15577246..15577265
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15588762..15588781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15595151..15596724
FT                   /estimated_length=1574
FT                   /gap_type="unknown"
FT   gene            complement(15610179..15619721)
FT                   /gene="Serpina11"
FT                   /locus_tag="mCG_117405"
FT                   /note="gene_id=mCG117405.0"
FT   mRNA            complement(join(15610179..15610484,15612757..15612904,
FT                   15614438..15614711,15615760..15616411,15619657..15619721))
FT                   /gene="Serpina11"
FT                   /locus_tag="mCG_117405"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 11,
FT                   transcript variant mCT118545"
FT                   /note="gene_id=mCG117405.0 transcript_id=mCT118545.0
FT                   created on 27-JAN-2003"
FT   mRNA            complement(join(15610179..15610484,15612757..15612904,
FT                   15614438..15614711,15615760..15616411,15619629..>15619689))
FT                   /gene="Serpina11"
FT                   /locus_tag="mCG_117405"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 11,
FT                   transcript variant mCT191249"
FT                   /note="gene_id=mCG117405.0 transcript_id=mCT191249.0
FT                   created on 09-MAR-2004"
FT   CDS             complement(join(15610281..15610484,15612757..15612904,
FT                   15614438..15614711,15615760..15616411,15619629..>15619652))
FT                   /codon_start=1
FT                   /gene="Serpina11"
FT                   /locus_tag="mCG_117405"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 11, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG117405.0 transcript_id=mCT191249.0
FT                   protein_id=mCP112200.0 isoform=CRA_b"
FT                   /protein_id="EDL18809.1"
FT   CDS             complement(join(15610281..15610484,15612757..15612904,
FT                   15614438..15614711,15615760..15616411))
FT                   /codon_start=1
FT                   /gene="Serpina11"
FT                   /locus_tag="mCG_117405"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 11, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG117405.0 transcript_id=mCT118545.0
FT                   protein_id=mCP50313.1 isoform=CRA_a"
FT                   /protein_id="EDL18808.1"
FT   assembly_gap    15621189..15621456
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    15625987..15626310
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   gene            complement(15626561..15644208)
FT                   /gene="Serpina9"
FT                   /locus_tag="mCG_3348"
FT                   /note="gene_id=mCG3348.2"
FT   mRNA            complement(join(15626561..15627131,15628728..15628875,
FT                   15631827..15632100,15638858..15639507,15644159..15644208))
FT                   /gene="Serpina9"
FT                   /locus_tag="mCG_3348"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 9"
FT                   /note="gene_id=mCG3348.2 transcript_id=mCT2251.2 created on
FT                   21-JAN-2003"
FT   CDS             complement(join(15626931..15627131,15628728..15628875,
FT                   15631827..15632100,15638858..15639491))
FT                   /codon_start=1
FT                   /gene="Serpina9"
FT                   /locus_tag="mCG_3348"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 9"
FT                   /note="gene_id=mCG3348.2 transcript_id=mCT2251.2
FT                   protein_id=mCP20609.2"
FT                   /protein_id="EDL18807.1"
FT   assembly_gap    15627681..15628461
FT                   /estimated_length=781
FT                   /gap_type="unknown"
FT   assembly_gap    15654712..15654731
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15659437..15675560)
FT                   /gene="Serpina12"
FT                   /locus_tag="mCG_3336"
FT                   /note="gene_id=mCG3336.1"
FT   mRNA            complement(join(15659437..15661875,15663207..15663354,
FT                   15666657..15666927,15668841..15669491,15675380..15675560))
FT                   /gene="Serpina12"
FT                   /locus_tag="mCG_3336"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 12"
FT                   /note="gene_id=mCG3336.1 transcript_id=mCT2264.1 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(15661687..15661875,15663207..15663354,
FT                   15666657..15666927,15668841..15669474))
FT                   /codon_start=1
FT                   /gene="Serpina12"
FT                   /locus_tag="mCG_3336"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade A
FT                   (alpha-1 antiproteinase, antitrypsin), member 12"
FT                   /note="gene_id=mCG3336.1 transcript_id=mCT2264.1
FT                   protein_id=mCP20623.2"
FT                   /protein_id="EDL18806.1"
FT                   PSMIFLARVYDPSG"
FT   assembly_gap    15662052..15662164
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    15693302..15693454
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    15696508..15696717
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    15702110..15702592
FT                   /estimated_length=483
FT                   /gap_type="unknown"
FT   gene            15709290..15717772
FT                   /locus_tag="mCG_3335"
FT                   /note="gene_id=mCG3335.2"
FT   mRNA            join(15709290..15709445,15711496..15712154,
FT                   15714470..15714740,15717369..15717772)
FT                   /locus_tag="mCG_3335"
FT                   /product="mCG3335"
FT                   /note="gene_id=mCG3335.2 transcript_id=mCT2268.2 created on
FT                   24-JAN-2003"
FT   CDS             join(15712124..15712154,15714470..15714740,
FT                   15717369..15717390)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3335"
FT                   /product="mCG3335"
FT                   /note="gene_id=mCG3335.2 transcript_id=mCT2268.2
FT                   protein_id=mCP20613.2"
FT                   /protein_id="EDL18805.1"
FT                   RPP"
FT   gene            15730966..15735963
FT                   /gene="Serpina5"
FT                   /locus_tag="mCG_117398"
FT                   /note="gene_id=mCG117398.0"
FT   mRNA            join(15730966..15731076,15731486..15732111,
FT                   15732972..15733242,15733558..15733705,15734995..15735963)
FT                   /gene="Serpina5"
FT                   /locus_tag="mCG_117398"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 5"
FT                   /note="gene_id=mCG117398.0 transcript_id=mCT118536.0
FT                   created on 24-JUL-2002"
FT   CDS             join(15731499..15732111,15732972..15733242,
FT                   15733558..15733705,15734995..15735180)
FT                   /codon_start=1
FT                   /gene="Serpina5"
FT                   /locus_tag="mCG_117398"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 5"
FT                   /note="gene_id=mCG117398.0 transcript_id=mCT118536.0
FT                   protein_id=mCP50521.1"
FT                   /db_xref="GOA:P70458"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:107817"
FT                   /db_xref="UniProtKB/Swiss-Prot:P70458"
FT                   /protein_id="EDL18804.1"
FT                   GKVTRP"
FT   assembly_gap    15737739..15737758
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15742592..15742611
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <15743246..15752734
FT                   /locus_tag="mCG_3338"
FT                   /note="gene_id=mCG3338.1"
FT   mRNA            join(<15743246..15743351,15749278..15749551,
FT                   15750492..15750642,15752156..15752734)
FT                   /locus_tag="mCG_3338"
FT                   /product="mCG3338"
FT                   /note="gene_id=mCG3338.1 transcript_id=mCT2262.2 created on
FT                   24-JUL-2002"
FT   assembly_gap    15743977..15743996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<15749280..15749551,15750492..15750642,
FT                   15752156..15752356)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3338"
FT                   /product="mCG3338"
FT                   /note="gene_id=mCG3338.1 transcript_id=mCT2262.2
FT                   protein_id=mCP20592.2"
FT                   /protein_id="EDL18803.1"
FT   gene            15758831..15770376
FT                   /gene="Serpina3b"
FT                   /locus_tag="mCG_3341"
FT                   /note="gene_id=mCG3341.2"
FT   mRNA            join(15758831..15758912,15761288..15761936,
FT                   15763703..15763976,15764910..15765060,15769460..15770376)
FT                   /gene="Serpina3b"
FT                   /locus_tag="mCG_3341"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 3B"
FT                   /note="gene_id=mCG3341.2 transcript_id=mCT2259.2 created on
FT                   24-JAN-2003"
FT   CDS             join(15761300..15761936,15763703..15763976,
FT                   15764910..15765060,15769460..15769660)
FT                   /codon_start=1
FT                   /gene="Serpina3b"
FT                   /locus_tag="mCG_3341"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 3B"
FT                   /note="gene_id=mCG3341.2 transcript_id=mCT2259.2
FT                   protein_id=mCP20597.2"
FT                   /db_xref="GOA:Q05A44"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:2182835"
FT                   /db_xref="UniProtKB/TrEMBL:Q05A44"
FT                   /protein_id="EDL18802.1"
FT   gene            complement(15777720..15784685)
FT                   /locus_tag="mCG_3340"
FT                   /note="gene_id=mCG3340.1"
FT   mRNA            complement(join(15777720..15778236,15779127..15779277,
FT                   15780186..15780459,15782254..15782907,15784592..15784685))
FT                   /locus_tag="mCG_3340"
FT                   /product="mCG3340, transcript variant mCT2261"
FT                   /note="gene_id=mCG3340.1 transcript_id=mCT2261.1 created on
FT                   15-JUL-2003"
FT   mRNA            complement(join(15777791..15777976,15780186..15780459,
FT                   15782254..15782907,15784592..15784685))
FT                   /locus_tag="mCG_3340"
FT                   /product="mCG3340, transcript variant mCT171204"
FT                   /note="gene_id=mCG3340.1 transcript_id=mCT171204.1 created
FT                   on 15-JUL-2003"
FT   CDS             complement(join(15777919..15777976,15780186..15780459,
FT                   15782254..15782890))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3340"
FT                   /product="mCG3340, isoform CRA_a"
FT                   /note="gene_id=mCG3340.1 transcript_id=mCT171204.1
FT                   protein_id=mCP94122.1 isoform=CRA_a"
FT                   /protein_id="EDL18800.1"
FT   CDS             complement(join(15778045..15778236,15779127..15779277,
FT                   15780186..15780459,15782254..15782890))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3340"
FT                   /product="mCG3340, isoform CRA_b"
FT                   /note="gene_id=mCG3340.1 transcript_id=mCT2261.1
FT                   protein_id=mCP20593.2 isoform=CRA_b"
FT                   /protein_id="EDL18801.1"
FT                   TDVQTTLFIAKITHPKRA"
FT   gene            complement(<15804107..15808728)
FT                   /locus_tag="mCG_117403"
FT                   /note="gene_id=mCG117403.0"
FT   mRNA            complement(join(<15804107..15804307,15805274..15805424,
FT                   15806376..15806652,15808458..15808728))
FT                   /locus_tag="mCG_117403"
FT                   /product="mCG117403"
FT                   /note="gene_id=mCG117403.0 transcript_id=mCT118543.0
FT                   created on 24-JAN-2003"
FT   CDS             complement(join(15804107..15804307,15805274..15805424,
FT                   15806376..15806652,15808458..15808488))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117403"
FT                   /product="mCG117403"
FT                   /note="gene_id=mCG117403.0 transcript_id=mCT118543.0
FT                   protein_id=mCP50281.1"
FT                   /protein_id="EDL18799.1"
FT   assembly_gap    15813686..15814678
FT                   /estimated_length=993
FT                   /gap_type="unknown"
FT   gene            complement(<15820471..15823386)
FT                   /locus_tag="mCG_3334"
FT                   /note="gene_id=mCG3334.1"
FT   mRNA            complement(join(<15820471..15820661,15821300..15821450,
FT                   15822275..15822548,15823269..15823386))
FT                   /locus_tag="mCG_3334"
FT                   /product="mCG3334"
FT                   /note="gene_id=mCG3334.1 transcript_id=mCT2267.1 created on
FT                   24-JAN-2003"
FT   CDS             complement(join(<15820471..15820661,15821300..15821450,
FT                   15822275..15822548,15823269..15823299))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3334"
FT                   /product="mCG3334"
FT                   /note="gene_id=mCG3334.1 transcript_id=mCT2267.1
FT                   protein_id=mCP20612.2"
FT                   /protein_id="EDL18798.1"
FT   assembly_gap    15833242..15837734
FT                   /estimated_length=4493
FT                   /gap_type="unknown"
FT   assembly_gap    15843891..15844122
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   gene            15845531..15892101
FT                   /locus_tag="mCG_117402"
FT                   /note="gene_id=mCG117402.0"
FT   mRNA            join(15845531..15845595,15847844..15848462,
FT                   15849181..15849454,15850394..15850544,15851184..15851271,
FT                   15875467..15876009,15876724..15876997,15877936..15878086,
FT                   15878725..15878938,15879417..15879465,15887897..15888166,
FT                   15888178..15888449,15889164..15889437,15890377..15890527,
FT                   15891167..15892101)
FT                   /locus_tag="mCG_117402"
FT                   /product="mCG117402"
FT                   /note="gene_id=mCG117402.0 transcript_id=mCT118542.0
FT                   created on 30-JAN-2003"
FT   CDS             join(15847856..15848462,15849181..15849454,
FT                   15850394..15850544,15851184..15851271,15875467..15876009,
FT                   15876724..15876997,15877936..15878086,15878725..15878938,
FT                   15879417..15879465,15887897..15888166,15888178..15888449,
FT                   15889164..15889437,15890377..15890527,15891167..15891361)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117402"
FT                   /product="mCG117402"
FT                   /note="gene_id=mCG117402.0 transcript_id=mCT118542.0
FT                   protein_id=mCP50271.1"
FT                   /protein_id="EDL18797.1"
FT                   TNPK"
FT   assembly_gap    15852879..15853415
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    15856354..15856373
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15860593..15860612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15862402..15862421
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15863483..15863502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15865731..15866790
FT                   /estimated_length=1060
FT                   /gap_type="unknown"
FT   assembly_gap    15867993..15868012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15869228..15869247
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15872097..15872116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15874050..15874151
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            15900847..>15906327
FT                   /locus_tag="mCG_3337"
FT                   /note="gene_id=mCG3337.2"
FT   mRNA            join(15900847..15900906,15902786..15903404,
FT                   15904137..15904410,15905349..15905499,15906137..>15906327)
FT                   /locus_tag="mCG_3337"
FT                   /product="mCG3337"
FT                   /note="gene_id=mCG3337.2 transcript_id=mCT2269.2 created on
FT                   30-JAN-2003"
FT   CDS             join(15902798..15903404,15904137..15904410,
FT                   15905349..15905499,15906137..>15906327)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3337"
FT                   /product="mCG3337"
FT                   /note="gene_id=mCG3337.2 transcript_id=mCT2269.2
FT                   protein_id=mCP20622.2"
FT                   /protein_id="EDL18796.1"
FT                   FMAKVTNP"
FT   assembly_gap    15910363..15911531
FT                   /estimated_length=1169
FT                   /gap_type="unknown"
FT   assembly_gap    15924432..15924451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15926143..15926854
FT                   /estimated_length=712
FT                   /gap_type="unknown"
FT   assembly_gap    15927748..15928210
FT                   /estimated_length=463
FT                   /gap_type="unknown"
FT   gene            <15952206..15958217
FT                   /locus_tag="mCG_54087"
FT                   /note="gene_id=mCG54087.1"
FT   mRNA            join(<15952206..15952842,15954925..15955198,
FT                   15956120..15956270,15957285..15958217)
FT                   /locus_tag="mCG_54087"
FT                   /product="mCG54087"
FT                   /note="gene_id=mCG54087.1 transcript_id=mCT54270.1 created
FT                   on 30-JAN-2003"
FT   CDS             join(15952206..15952842,15954925..15955198,
FT                   15956120..15956270,15957285..15957485)
FT                   /codon_start=1
FT                   /locus_tag="mCG_54087"
FT                   /product="mCG54087"
FT                   /note="gene_id=mCG54087.1 transcript_id=mCT54270.1
FT                   protein_id=mCP40735.1"
FT                   /db_xref="GOA:D3Z451"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:2182843"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z451"
FT                   /protein_id="EDL18795.1"
FT   gene            15976043..15983673
FT                   /locus_tag="mCG_1051009"
FT                   /note="gene_id=mCG1051009.0"
FT   mRNA            join(15976043..15976080,15978029..15978685,
FT                   15980474..15980747,15981662..15981815,15982768..15983673)
FT                   /locus_tag="mCG_1051009"
FT                   /product="mCG1051009"
FT                   /note="gene_id=mCG1051009.0 transcript_id=mCT194798.0
FT                   created on 27-JAN-2005"
FT   CDS             join(15978046..15978685,15980474..15980747,
FT                   15981662..15981815,15982768..15982956)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1051009"
FT                   /product="mCG1051009"
FT                   /note="gene_id=mCG1051009.0 transcript_id=mCT194798.0
FT                   protein_id=mCP115827.0"
FT                   /db_xref="GOA:A0A0R4J0I1"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:98377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J0I1"
FT                   /protein_id="EDL18794.1"
FT   assembly_gap    15989034..15989148
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    15990530..15990549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15991748..15991767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15992832..15992851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16013521..16013540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16022745..16022764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16024117..16024136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16028397..16035489
FT                   /locus_tag="mCG_3344"
FT                   /note="gene_id=mCG3344.2"
FT   mRNA            join(16028397..16028454,16030536..16030942,
FT                   16032686..16032731,16033872..16034022,16034963..16035489)
FT                   /locus_tag="mCG_3344"
FT                   /product="mCG3344, transcript variant mCT171205"
FT                   /note="gene_id=mCG3344.2 transcript_id=mCT171205.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(16028423..16028454,16030294..16030942,
FT                   16032686..16032959,16033872..16034022,16034963..16035488)
FT                   /locus_tag="mCG_3344"
FT                   /product="mCG3344, transcript variant mCT2258"
FT                   /note="gene_id=mCG3344.2 transcript_id=mCT2258.1 created on
FT                   24-JUL-2002"
FT   CDS             join(16030306..16030942,16032686..16032959,
FT                   16033872..16034022,16034963..16035157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3344"
FT                   /product="mCG3344, isoform CRA_b"
FT                   /note="gene_id=mCG3344.2 transcript_id=mCT2258.1
FT                   protein_id=mCP20595.2 isoform=CRA_b"
FT                   /protein_id="EDL18793.1"
FT   CDS             join(16030720..16030942,16032686..16032731,
FT                   16033872..16034022,16034963..16035157)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3344"
FT                   /product="mCG3344, isoform CRA_a"
FT                   /note="gene_id=mCG3344.2 transcript_id=mCT171205.0
FT                   protein_id=mCP94123.0 isoform=CRA_a"
FT                   /protein_id="EDL18792.1"
FT   assembly_gap    16039085..16039104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16049963..16154956
FT                   /gene="Serpina3n"
FT                   /locus_tag="mCG_3346"
FT                   /note="gene_id=mCG3346.2"
FT   mRNA            join(16049963..16050021,16051881..16052540,
FT                   16053215..16053219,16054365..16054452,16054501..16054627,
FT                   16055561..16055711,16056639..16057448)
FT                   /gene="Serpina3n"
FT                   /locus_tag="mCG_3346"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 3N, transcript variant mCT171210"
FT                   /note="gene_id=mCG3346.2 transcript_id=mCT171210.0 created
FT                   on 24-JUL-2002"
FT   mRNA            join(16049978..16050021,16051881..16052534,
FT                   16054354..16054627,16055561..16055711,16056639..16057552,
FT                   16154922..16154956)
FT                   /gene="Serpina3n"
FT                   /locus_tag="mCG_3346"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 3N, transcript variant mCT2257"
FT                   /note="gene_id=mCG3346.2 transcript_id=mCT2257.2 created on
FT                   24-JUL-2002"
FT   CDS             join(16051898..16052540,16053215..16053219,
FT                   16054365..16054452,16054501..16054627,16055561..16055711,
FT                   16056639..16056833)
FT                   /codon_start=1
FT                   /gene="Serpina3n"
FT                   /locus_tag="mCG_3346"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 3N, isoform CRA_b"
FT                   /note="gene_id=mCG3346.2 transcript_id=mCT171210.0
FT                   protein_id=mCP94128.0 isoform=CRA_b"
FT                   /protein_id="EDL18790.1"
FT                   NPK"
FT   CDS             join(16051898..16052534,16054354..16054627,
FT                   16055561..16055711,16056639..16056833)
FT                   /codon_start=1
FT                   /gene="Serpina3n"
FT                   /locus_tag="mCG_3346"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   A, member 3N, isoform CRA_a"
FT                   /note="gene_id=mCG3346.2 transcript_id=mCT2257.2
FT                   protein_id=mCP20605.2 isoform=CRA_a"
FT                   /db_xref="GOA:G3X8T9"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:105045"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8T9"
FT                   /protein_id="EDL18789.1"
FT   assembly_gap    16061095..16061808
FT                   /estimated_length=714
FT                   /gap_type="unknown"
FT   assembly_gap    16064923..16066253
FT                   /estimated_length=1331
FT                   /gap_type="unknown"
FT   assembly_gap    16078027..16078046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16085891..16086467
FT                   /estimated_length=577
FT                   /gap_type="unknown"
FT   gene            complement(16114844..16116871)
FT                   /gene="Gsc"
FT                   /locus_tag="mCG_3347"
FT                   /note="gene_id=mCG3347.0"
FT   mRNA            complement(join(16114844..16115281,16115628..16115887,
FT                   16116396..16116871))
FT                   /gene="Gsc"
FT                   /locus_tag="mCG_3347"
FT                   /product="goosecoid"
FT                   /note="gene_id=mCG3347.0 transcript_id=mCT2255.0 created on
FT                   24-JUL-2002"
FT   CDS             complement(join(16115126..16115281,16115628..16115887,
FT                   16116396..16116750))
FT                   /codon_start=1
FT                   /gene="Gsc"
FT                   /locus_tag="mCG_3347"
FT                   /product="goosecoid"
FT                   /note="gene_id=mCG3347.0 transcript_id=mCT2255.0
FT                   protein_id=mCP20608.1"
FT                   /protein_id="EDL18791.1"
FT   assembly_gap    16117123..16117142
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16143732..16143793
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    16153808..16154036
FT                   /estimated_length=229
FT                   /gap_type="unknown"
FT   assembly_gap    16164335..16164517
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    16187651..16187670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16201960..16202314
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    16205159..16205182
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    16209108..16209127
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16219443..16219513
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    16231732..16231821
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   assembly_gap    16243265..16243296
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    16260381..16260704
FT                   /estimated_length=324
FT                   /gap_type="unknown"
FT   assembly_gap    16262578..16262673
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    16296764..16296783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16315094..16315113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16321411..16321430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16324120..16324141
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   gene            complement(16330794..>16394996)
FT                   /gene="Dicer1"
FT                   /locus_tag="mCG_3343"
FT                   /note="gene_id=mCG3343.2"
FT   mRNA            complement(join(16330794..16334809,16335159..16335234,
FT                   16335335..16335497,16337510..16337778,16339306..16340176,
FT                   16343397..16343552,16345434..16346214,16347098..16347273,
FT                   16347751..16347856,16348085..16348267,16349245..16349398,
FT                   16349583..16349796,16349885..16350064,16351808..16351947,
FT                   16352817..16352892,16353657..16353789,16355213..16355367,
FT                   16356027..16356269,16357806..16357938,16365007..16365479,
FT                   16366938..16367106,16371369..16371529,16372164..16372298,
FT                   16373169..16373299,16374056..16374218,16374836..16375023,
FT                   16394773..>16394996))
FT                   /gene="Dicer1"
FT                   /locus_tag="mCG_3343"
FT                   /product="Dicer1, Dcr-1 homolog (Drosophila), transcript
FT                   variant mCT2265"
FT                   /note="gene_id=mCG3343.2 transcript_id=mCT2265.2 created on
FT                   06-JAN-2003"
FT   mRNA            complement(join(16334490..16334809,16335159..16335234,
FT                   16335335..16335497,16337510..16337778,16339306..16340176,
FT                   16343397..16343552,16345434..16346214,16347098..16347273,
FT                   16347751..16347856,16348085..16348267,16349245..16349398,
FT                   16349583..16349796,16349885..16350064,16351808..16351947,
FT                   16352817..16352892,16353657..16353789,16355213..16355367,
FT                   16356027..16356269,16357806..16357938,16365007..16365479,
FT                   16366938..16367106,16371369..16371529,16372164..16372298,
FT                   16373169..16373299,16374056..16374218,16374836..16375023,
FT                   16394772..>16394909))
FT                   /gene="Dicer1"
FT                   /locus_tag="mCG_3343"
FT                   /product="Dicer1, Dcr-1 homolog (Drosophila), transcript
FT                   variant mCT191255"
FT                   /note="gene_id=mCG3343.2 transcript_id=mCT191255.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(16334644..16334809,16335159..16335234,
FT                   16335335..16335497,16337510..16337778,16339306..16340176,
FT                   16343397..16343552,16345434..16346214,16347098..16347273,
FT                   16347751..16347856,16348085..16348267,16349245..16349398,
FT                   16349583..16349796,16349885..16350064,16351808..16351947,
FT                   16352817..16352892,16353657..16353789,16355213..16355367,
FT                   16356027..16356269,16357806..16357938,16365007..16365479,
FT                   16366938..16367106,16371369..16371529,16372164..16372298,
FT                   16373169..16373299,16374056..16374218,16374836..>16374979))
FT                   /codon_start=1
FT                   /gene="Dicer1"
FT                   /locus_tag="mCG_3343"
FT                   /product="Dicer1, Dcr-1 homolog (Drosophila), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3343.2 transcript_id=mCT191255.0
FT                   protein_id=mCP112186.0 isoform=CRA_a"
FT                   /protein_id="EDL18787.1"
FT   CDS             complement(join(16334644..16334809,16335159..16335234,
FT                   16335335..16335497,16337510..16337778,16339306..16340176,
FT                   16343397..16343552,16345434..16346214,16347098..16347273,
FT                   16347751..16347856,16348085..16348267,16349245..16349398,
FT                   16349583..16349796,16349885..16350064,16351808..16351947,
FT                   16352817..16352892,16353657..16353789,16355213..16355367,
FT                   16356027..16356269,16357806..16357938,16365007..16365479,
FT                   16366938..16367106,16371369..16371529,16372164..16372298,
FT                   16373169..16373299,16374056..16374218,16374836..>16374955))
FT                   /codon_start=1
FT                   /gene="Dicer1"
FT                   /locus_tag="mCG_3343"
FT                   /product="Dicer1, Dcr-1 homolog (Drosophila), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3343.2 transcript_id=mCT2265.2
FT                   protein_id=mCP20599.2 isoform=CRA_b"
FT                   /protein_id="EDL18788.1"
FT   assembly_gap    16334953..16334972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16394912..16394931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16405015..16405333
FT                   /estimated_length=319
FT                   /gap_type="unknown"
FT   gene            complement(16414389..>16509632)
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /note="gene_id=mCG3345.2"
FT   mRNA            complement(join(16414389..16415304,16416523..16416615,
FT                   16417114..16417184,16417830..16417890,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444134,16450856..16450894))
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, transcript variant mCT2256"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT2256.2 created on
FT                   18-MAR-2003"
FT   mRNA            complement(join(16415098..16415304,16417114..16417184,
FT                   16417830..16417890,16420286..16420482,16424063..16425742,
FT                   16427470..16427552,16428956..16429149,16433542..16433732,
FT                   16435398..16435490,16440601..16440684,16444039..16444134,
FT                   16448652..16448713,16509601..16509632))
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, transcript variant mCT171207"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT171207.0 created
FT                   on 18-MAR-2003"
FT   mRNA            complement(join(16415098..16415304,16416519..16416615,
FT                   16417114..16417184,16417830..16417890,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444134,16448652..16448713,16509601..16509632))
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, transcript variant mCT171206"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT171206.0 created
FT                   on 18-MAR-2003"
FT   mRNA            complement(join(16415098..16415304,16417114..16417239,
FT                   16417830..16417890,16420286..16420482,16424063..16425742,
FT                   16427470..16427552,16428956..16429149,16433542..16433732,
FT                   16435398..16435490,16440601..16440684,16444039..16444134,
FT                   16448652..16448713,16509601..>16509632))
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, transcript variant mCT191256"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT191256.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(16415098..16415304,16417114..16417184,
FT                   16417830..16417890,16419189..16419269,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444134,16448652..16448713,16509601..>16509632))
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, transcript variant mCT191258"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT191258.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(16415098..16415304,16416519..16416615,
FT                   16417114..16417184,16417830..16417890,16419189..16419269,
FT                   16420286..16420482,16424063..16425742,16427470..16427552,
FT                   16428956..16429149,16433542..16433732,16435398..16435490,
FT                   16440601..16440684,16444039..16444134,16448652..16448713,
FT                   16509601..16509632))
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, transcript variant mCT171208"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT171208.0 created
FT                   on 18-MAR-2003"
FT   mRNA            complement(join(16415098..16415304,16417114..16417239,
FT                   16417830..16417890,16419189..16419269,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444134,16448652..16448713,16509601..16509632))
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, transcript variant mCT171209"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT171209.0 created
FT                   on 18-MAR-2003"
FT   mRNA            complement(join(16415098..16415304,16416519..16416615,
FT                   16417114..16417239,16417830..16417890,16419189..16419269,
FT                   16420286..16420482,16424063..16425742,16427470..16427552,
FT                   16428956..16429149,16433542..16433732,16435398..16435490,
FT                   16440601..16440684,16444039..16444134,16448652..16448713,
FT                   16509601..>16509632))
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, transcript variant mCT191257"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT191257.0 created
FT                   on 09-MAR-2004"
FT   CDS             complement(join(16415133..16415304,16417114..16417184,
FT                   16417830..16417890,16420286..16420482,16424063..16425742,
FT                   16427470..16427552,16428956..16429149,16433542..16433732,
FT                   16435398..16435490,16440601..16440684,16444039..16444074))
FT                   /codon_start=1
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, isoform CRA_a"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT171207.0
FT                   protein_id=mCP94127.1 isoform=CRA_a"
FT                   /protein_id="EDL18779.1"
FT   CDS             complement(join(16415133..16415304,16416523..16416615,
FT                   16417114..16417184,16417830..16417890,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444074))
FT                   /codon_start=1
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, isoform CRA_f"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT2256.2
FT                   protein_id=mCP20621.3 isoform=CRA_f"
FT                   /protein_id="EDL18786.1"
FT   CDS             complement(join(16415149..16415304,16416519..16416615,
FT                   16417114..16417184,16417830..16417890,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444074))
FT                   /codon_start=1
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, isoform CRA_e"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT171206.0
FT                   protein_id=mCP94124.1 isoform=CRA_e"
FT                   /protein_id="EDL18784.1"
FT   CDS             complement(join(16417222..16417239,16417830..16417890,
FT                   16420286..16420482,16424063..16425742,16427470..16427552,
FT                   16428956..16429149,16433542..16433732,16435398..16435490,
FT                   16440601..16440684,16444039..16444134,16448652..16448713,
FT                   16509601..>16509631))
FT                   /codon_start=1
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, isoform CRA_c"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT191256.0
FT                   protein_id=mCP112187.0 isoform=CRA_c"
FT                   /protein_id="EDL18781.1"
FT   CDS             complement(join(16419248..16419269,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444134,16448652..16448713,16509601..>16509631))
FT                   /codon_start=1
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, isoform CRA_d"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT191257.0
FT                   protein_id=mCP112188.0 isoform=CRA_d"
FT                   /protein_id="EDL18782.1"
FT   CDS             complement(join(16419248..16419269,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444134,16448652..16448713,16509601..>16509631))
FT                   /codon_start=1
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, isoform CRA_d"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT191258.0
FT                   protein_id=mCP112189.0 isoform=CRA_d"
FT                   /protein_id="EDL18783.1"
FT   CDS             complement(join(16419248..16419269,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444074))
FT                   /codon_start=1
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, isoform CRA_b"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT171209.0
FT                   protein_id=mCP94126.1 isoform=CRA_b"
FT                   /protein_id="EDL18780.1"
FT   CDS             complement(join(16419248..16419269,16420286..16420482,
FT                   16424063..16425742,16427470..16427552,16428956..16429149,
FT                   16433542..16433732,16435398..16435490,16440601..16440684,
FT                   16444039..16444074))
FT                   /codon_start=1
FT                   /gene="Clmn"
FT                   /locus_tag="mCG_3345"
FT                   /product="calmin, isoform CRA_b"
FT                   /note="gene_id=mCG3345.2 transcript_id=mCT171208.0
FT                   protein_id=mCP94125.1 isoform=CRA_b"
FT                   /protein_id="EDL18785.1"
FT   assembly_gap    16426584..16426603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16447692..16447711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16449033..16449052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16450651..16450670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16455317..16455398
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    16461515..16461591
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    16475471..16478855
FT                   /estimated_length=3385
FT                   /gap_type="unknown"
FT   assembly_gap    16479892..16479911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16482894..16482913
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16483965..16486681
FT                   /estimated_length=2717
FT                   /gap_type="unknown"
FT   assembly_gap    16487759..16487778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16490780..16490799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16491914..16491933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16509633..16509826
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   gene            16509997..16516255
FT                   /locus_tag="mCG_1048037"
FT                   /note="gene_id=mCG1048037.0"
FT   mRNA            join(16509997..16510164,16515803..16516255)
FT                   /locus_tag="mCG_1048037"
FT                   /product="mCG1048037"
FT                   /note="gene_id=mCG1048037.0 transcript_id=mCT165741.0
FT                   created on 05-FEB-2003"
FT   CDS             16515839..16516030
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048037"
FT                   /product="mCG1048037"
FT                   /note="gene_id=mCG1048037.0 transcript_id=mCT165741.0
FT                   protein_id=mCP50558.1"
FT                   /protein_id="EDL18778.1"
FT                   VSACWGVNSDVYLQMVRH"
FT   assembly_gap    16542817..16543214
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    16549951..16549970
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16550750..16550856
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    16552585..16552604
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16563764..16564125
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    16567627..16567646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16570610..16571017)
FT                   /locus_tag="mCG_1048036"
FT                   /note="gene_id=mCG1048036.1"
FT   mRNA            complement(16570610..16571017)
FT                   /locus_tag="mCG_1048036"
FT                   /product="mCG1048036"
FT                   /note="gene_id=mCG1048036.1 transcript_id=mCT165740.1
FT                   created on 05-FEB-2003"
FT   CDS             complement(16570801..16570845)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048036"
FT                   /product="mCG1048036"
FT                   /note="gene_id=mCG1048036.1 transcript_id=mCT165740.1
FT                   protein_id=mCP50552.1"
FT                   /protein_id="EDL18777.1"
FT                   /translation="MCGVILVHIKSRAD"
FT   gene            complement(16575108..16643684)
FT                   /gene="4831426I19Rik"
FT                   /locus_tag="mCG_51767"
FT                   /note="gene_id=mCG51767.2"
FT   mRNA            complement(join(16575108..16576265,16576411..16577458,
FT                   16584705..16584743,16585730..16585879,16588429..16588587,
FT                   16590021..16590150,16591506..16591678,16591832..16591993,
FT                   16597951..16598085,16599129..16599272,16600493..16600675,
FT                   16602922..16603096,16604365..16604498,16606292..16606639,
FT                   16608137..16608298,16612882..16613191,16614187..16614359,
FT                   16620737..16620894,16642477..16642608,16643538..16643684))
FT                   /gene="4831426I19Rik"
FT                   /locus_tag="mCG_51767"
FT                   /product="RIKEN cDNA 4831426I19"
FT                   /note="gene_id=mCG51767.2 transcript_id=mCT51950.2 created
FT                   on 30-JAN-2003"
FT   assembly_gap    16576266..16576410
FT                   /estimated_length=145
FT                   /gap_type="unknown"
FT   CDS             complement(join(16577252..16577458,16584705..16584743,
FT                   16585730..16585879,16588429..16588587,16590021..16590150,
FT                   16591506..16591678,16591832..16591993,16597951..16598085,
FT                   16599129..16599272,16600493..16600675,16602922..16603096,
FT                   16604365..16604498,16606292..16606639,16608137..16608298,
FT                   16612882..16613191,16614187..16614359,16620737..16620880))
FT                   /codon_start=1
FT                   /gene="4831426I19Rik"
FT                   /locus_tag="mCG_51767"
FT                   /product="RIKEN cDNA 4831426I19"
FT                   /note="gene_id=mCG51767.2 transcript_id=mCT51950.2
FT                   protein_id=mCP40730.2"
FT                   /protein_id="EDL18776.1"
FT   assembly_gap    16582614..16582789
FT                   /estimated_length=176
FT                   /gap_type="unknown"
FT   assembly_gap    16588867..16588899
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    16593161..16593214
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    16605313..16605332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16613712..16613786
FT                   /estimated_length=75
FT                   /gap_type="unknown"
FT   assembly_gap    16631514..16631549
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    16663973..16663992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16675628..16677273)
FT                   /locus_tag="mCG_147636"
FT                   /note="gene_id=mCG147636.0"
FT   mRNA            complement(join(16675628..16675818,16676953..16677273))
FT                   /locus_tag="mCG_147636"
FT                   /product="mCG147636"
FT                   /note="gene_id=mCG147636.0 transcript_id=mCT187899.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(16677046..16677234)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147636"
FT                   /product="mCG147636"
FT                   /note="gene_id=mCG147636.0 transcript_id=mCT187899.0
FT                   protein_id=mCP109012.0"
FT                   /protein_id="EDL18775.1"
FT                   GLPWDSSSRMRFFFFLA"
FT   gene            <16677662..16687221
FT                   /gene="Glrx5"
FT                   /locus_tag="mCG_1145"
FT                   /note="gene_id=mCG1145.2"
FT   mRNA            join(<16677662..16677851,16677928..16677975,
FT                   16685268..16685696)
FT                   /gene="Glrx5"
FT                   /locus_tag="mCG_1145"
FT                   /product="glutaredoxin 5 homolog (S. cerevisiae),
FT                   transcript variant mCT178207"
FT                   /note="gene_id=mCG1145.2 transcript_id=mCT178207.0 created
FT                   on 31-DEC-2002"
FT   CDS             join(<16677662..16677851,16677928..16677975,
FT                   16685268..16685443)
FT                   /codon_start=1
FT                   /gene="Glrx5"
FT                   /locus_tag="mCG_1145"
FT                   /product="glutaredoxin 5 homolog (S. cerevisiae), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1145.2 transcript_id=mCT178207.0
FT                   protein_id=mCP101129.0 isoform=CRA_a"
FT                   /protein_id="EDL18773.1"
FT   mRNA            join(16677663..16677975,16685268..16687221)
FT                   /gene="Glrx5"
FT                   /locus_tag="mCG_1145"
FT                   /product="glutaredoxin 5 homolog (S. cerevisiae),
FT                   transcript variant mCT8730"
FT                   /note="gene_id=mCG1145.2 transcript_id=mCT8730.2 created on
FT                   31-DEC-2002"
FT   CDS             join(16677693..16677975,16685268..16685443)
FT                   /codon_start=1
FT                   /gene="Glrx5"
FT                   /locus_tag="mCG_1145"
FT                   /product="glutaredoxin 5 homolog (S. cerevisiae), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1145.2 transcript_id=mCT8730.2
FT                   protein_id=mCP20616.2 isoform=CRA_b"
FT                   /protein_id="EDL18774.1"
FT   assembly_gap    16701171..16701227
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    16717695..16717714
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16753395..16753561
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    16755743..16755762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16784063..16784109
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   gene            16792153..16800359
FT                   /locus_tag="mCG_53021"
FT                   /note="gene_id=mCG53021.1"
FT   mRNA            join(16792153..16792353,16798135..16798305,
FT                   16799199..16799239,16799766..16800359)
FT                   /locus_tag="mCG_53021"
FT                   /product="mCG53021"
FT                   /note="gene_id=mCG53021.1 transcript_id=mCT53204.2 created
FT                   on 17-MAR-2003"
FT   CDS             join(16792210..16792353,16798135..16798305,
FT                   16799199..16799237)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53021"
FT                   /product="mCG53021"
FT                   /note="gene_id=mCG53021.1 transcript_id=mCT53204.2
FT                   protein_id=mCP40736.2"
FT                   /db_xref="InterPro:IPR004832"
FT                   /db_xref="MGI:MGI:1351609"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FZI4"
FT                   /protein_id="EDL18772.1"
FT                   QVGDTVQLILMLE"
FT   gene            16804841..16811726
FT                   /locus_tag="mCG_1160"
FT                   /note="gene_id=mCG1160.1"
FT   mRNA            join(16804841..16805038,16809504..16809668,
FT                   16810573..16810642,16811136..16811726)
FT                   /locus_tag="mCG_1160"
FT                   /product="mCG1160, transcript variant mCT8745"
FT                   /note="gene_id=mCG1160.1 transcript_id=mCT8745.2 created on
FT                   17-MAR-2003"
FT   mRNA            join(16804859..16805038,16809504..16809668,
FT                   16811136..16811377)
FT                   /locus_tag="mCG_1160"
FT                   /product="mCG1160, transcript variant mCT171178"
FT                   /note="gene_id=mCG1160.1 transcript_id=mCT171178.0 created
FT                   on 17-MAR-2003"
FT   CDS             join(16804898..16805038,16809504..16809668,
FT                   16811136..16811219)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1160"
FT                   /product="mCG1160, isoform CRA_b"
FT                   /note="gene_id=mCG1160.1 transcript_id=mCT171178.0
FT                   protein_id=mCP94096.0 isoform=CRA_b"
FT                   /db_xref="MGI:MGI:1351601"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1Y7VM49"
FT                   /protein_id="EDL18771.1"
FT   CDS             join(16804898..16805038,16809504..16809668,
FT                   16810573..16810617)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1160"
FT                   /product="mCG1160, isoform CRA_a"
FT                   /note="gene_id=mCG1160.1 transcript_id=mCT8745.2
FT                   protein_id=mCP20602.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR004832"
FT                   /db_xref="MGI:MGI:1351601"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UWQ4"
FT                   /protein_id="EDL18770.1"
FT                   DTEQLILMLVLG"
FT   assembly_gap    16807548..16807572
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            16821438..16826264
FT                   /locus_tag="mCG_1150"
FT                   /note="gene_id=mCG1150.1"
FT   mRNA            join(16821438..16821635,16824039..16824209,
FT                   16825101..16825175,16825668..16826264)
FT                   /locus_tag="mCG_1150"
FT                   /product="mCG1150"
FT                   /note="gene_id=mCG1150.1 transcript_id=mCT8735.2 created on
FT                   24-JUL-2002"
FT   CDS             join(16821495..16821635,16824039..16824209,
FT                   16825101..16825154)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1150"
FT                   /product="mCG1150"
FT                   /note="gene_id=mCG1150.1 transcript_id=mCT8735.2
FT                   protein_id=mCP20606.2"
FT                   /db_xref="InterPro:IPR004832"
FT                   /db_xref="MGI:MGI:1351635"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UT92"
FT                   /protein_id="EDL18769.1"
FT                   MGDTVQLTLDIIIGEDD"
FT   assembly_gap    16821987..16822006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16835991..16840753
FT                   /locus_tag="mCG_1148"
FT                   /note="gene_id=mCG1148.2"
FT   mRNA            join(16835991..16836097,16838557..16838727,
FT                   16839588..16839662,16840157..16840753)
FT                   /locus_tag="mCG_1148"
FT                   /product="mCG1148, transcript variant mCT171175"
FT                   /note="gene_id=mCG1148.2 transcript_id=mCT171175.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(16835999..16836097,16838557..16838727,
FT                   16839588..16839641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1148"
FT                   /product="mCG1148, isoform CRA_a"
FT                   /note="gene_id=mCG1148.2 transcript_id=mCT171175.0
FT                   protein_id=mCP94093.0 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR004832"
FT                   /db_xref="MGI:MGI:1351600"
FT                   /db_xref="UniProtKB/TrEMBL:Q9QXN9"
FT                   /protein_id="EDL18767.1"
FT                   EVD"
FT   mRNA            join(16836180..16836381,16838557..16838727,
FT                   16839588..16839662,16840157..16840751)
FT                   /locus_tag="mCG_1148"
FT                   /product="mCG1148, transcript variant mCT8733"
FT                   /note="gene_id=mCG1148.2 transcript_id=mCT8733.2 created on
FT                   23-JUL-2002"
FT   CDS             join(16836238..16836381,16838557..16838727,
FT                   16839588..16839641)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1148"
FT                   /product="mCG1148, isoform CRA_b"
FT                   /note="gene_id=mCG1148.2 transcript_id=mCT8733.2
FT                   protein_id=mCP20604.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR004832"
FT                   /db_xref="MGI:MGI:1351600"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBM6"
FT                   /protein_id="EDL18768.1"
FT                   QMGDTLQLILDIVICEVD"
FT   gene            16847563..16852132
FT                   /gene="Tcl1b4"
FT                   /locus_tag="mCG_1152"
FT                   /note="gene_id=mCG1152.1"
FT   mRNA            join(16847563..16847766,16849783..16849953,
FT                   16850993..16851062,16851549..16852132)
FT                   /gene="Tcl1b4"
FT                   /locus_tag="mCG_1152"
FT                   /product="T-cell leukemia/lymphoma 1B, 4"
FT                   /note="gene_id=mCG1152.1 transcript_id=mCT8737.2 created on
FT                   23-JUL-2002"
FT   CDS             join(16847620..16847766,16849783..16849953,
FT                   16850993..16851037)
FT                   /codon_start=1
FT                   /gene="Tcl1b4"
FT                   /locus_tag="mCG_1152"
FT                   /product="T-cell leukemia/lymphoma 1B, 4"
FT                   /note="gene_id=mCG1152.1 transcript_id=mCT8737.2
FT                   protein_id=mCP20607.1"
FT                   /protein_id="EDL18766.1"
FT                   SQFYGTEELVLMLDSR"
FT   assembly_gap    16858846..16858865
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(16861812..16867768)
FT                   /gene="Tcl1"
FT                   /locus_tag="mCG_1154"
FT                   /note="gene_id=mCG1154.1"
FT   mRNA            complement(join(16861812..16861935,16862284..16862437,
FT                   16862478..16862756,16863278..16863347,16863714..16863884,
FT                   16867588..16867760))
FT                   /gene="Tcl1"
FT                   /locus_tag="mCG_1154"
FT                   /product="T-cell lymphoma breakpoint 1, transcript variant
FT                   mCT171177"
FT                   /note="gene_id=mCG1154.1 transcript_id=mCT171177.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(16861842..16862756,16863278..16863347,
FT                   16863714..16863884,16867588..16867768))
FT                   /gene="Tcl1"
FT                   /locus_tag="mCG_1154"
FT                   /product="T-cell lymphoma breakpoint 1, transcript variant
FT                   mCT8740"
FT                   /note="gene_id=mCG1154.1 transcript_id=mCT8740.0 created on
FT                   23-JUL-2002"
FT   CDS             complement(join(16863288..16863347,16863714..16863884,
FT                   16867588..16867707))
FT                   /codon_start=1
FT                   /gene="Tcl1"
FT                   /locus_tag="mCG_1154"
FT                   /product="T-cell lymphoma breakpoint 1, isoform CRA_a"
FT                   /note="gene_id=mCG1154.1 transcript_id=mCT171177.0
FT                   protein_id=mCP94095.0 isoform=CRA_a"
FT                   /protein_id="EDL18764.1"
FT                   LLELIDSESNDE"
FT   CDS             complement(join(16863288..16863347,16863714..16863884,
FT                   16867588..16867707))
FT                   /codon_start=1
FT                   /gene="Tcl1"
FT                   /locus_tag="mCG_1154"
FT                   /product="T-cell lymphoma breakpoint 1, isoform CRA_a"
FT                   /note="gene_id=mCG1154.1 transcript_id=mCT8740.0
FT                   protein_id=mCP20610.1 isoform=CRA_a"
FT                   /protein_id="EDL18765.1"
FT                   LLELIDSESNDE"
FT   assembly_gap    16868973..16868992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16904664..16904763
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    16923716..16924076
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    16926142..16926161
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16935604..16935623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16949353..16950057
FT                   /estimated_length=705
FT                   /gap_type="unknown"
FT   gene            16981940..17027483
FT                   /locus_tag="mCG_53020"
FT                   /note="gene_id=mCG53020.2"
FT   mRNA            join(16981940..16982303,16982576..16982905,
FT                   17026717..17027483)
FT                   /locus_tag="mCG_53020"
FT                   /product="mCG53020, transcript variant mCT53203"
FT                   /note="gene_id=mCG53020.2 transcript_id=mCT53203.2 created
FT                   on 30-JAN-2003"
FT   mRNA            join(<16982561..16982905,17026717..17027482)
FT                   /locus_tag="mCG_53020"
FT                   /product="mCG53020, transcript variant mCT191272"
FT                   /note="gene_id=mCG53020.2 transcript_id=mCT191272.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<16982771..16982905,17026717..17026902)
FT                   /codon_start=1
FT                   /locus_tag="mCG_53020"
FT                   /product="mCG53020, isoform CRA_a"
FT                   /note="gene_id=mCG53020.2 transcript_id=mCT191272.0
FT                   protein_id=mCP112239.0 isoform=CRA_a"
FT                   /protein_id="EDL18762.1"
FT                   TL"
FT   assembly_gap    17009728..17009819
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   CDS             17027102..17027311
FT                   /codon_start=1
FT                   /locus_tag="mCG_53020"
FT                   /product="mCG53020, isoform CRA_b"
FT                   /note="gene_id=mCG53020.2 transcript_id=mCT53203.2
FT                   protein_id=mCP40731.2 isoform=CRA_b"
FT                   /protein_id="EDL18763.1"
FT   assembly_gap    17032609..17032673
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    17034170..17034406
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    17035581..17035731
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   gene            complement(17040513..>17049577)
FT                   /locus_tag="mCG_144676"
FT                   /note="gene_id=mCG144676.0"
FT   mRNA            complement(join(17040513..17041951,17043659..17043728,
FT                   17049515..>17049577))
FT                   /locus_tag="mCG_144676"
FT                   /product="mCG144676"
FT                   /note="gene_id=mCG144676.0 transcript_id=mCT184100.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(17041777..17041951,17043659..17043728,
FT                   17049515..>17049575))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144676"
FT                   /product="mCG144676"
FT                   /note="gene_id=mCG144676.0 transcript_id=mCT184100.0
FT                   protein_id=mCP105370.0"
FT                   /protein_id="EDL18761.1"
FT   assembly_gap    17044161..17044297
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    17050085..17050104
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17068575..17068594
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17072108..17072863
FT                   /estimated_length=756
FT                   /gap_type="unknown"
FT   assembly_gap    17080423..17080442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17087724..17087743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17089142..17089289
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   gene            17098591..17133213
FT                   /locus_tag="mCG_1155"
FT                   /note="gene_id=mCG1155.1"
FT   mRNA            join(17098591..17098778,17132376..17133213)
FT                   /locus_tag="mCG_1155"
FT                   /product="mCG1155"
FT                   /note="gene_id=mCG1155.1 transcript_id=mCT8739.1 created on
FT                   29-JAN-2003"
FT   CDS             join(17098752..17098778,17132376..17132600)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1155"
FT                   /product="mCG1155"
FT                   /note="gene_id=mCG1155.1 transcript_id=mCT8739.1
FT                   protein_id=mCP20617.2"
FT                   /db_xref="GOA:J3QPM6"
FT                   /db_xref="MGI:MGI:2443127"
FT                   /db_xref="UniProtKB/TrEMBL:J3QPM6"
FT                   /protein_id="EDL18760.1"
FT   assembly_gap    17101483..17101638
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    17140288..17140638
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    17190919..17190938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <17210330..17242399
FT                   /gene="Bdkrb2"
FT                   /locus_tag="mCG_1157"
FT                   /note="gene_id=mCG1157.2"
FT   mRNA            join(17210330..17210406,17235356..17235459,
FT                   17238740..17240231,17241025..17241196,17241912..17242399)
FT                   /gene="Bdkrb2"
FT                   /locus_tag="mCG_1157"
FT                   /product="bradykinin receptor, beta 2, transcript variant
FT                   mCT8742"
FT                   /note="gene_id=mCG1157.2 transcript_id=mCT8742.2 created on
FT                   23-JUL-2002"
FT   mRNA            join(<17210330..17210406,17235356..17235459,
FT                   17238733..17240231)
FT                   /gene="Bdkrb2"
FT                   /locus_tag="mCG_1157"
FT                   /product="bradykinin receptor, beta 2, transcript variant
FT                   mCT191278"
FT                   /note="gene_id=mCG1157.2 transcript_id=mCT191278.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<17210401..17210406,17235356..17235459,
FT                   17238733..17239840)
FT                   /codon_start=1
FT                   /gene="Bdkrb2"
FT                   /locus_tag="mCG_1157"
FT                   /product="bradykinin receptor, beta 2, isoform CRA_a"
FT                   /note="gene_id=mCG1157.2 transcript_id=mCT191278.0
FT                   protein_id=mCP112230.0 isoform=CRA_a"
FT                   /protein_id="EDL18758.1"
FT                   WAGKKQ"
FT   assembly_gap    17236758..17236777
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             17238740..17239840
FT                   /codon_start=1
FT                   /gene="Bdkrb2"
FT                   /locus_tag="mCG_1157"
FT                   /product="bradykinin receptor, beta 2, isoform CRA_b"
FT                   /note="gene_id=mCG1157.2 transcript_id=mCT8742.2
FT                   protein_id=mCP20614.2 isoform=CRA_b"
FT                   /db_xref="GOA:B2RQ47"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000496"
FT                   /db_xref="InterPro:IPR001504"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:102845"
FT                   /db_xref="UniProtKB/TrEMBL:B2RQ47"
FT                   /protein_id="EDL18759.1"
FT   gene            17249530..17252415
FT                   /locus_tag="mCG_1159"
FT                   /note="gene_id=mCG1159.1"
FT   mRNA            join(17249530..17249552,17251337..17252415)
FT                   /locus_tag="mCG_1159"
FT                   /product="mCG1159"
FT                   /note="gene_id=mCG1159.1 transcript_id=mCT8744.1 created on
FT                   23-JUL-2002"
FT   CDS             17251337..17252341
FT                   /codon_start=1
FT                   /locus_tag="mCG_1159"
FT                   /product="mCG1159"
FT                   /note="gene_id=mCG1159.1 transcript_id=mCT8744.1
FT                   protein_id=mCP20615.0"
FT                   /db_xref="GOA:Q0VBD7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000496"
FT                   /db_xref="InterPro:IPR001186"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:88144"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBD7"
FT                   /protein_id="EDL18757.1"
FT   gene            complement(17263298..>17345883)
FT                   /locus_tag="mCG_1151"
FT                   /note="gene_id=mCG1151.2"
FT   mRNA            complement(join(17263298..17264463,17268366..17268515,
FT                   17269262..17269416,17269866..17269987,17270580..17270662,
FT                   17271074..17271143,17273337..17273541,17273887..17273965,
FT                   17282079..17282180,17282844..17283038,17283606..17283711,
FT                   17285070..17285296,17286361..17286563,17288311..17288452,
FT                   17290349..17290519,17290952..17291028,17291452..17291522,
FT                   17291991..17292083,17292531..17292637,17293683..17293763,
FT                   17293912..17294103,17295472..17295622,17296148..17296199,
FT                   17298540..17298682,17299218..17299413,17299688..17299790,
FT                   17301168..17301441,17305126..17305314,17305427..17305519,
FT                   17305997..17306147,17308159..17308420,17309774..17309876,
FT                   17309966..17310120,17311083..17311268,17311803..17311899,
FT                   17313756..17313935,17316423..17316585,17317834..17317936,
FT                   17318634..17318805,17322013..17322083,17331740..17332321))
FT                   /locus_tag="mCG_1151"
FT                   /product="mCG1151, transcript variant mCT8736"
FT                   /note="gene_id=mCG1151.2 transcript_id=mCT8736.2 created on
FT                   31-DEC-2002"
FT   mRNA            complement(join(17263299..17264463,17268366..17268515,
FT                   17269262..17269416,17269866..17269987,17270158..17270302))
FT                   /locus_tag="mCG_1151"
FT                   /product="mCG1151, transcript variant mCT178209"
FT                   /note="gene_id=mCG1151.2 transcript_id=mCT178209.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(17264233..17264463,17268366..17268515,
FT                   17269262..17269416,17269866..17269987,17270580..17270662,
FT                   17271074..17271143,17273337..17273541,17273887..17273965,
FT                   17282079..17282180,17282844..17283038,17283606..17283711,
FT                   17285070..17285296,17286361..17286563,17288311..17288452,
FT                   17290349..17290519,17290952..17291028,17291452..17291522,
FT                   17291991..17292083,17292531..17292637,17293683..17293763,
FT                   17293912..17294103,17295472..17295537))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1151"
FT                   /product="mCG1151, isoform CRA_c"
FT                   /note="gene_id=mCG1151.2 transcript_id=mCT8736.2
FT                   protein_id=mCP20596.2 isoform=CRA_c"
FT                   /protein_id="EDL18756.1"
FT   CDS             complement(join(17264233..17264463,17268366..17268515,
FT                   17269262..17269416,17269866..17269887))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1151"
FT                   /product="mCG1151, isoform CRA_b"
FT                   /note="gene_id=mCG1151.2 transcript_id=mCT178209.0
FT                   protein_id=mCP101131.0 isoform=CRA_b"
FT                   /protein_id="EDL18755.1"
FT   mRNA            complement(join(17306423..17308420,17309774..17309876,
FT                   17309966..17310120,17311083..17311268,17311803..17311899,
FT                   17313756..17313935,17316423..17316585,17317834..17317936,
FT                   17318634..17318788,17322013..17322083,17331743..17332522,
FT                   17345761..>17345883))
FT                   /locus_tag="mCG_1151"
FT                   /product="mCG1151, transcript variant mCT178208"
FT                   /note="gene_id=mCG1151.2 transcript_id=mCT178208.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(17308155..17308420,17309774..17309876,
FT                   17309966..17310120,17311083..17311268,17311803..17311899,
FT                   17313756..17313935,17316423..17316585,17317834..17317936,
FT                   17318634..17318788,17322013..>17322032))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1151"
FT                   /product="mCG1151, isoform CRA_a"
FT                   /note="gene_id=mCG1151.2 transcript_id=mCT178208.0
FT                   protein_id=mCP101130.0 isoform=CRA_a"
FT                   /protein_id="EDL18754.1"
FT                   KSFRAVFAEACSHDHLR"
FT   assembly_gap    17321993..17322012
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <17331898..17349000
FT                   /gene="4933433P14Rik"
FT                   /locus_tag="mCG_1147"
FT                   /note="gene_id=mCG1147.2"
FT   mRNA            join(<17331898..17332529,17345774..17346207)
FT                   /gene="4933433P14Rik"
FT                   /locus_tag="mCG_1147"
FT                   /product="RIKEN cDNA 4933433P14, transcript variant
FT                   mCT191248"
FT                   /note="gene_id=mCG1147.2 transcript_id=mCT191248.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(17331899..17332529,17345774..17346032,
FT                   17347694..17349000)
FT                   /gene="4933433P14Rik"
FT                   /locus_tag="mCG_1147"
FT                   /product="RIKEN cDNA 4933433P14, transcript variant
FT                   mCT8732"
FT                   /note="gene_id=mCG1147.2 transcript_id=mCT8732.1 created on
FT                   29-JAN-2003"
FT   CDS             join(<17332366..17332529,17345774..17346053)
FT                   /codon_start=1
FT                   /gene="4933433P14Rik"
FT                   /locus_tag="mCG_1147"
FT                   /product="RIKEN cDNA 4933433P14, isoform CRA_a"
FT                   /note="gene_id=mCG1147.2 transcript_id=mCT191248.0
FT                   protein_id=mCP112193.0 isoform=CRA_a"
FT                   /protein_id="EDL18752.1"
FT   CDS             join(17332516..17332529,17345774..17346032,
FT                   17347694..17347855)
FT                   /codon_start=1
FT                   /gene="4933433P14Rik"
FT                   /locus_tag="mCG_1147"
FT                   /product="RIKEN cDNA 4933433P14, isoform CRA_b"
FT                   /note="gene_id=mCG1147.2 transcript_id=mCT8732.1
FT                   protein_id=mCP20618.2 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR007967"
FT                   /db_xref="InterPro:IPR023231"
FT                   /db_xref="MGI:MGI:1914037"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TBR1"
FT                   /protein_id="EDL18753.1"
FT   assembly_gap    17339824..17339843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17343624..17343838
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    17350784..17350803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <17353190..17429676
FT                   /locus_tag="mCG_1149"
FT                   /note="gene_id=mCG1149.1"
FT   mRNA            join(<17353190..17353339,17357386..17357502,
FT                   17360669..17360777,17363152..17363246,17373355..17373465,
FT                   17382148..17382236,17385832..17385922,17388267..17388344,
FT                   17389524..17389673,17392492..17392620,17394561..17394621,
FT                   17408754..17408882,17413924..17414121,17415852..17416120,
FT                   17428902..17429676)
FT                   /locus_tag="mCG_1149"
FT                   /product="mCG1149"
FT                   /note="gene_id=mCG1149.1 transcript_id=mCT8734.1 created on
FT                   29-JAN-2003"
FT   CDS             join(<17353190..17353339,17357386..17357502,
FT                   17360669..17360777,17363152..17363246,17373355..17373465,
FT                   17382148..17382236,17385832..17385922,17388267..17388344,
FT                   17389524..17389673,17392492..17392620,17394561..17394621,
FT                   17408754..17408882,17413924..17414121,17415852..17416120,
FT                   17428902..17428940)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1149"
FT                   /product="mCG1149"
FT                   /note="gene_id=mCG1149.1 transcript_id=mCT8734.1
FT                   protein_id=mCP20620.1"
FT                   /protein_id="EDL18751.1"
FT   assembly_gap    17356453..17356578
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    17374865..17374925
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    17377519..17377561
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    17381262..17381281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17389174..17389193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17409257..17409357
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    17426186..17426331
FT                   /estimated_length=146
FT                   /gap_type="unknown"
FT   assembly_gap    17428027..17428583
FT                   /estimated_length=557
FT                   /gap_type="unknown"
FT   assembly_gap    17429701..17430662
FT                   /estimated_length=962
FT                   /gap_type="unknown"
FT   assembly_gap    17431828..17432292
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   assembly_gap    17443749..17443768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <17446862..17486139
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /note="gene_id=mCG1153.2"
FT   mRNA            join(<17446862..17447035,17447895..17447961,
FT                   17452138..17452219,17453698..17453807,17454376..17454429,
FT                   17455766..17455877,17456554..17456643,17456735..17456873,
FT                   17458248..17458320,17459485..17459605,17460409..17460493,
FT                   17465568..17465621,17465992..17466111,17467553..17467662,
FT                   17470768..17470889,17474144..17474286,17475481..17475581,
FT                   17476257..17476477,17480300..17480362,17481910..17481984,
FT                   17483965..17484249,17485730..17486139)
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /product="poly (A) polymerase alpha, transcript variant
FT                   mCT178210"
FT                   /note="gene_id=mCG1153.2 transcript_id=mCT178210.0 created
FT                   on 31-DEC-2002"
FT   mRNA            join(<17446862..17447035,17447895..17447961,
FT                   17452138..17452219,17453698..17453807,17454376..17454429,
FT                   17456554..17456643,17456735..17456873,17458248..17458320,
FT                   17459485..17459605,17460409..17460493,17465568..17465621,
FT                   17465992..17466111,17467553..17467662,17470768..17470889,
FT                   17474144..17474286,17475481..17475581,17476257..17476477,
FT                   17480300..17480362,17481910..17481984,17483965..17486124)
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /product="poly (A) polymerase alpha, transcript variant
FT                   mCT191276"
FT                   /note="gene_id=mCG1153.2 transcript_id=mCT191276.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(<17446862..17447035,17447895..17447961,
FT                   17452138..17452219,17453698..17453807,17454376..17454429,
FT                   17455766..17455877,17456554..17456643,17456735..17456873,
FT                   17458248..17458320,17459485..17459605,17460409..17460493,
FT                   17465568..17465621,17465992..17466111,17467553..17467662,
FT                   17470768..17470889,17474144..17474286,17475481..17475581,
FT                   17476257..17476477,17480300..17480362,17481910..17481984,
FT                   17483965..17486090)
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /product="poly (A) polymerase alpha, transcript variant
FT                   mCT8738"
FT                   /note="gene_id=mCG1153.2 transcript_id=mCT8738.2 created on
FT                   31-DEC-2002"
FT   mRNA            join(<17446862..17447035,17447895..17447961,
FT                   17452138..17452219,17453698..17453807,17454376..17454429,
FT                   17455766..17455877,17456554..17456643,17456735..17456873,
FT                   17458248..17458320,17459485..17459605,17460409..17460493,
FT                   17465568..17465621,17465992..17466111,17467553..17467662,
FT                   17470768..17470889,17474144..17474286,17475481..17475581,
FT                   17476257..17476477,17480300..17480362,17481910..17482093)
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /product="poly (A) polymerase alpha, transcript variant
FT                   mCT191277"
FT                   /note="gene_id=mCG1153.2 transcript_id=mCT191277.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<17446863..17447035,17447895..17447961,
FT                   17452138..17452219,17453698..17453807,17454376..17454429,
FT                   17455766..17455877,17456554..17456643,17456735..17456873,
FT                   17458248..17458320,17459485..17459605,17460409..17460493,
FT                   17465568..17465621,17465992..17466111,17467553..17467662,
FT                   17470768..17470889,17474144..17474286,17475481..17475581,
FT                   17476257..17476477,17480300..17480362,17481910..17481984,
FT                   17483965..17484060)
FT                   /codon_start=1
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /product="poly (A) polymerase alpha, isoform CRA_a"
FT                   /note="gene_id=mCG1153.2 transcript_id=mCT178210.0
FT                   protein_id=mCP101132.0 isoform=CRA_a"
FT                   /protein_id="EDL18747.1"
FT   CDS             join(<17446863..17447035,17447895..17447961,
FT                   17452138..17452219,17453698..17453807,17454376..17454429,
FT                   17455766..17455877,17456554..17456643,17456735..17456873,
FT                   17458248..17458320,17459485..17459605,17460409..17460493,
FT                   17465568..17465621,17465992..17466111,17467553..17467662,
FT                   17470768..17470889,17474144..17474286,17475481..17475581,
FT                   17476257..17476477,17480300..17480362,17481910..17481984,
FT                   17483965..17484060)
FT                   /codon_start=1
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /product="poly (A) polymerase alpha, isoform CRA_a"
FT                   /note="gene_id=mCG1153.2 transcript_id=mCT8738.2
FT                   protein_id=mCP20598.2 isoform=CRA_a"
FT                   /protein_id="EDL18750.1"
FT   CDS             join(<17446863..17447035,17447895..17447961,
FT                   17452138..17452219,17453698..17453807,17454376..17454429,
FT                   17455766..17455877,17456554..17456643,17456735..17456873,
FT                   17458248..17458320,17459485..17459605,17460409..17460493,
FT                   17465568..17465621,17465992..17466111,17467553..17467662,
FT                   17470768..17470889,17474144..17474286,17475481..17475581,
FT                   17476257..17476477,17480300..17480362,17481910..17482059)
FT                   /codon_start=1
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /product="poly (A) polymerase alpha, isoform CRA_c"
FT                   /note="gene_id=mCG1153.2 transcript_id=mCT191277.0
FT                   protein_id=mCP112229.0 isoform=CRA_c"
FT                   /protein_id="EDL18749.1"
FT   CDS             join(<17454420..17454429,17456554..17456643,
FT                   17456735..17456873,17458248..17458320,17459485..17459605,
FT                   17460409..17460493,17465568..17465621,17465992..17466111,
FT                   17467553..17467662,17470768..17470889,17474144..17474286,
FT                   17475481..17475581,17476257..17476477,17480300..17480362,
FT                   17481910..17481984,17483965..17484060)
FT                   /codon_start=1
FT                   /gene="Papola"
FT                   /locus_tag="mCG_1153"
FT                   /product="poly (A) polymerase alpha, isoform CRA_b"
FT                   /note="gene_id=mCG1153.2 transcript_id=mCT191276.0
FT                   protein_id=mCP112228.0 isoform=CRA_b"
FT                   /protein_id="EDL18748.1"
FT   assembly_gap    17498774..17498902
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    17530018..17530466
FT                   /estimated_length=449
FT                   /gap_type="unknown"
FT   assembly_gap    17532380..17532502
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    17533561..17533580
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17535077..17535675
FT                   /estimated_length=599
FT                   /gap_type="unknown"
FT   gene            17547715..17549897
FT                   /locus_tag="mCG_147628"
FT                   /note="gene_id=mCG147628.0"
FT   mRNA            join(17547715..17547816,17548051..17549897)
FT                   /locus_tag="mCG_147628"
FT                   /product="mCG147628"
FT                   /note="gene_id=mCG147628.0 transcript_id=mCT187891.0
FT                   created on 13-JAN-2004"
FT   CDS             17548297..17548506
FT                   /codon_start=1
FT                   /locus_tag="mCG_147628"
FT                   /product="mCG147628"
FT                   /note="gene_id=mCG147628.0 transcript_id=mCT187891.0
FT                   protein_id=mCP109004.0"
FT                   /protein_id="EDL18746.1"
FT   assembly_gap    17551653..17551672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17560905..17561034
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    17583526..17583545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17588234..17588927
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    17591798..17592149
FT                   /estimated_length=352
FT                   /gap_type="unknown"
FT   assembly_gap    17596361..17596520
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    17605111..17605308
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    17622118..17622283
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    17622990..17623009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17630629..17630766
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    17640444..17640600
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   gene            <17658981..17724379
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /note="gene_id=mCG18807.2"
FT   mRNA            join(<17658981..17659111,17685295..17685459,
FT                   17691592..17691647,17699691..17699760,17700516..17700603,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719508..17719598,17723990..17724182)
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, transcript variant
FT                   mCT191225"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT191225.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(17658981..17659111,17685300..17685459,
FT                   17691592..17691647,17699691..17699760,17700516..17700603,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719508..17719598,17720553..17720624,17722602..17722661,
FT                   17723990..17724153)
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, transcript variant
FT                   mCT15325"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT15325.1 created
FT                   on 23-JUL-2002"
FT   CDS             join(<17658982..17659111,17685295..17685459,
FT                   17691592..17691647,17699691..17699760,17700516..17700603,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719508..17719598,17723990..17724021)
FT                   /codon_start=1
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, isoform CRA_c"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT191225.0
FT                   protein_id=mCP112176.0 isoform=CRA_c"
FT                   /protein_id="EDL18742.1"
FT   mRNA            join(17659027..17659111,17685295..17685459,
FT                   17691592..17691647,17699691..17699760,17700516..17700603,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719508..17719598,17722602..17722661,17723990..17724379)
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, transcript variant
FT                   mCT171202"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT171202.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(<17659036..17659111,17685295..17685459,
FT                   17691592..17691647,17699691..17699760,17700516..17700603,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719508..17720624,17722602..17722661,17723990..17724182)
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, transcript variant
FT                   mCT191226"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT191226.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<17659036..17659111,17685295..17685459,
FT                   17691592..17691647,17699691..17699760,17700516..17700603,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719508..17719681)
FT                   /codon_start=1
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, isoform CRA_d"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT191226.0
FT                   protein_id=mCP112177.0 isoform=CRA_d"
FT                   /protein_id="EDL18743.1"
FT   mRNA            join(<17659065..17659111,17685295..17685459,
FT                   17691592..17691647,17699691..17699760,17700516..17700603,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719508..17719598,17720553..17720624,17722602..17722661,
FT                   17723990..17724378)
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, transcript variant
FT                   mCT191224"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT191224.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<17659066..17659111,17685295..17685459,
FT                   17691592..17691647,17699691..17699760,17700516..17700603,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719508..17719598,17720553..17720624,17722602..17722661,
FT                   17723990..17724021)
FT                   /codon_start=1
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, isoform CRA_b"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT191224.0
FT                   protein_id=mCP112175.0 isoform=CRA_b"
FT                   /protein_id="EDL18741.1"
FT   mRNA            join(17674560..17674802,17685294..17685459,
FT                   17691592..17691646,17704558..17704666,17704777..17704869,
FT                   17706599..17706731,17707332..17707452,17708374..17708432,
FT                   17711613..17711791,17719511..17719582,17723990..17724136)
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, transcript variant
FT                   mCT171203"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT171203.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(17685300..17685459,17691592..17691646,
FT                   17704558..17704666,17704777..17704869,17706599..17706731,
FT                   17707332..17707452,17708374..17708432,17711613..17711791,
FT                   17719511..17719582,17723990..17724061)
FT                   /codon_start=1
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, isoform CRA_f"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT171203.0
FT                   protein_id=mCP94120.0 isoform=CRA_f"
FT                   /protein_id="EDL18745.1"
FT                   SRNHLLCLFI"
FT   CDS             join(17685300..17685459,17691592..17691647,
FT                   17699691..17699760,17700516..17700603,17704558..17704666,
FT                   17704777..17704869,17706599..17706731,17707332..17707452,
FT                   17708374..17708432,17711613..17711791,17719508..17719598,
FT                   17720553..17720624,17722602..17722661,17723990..17724021)
FT                   /codon_start=1
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, isoform CRA_e"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT15325.1
FT                   protein_id=mCP20600.1 isoform=CRA_e"
FT                   /protein_id="EDL18744.1"
FT   CDS             join(17685300..17685459,17691592..17691647,
FT                   17699691..17699760,17700516..17700603,17704558..17704666,
FT                   17704777..17704869,17706599..17706731,17707332..17707452,
FT                   17708374..17708432,17711613..17711791,17719508..17719598,
FT                   17722602..17722661,17723990..17724021)
FT                   /codon_start=1
FT                   /gene="Vrk1"
FT                   /locus_tag="mCG_18807"
FT                   /product="vaccinia related kinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG18807.2 transcript_id=mCT171202.0
FT                   protein_id=mCP94121.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UWH3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:1261847"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UWH3"
FT                   /protein_id="EDL18740.1"
FT                   MLRLDRRGSRTRKKAQK"
FT   assembly_gap    17709628..17709895
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   gene            17733353..17737637
FT                   /locus_tag="mCG_147627"
FT                   /note="gene_id=mCG147627.0"
FT   mRNA            17733353..17737637
FT                   /locus_tag="mCG_147627"
FT                   /product="mCG147627"
FT                   /note="gene_id=mCG147627.0 transcript_id=mCT187890.0
FT                   created on 13-JAN-2004"
FT   CDS             17733922..17734353
FT                   /codon_start=1
FT                   /locus_tag="mCG_147627"
FT                   /product="mCG147627"
FT                   /note="gene_id=mCG147627.0 transcript_id=mCT187890.0
FT                   protein_id=mCP109003.0"
FT                   /protein_id="EDL18739.1"
FT   assembly_gap    17744737..17744756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17749124..17749143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17755042..17755324
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    17771359..17771417
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            complement(17780983..17794160)
FT                   /locus_tag="mCG_147624"
FT                   /note="gene_id=mCG147624.0"
FT   mRNA            complement(join(17780983..17784195,17793839..17794160))
FT                   /locus_tag="mCG_147624"
FT                   /product="mCG147624"
FT                   /note="gene_id=mCG147624.0 transcript_id=mCT187887.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17783235..17783474)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147624"
FT                   /product="mCG147624"
FT                   /note="gene_id=mCG147624.0 transcript_id=mCT187887.0
FT                   protein_id=mCP109001.0"
FT                   /protein_id="EDL18738.1"
FT   assembly_gap    17791225..17791244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17793087..17793106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17794825..17794934
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    17798998..17799017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17825668..17827427
FT                   /estimated_length=1760
FT                   /gap_type="unknown"
FT   assembly_gap    17832802..17833257
FT                   /estimated_length=456
FT                   /gap_type="unknown"
FT   assembly_gap    17837064..17837653
FT                   /estimated_length=590
FT                   /gap_type="unknown"
FT   assembly_gap    17845638..17845800
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    17853512..17853812
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    17854862..17856460
FT                   /estimated_length=1599
FT                   /gap_type="unknown"
FT   assembly_gap    17860277..17860381
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    17867777..17868053
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    17869780..17870088
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    17885679..17885748
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    17898908..17899020
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    17914617..17914780
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    17917204..17917223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17951823..17952249
FT                   /estimated_length=427
FT                   /gap_type="unknown"
FT   assembly_gap    17986562..17986669
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    17987952..17987971
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18010651..18011073
FT                   /estimated_length=423
FT                   /gap_type="unknown"
FT   assembly_gap    18020298..18022047
FT                   /estimated_length=1750
FT                   /gap_type="unknown"
FT   assembly_gap    18029253..18029586
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    18033682..18033701
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18039074..18039184
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    18042648..18042820
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    18050560..18050805
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    18052903..18053206
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    18054216..18054235
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18077468..18077487
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18088603..18088622
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18091549..18096747)
FT                   /locus_tag="mCG_67366"
FT                   /note="gene_id=mCG67366.1"
FT   mRNA            complement(join(18091549..18091946,18092562..18092766,
FT                   18095631..18095711,18096404..18096747))
FT                   /locus_tag="mCG_67366"
FT                   /product="mCG67366"
FT                   /note="gene_id=mCG67366.1 transcript_id=mCT67549.2 created
FT                   on 29-JAN-2003"
FT   CDS             complement(join(18092732..18092766,18095631..18095711,
FT                   18096404..18096506))
FT                   /codon_start=1
FT                   /locus_tag="mCG_67366"
FT                   /product="mCG67366"
FT                   /note="gene_id=mCG67366.1 transcript_id=mCT67549.2
FT                   protein_id=mCP40727.2"
FT                   /protein_id="EDL18737.1"
FT   assembly_gap    18093291..18093607
FT                   /estimated_length=317
FT                   /gap_type="unknown"
FT   assembly_gap    18096234..18096253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18103732..18103765
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    18112341..18112399
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    18115033..18115185
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    18141972..18141991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18147547..18147747
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    18150131..18150810
FT                   /estimated_length=680
FT                   /gap_type="unknown"
FT   assembly_gap    18161229..18161499
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    18164241..18164260
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18166934..18166953
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18180633..18180782
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    18185356..18185790
FT                   /estimated_length=435
FT                   /gap_type="unknown"
FT   assembly_gap    18200687..18201177
FT                   /estimated_length=491
FT                   /gap_type="unknown"
FT   assembly_gap    18215511..18215564
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    18233140..18233159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18244412..18244538
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    18256713..18256863
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    18274916..18274982
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    18295155..18295296
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    18305576..18305812
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    18313157..18313643
FT                   /estimated_length=487
FT                   /gap_type="unknown"
FT   assembly_gap    18325889..18349337
FT                   /estimated_length=23449
FT                   /gap_type="unknown"
FT   gene            complement(18351600..>18361919)
FT                   /locus_tag="mCG_145302"
FT                   /note="gene_id=mCG145302.0"
FT   mRNA            complement(join(18351600..18352420,18355014..18355110,
FT                   18356357..18356454,18356665..18356780,18359645..18359805,
FT                   18360034..18360139,18361716..>18361919))
FT                   /locus_tag="mCG_145302"
FT                   /product="mCG145302"
FT                   /note="gene_id=mCG145302.0 transcript_id=mCT184726.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(18352124..18352420,18355014..>18355031))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145302"
FT                   /product="mCG145302"
FT                   /note="gene_id=mCG145302.0 transcript_id=mCT184726.0
FT                   protein_id=mCP105382.0"
FT                   /protein_id="EDL18736.1"
FT                   "
FT   assembly_gap    18365648..18365830
FT                   /estimated_length=183
FT                   /gap_type="unknown"
FT   assembly_gap    18371534..18371803
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    18378367..18378790
FT                   /estimated_length=424
FT                   /gap_type="unknown"
FT   assembly_gap    18400387..18400406
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18406012..18406031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18412060..18412209
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    18415474..18415666
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    18421055..18422253
FT                   /estimated_length=1199
FT                   /gap_type="unknown"
FT   assembly_gap    18433661..18433752
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   gene            <18482957..18524931
FT                   /locus_tag="mCG_145301"
FT                   /note="gene_id=mCG145301.0"
FT   mRNA            join(<18482957..18482989,18484073..18484159,
FT                   18484773..18484943,18512359..18512497,18523602..18523702,
FT                   18524767..18524931)
FT                   /locus_tag="mCG_145301"
FT                   /product="mCG145301"
FT                   /note="gene_id=mCG145301.0 transcript_id=mCT184725.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<18484797..18484943,18512359..18512379)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145301"
FT                   /product="mCG145301"
FT                   /note="gene_id=mCG145301.0 transcript_id=mCT184725.0
FT                   protein_id=mCP105379.0"
FT                   /protein_id="EDL18735.1"
FT                   DRKWHRFPDS"
FT   assembly_gap    18527485..18527560
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    18531331..18531408
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    18538229..18538248
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18539372..18539391
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18587682..18587797
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    18602351..18602471
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    18626498..18626858
FT                   /estimated_length=361
FT                   /gap_type="unknown"
FT   assembly_gap    18660935..18661025
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    18661818..18663078
FT                   /estimated_length=1261
FT                   /gap_type="unknown"
FT   assembly_gap    18675852..18675871
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18691041..18691619
FT                   /estimated_length=579
FT                   /gap_type="unknown"
FT   assembly_gap    18699879..18700068
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    18705382..18705680
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    18706596..18708072
FT                   /estimated_length=1477
FT                   /gap_type="unknown"
FT   assembly_gap    18713903..18713922
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18725048..18725253
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    18764664..18765030
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    18776933..18776952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18801285..18801592
FT                   /estimated_length=308
FT                   /gap_type="unknown"
FT   assembly_gap    18815585..18815951
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    18825288..18827143
FT                   /estimated_length=1856
FT                   /gap_type="unknown"
FT   gene            18832630..18835809
FT                   /locus_tag="mCG_147611"
FT                   /note="gene_id=mCG147611.0"
FT   mRNA            join(18832630..18832753,18835293..18835809)
FT                   /locus_tag="mCG_147611"
FT                   /product="mCG147611"
FT                   /note="gene_id=mCG147611.0 transcript_id=mCT187874.0
FT                   created on 13-JAN-2004"
FT   CDS             18835458..18835628
FT                   /codon_start=1
FT                   /locus_tag="mCG_147611"
FT                   /product="mCG147611"
FT                   /note="gene_id=mCG147611.0 transcript_id=mCT187874.0
FT                   protein_id=mCP108987.0"
FT                   /protein_id="EDL18734.1"
FT                   VKGRKEFWVSK"
FT   assembly_gap    18840645..18840664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(18854382..18854862)
FT                   /locus_tag="mCG_10698"
FT                   /note="gene_id=mCG10698.2"
FT   mRNA            complement(18854382..18854862)
FT                   /locus_tag="mCG_10698"
FT                   /product="mCG10698"
FT                   /note="gene_id=mCG10698.2 transcript_id=mCT10585.2 created
FT                   on 01-APR-2003"
FT   CDS             complement(18854614..18854784)
FT                   /codon_start=1
FT                   /locus_tag="mCG_10698"
FT                   /product="mCG10698"
FT                   /note="gene_id=mCG10698.2 transcript_id=mCT10585.2
FT                   protein_id=mCP3801.2"
FT                   /protein_id="EDL18733.1"
FT                   MTTVHAITATQ"
FT   assembly_gap    18858079..18858381
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    18863299..18863422
FT                   /estimated_length=124
FT                   /gap_type="unknown"
FT   assembly_gap    18864605..18867553
FT                   /estimated_length=2949
FT                   /gap_type="unknown"
FT   assembly_gap    18868759..18869358
FT                   /estimated_length=600
FT                   /gap_type="unknown"
FT   assembly_gap    18884567..18884586
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18913703..18913734
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    18916038..18916057
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18920079..18920098
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18947120..18947730
FT                   /estimated_length=611
FT                   /gap_type="unknown"
FT   assembly_gap    18979961..18980489
FT                   /estimated_length=529
FT                   /gap_type="unknown"
FT   assembly_gap    18987028..18987054
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    18992100..18992119
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18993398..18993673
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    18994930..18994949
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18997976..18997995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19006496..19006572
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    19016145..19016164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19017330..19024309
FT                   /estimated_length=6980
FT                   /gap_type="unknown"
FT   assembly_gap    19048949..19048968
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19062850..19063416
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    19067572..19067591
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19072892..19072911
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19079587..19080352
FT                   /estimated_length=766
FT                   /gap_type="unknown"
FT   assembly_gap    19100601..19100620
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19107135..19107154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19117317..19138621)
FT                   /locus_tag="mCG_147623"
FT                   /note="gene_id=mCG147623.0"
FT   mRNA            complement(join(19117317..19120224,19138276..19138621))
FT                   /locus_tag="mCG_147623"
FT                   /product="mCG147623"
FT                   /note="gene_id=mCG147623.0 transcript_id=mCT187886.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(19120049..19120224,19138276..19138339))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147623"
FT                   /product="mCG147623"
FT                   /note="gene_id=mCG147623.0 transcript_id=mCT187886.0
FT                   protein_id=mCP109000.0"
FT                   /protein_id="EDL18732.1"
FT   assembly_gap    19121820..19121889
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    19123382..19123650
FT                   /estimated_length=269
FT                   /gap_type="unknown"
FT   assembly_gap    19129174..19129720
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    19131380..19131413
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    19132240..19133478
FT                   /estimated_length=1239
FT                   /gap_type="unknown"
FT   gene            19143111..19144116
FT                   /locus_tag="mCG_147629"
FT                   /note="gene_id=mCG147629.0"
FT   mRNA            19143111..19144116
FT                   /locus_tag="mCG_147629"
FT                   /product="mCG147629"
FT                   /note="gene_id=mCG147629.0 transcript_id=mCT187892.0
FT                   created on 13-JAN-2004"
FT   CDS             19143137..19143499
FT                   /codon_start=1
FT                   /locus_tag="mCG_147629"
FT                   /product="mCG147629"
FT                   /note="gene_id=mCG147629.0 transcript_id=mCT187892.0
FT                   protein_id=mCP109006.0"
FT                   /protein_id="EDL18731.1"
FT                   RLPQQNTIRPTFQRHP"
FT   assembly_gap    19144576..19144595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19148825..19149569
FT                   /estimated_length=745
FT                   /gap_type="unknown"
FT   assembly_gap    19153371..19155177
FT                   /estimated_length=1807
FT                   /gap_type="unknown"
FT   assembly_gap    19167794..19167956
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    19173640..19173866
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    19178211..19178230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19184806..19184994
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    19215502..19215521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19235042..19235061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19236069..19236277
FT                   /estimated_length=209
FT                   /gap_type="unknown"
FT   assembly_gap    19273425..19273444
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19285430..19286410
FT                   /estimated_length=981
FT                   /gap_type="unknown"
FT   assembly_gap    19306763..19306866
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    19309095..19309220
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    19336337..19338047
FT                   /estimated_length=1711
FT                   /gap_type="unknown"
FT   assembly_gap    19339436..19340161
FT                   /estimated_length=726
FT                   /gap_type="unknown"
FT   assembly_gap    19341862..19341881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19343200..19343219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19347544..19347563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19351821..19352817
FT                   /estimated_length=997
FT                   /gap_type="unknown"
FT   assembly_gap    19354526..19354545
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19356770..19356789
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19358643..19358662
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19366666..19367471
FT                   /estimated_length=806
FT                   /gap_type="unknown"
FT   gene            complement(19376253..19387994)
FT                   /locus_tag="mCG_1047997"
FT                   /note="gene_id=mCG1047997.1"
FT   mRNA            complement(join(19376253..19377200,19381889..19382232,
FT                   19387955..19387994))
FT                   /locus_tag="mCG_1047997"
FT                   /product="mCG1047997"
FT                   /note="gene_id=mCG1047997.1 transcript_id=mCT165701.1
FT                   created on 05-FEB-2003"
FT   CDS             complement(19376636..19376800)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047997"
FT                   /product="mCG1047997"
FT                   /note="gene_id=mCG1047997.1 transcript_id=mCT165701.1
FT                   protein_id=mCP50427.1"
FT                   /protein_id="EDL18730.1"
FT                   RATTSSPQL"
FT   assembly_gap    19383631..19384160
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    19385076..19385937
FT                   /estimated_length=862
FT                   /gap_type="unknown"
FT   assembly_gap    19387122..19387419
FT                   /estimated_length=298
FT                   /gap_type="unknown"
FT   assembly_gap    19395074..19395093
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19412532..19412551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19424274..19424383
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    19429654..19430616
FT                   /estimated_length=963
FT                   /gap_type="unknown"
FT   assembly_gap    19442075..19442150
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    19473994..19474237
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    19499188..19499207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19500420..19500598
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    19508073..19508092
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19511570..19511654
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    19530468..19534464
FT                   /estimated_length=3997
FT                   /gap_type="unknown"
FT   assembly_gap    19561538..19561627
FT                   /estimated_length=90
FT                   /gap_type="unknown"
FT   gene            complement(19567831..>19658387)
FT                   /gene="Bcl11b"
FT                   /locus_tag="mCG_18350"
FT                   /note="gene_id=mCG18350.2"
FT   mRNA            complement(join(19567831..19568442,19569348..19571539,
FT                   19643890..19644255,19657519..19657593,19657885..>19658387))
FT                   /gene="Bcl11b"
FT                   /locus_tag="mCG_18350"
FT                   /product="B-cell leukemia/lymphoma 11B, transcript variant
FT                   mCT14072"
FT                   /note="gene_id=mCG18350.2 transcript_id=mCT14072.2 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(19569347..19571539,19620078..19620293,
FT                   19643890..19644255,19657519..>19657786))
FT                   /gene="Bcl11b"
FT                   /locus_tag="mCG_18350"
FT                   /product="B-cell leukemia/lymphoma 11B, transcript variant
FT                   mCT171195"
FT                   /note="gene_id=mCG18350.2 transcript_id=mCT171195.0 created
FT                   on 23-JUL-2002"
FT   CDS             complement(join(19569525..19571539,19620078..19620293,
FT                   19643890..19644255,19657519..>19657774))
FT                   /codon_start=1
FT                   /gene="Bcl11b"
FT                   /locus_tag="mCG_18350"
FT                   /product="B-cell leukemia/lymphoma 11B, isoform CRA_a"
FT                   /note="gene_id=mCG18350.2 transcript_id=mCT171195.0
FT                   protein_id=mCP94113.0 isoform=CRA_a"
FT                   /protein_id="EDL18728.1"
FT   CDS             complement(join(19569525..19571539,19643890..>19644253))
FT                   /codon_start=1
FT                   /gene="Bcl11b"
FT                   /locus_tag="mCG_18350"
FT                   /product="B-cell leukemia/lymphoma 11B, isoform CRA_b"
FT                   /note="gene_id=mCG18350.2 transcript_id=mCT14072.2
FT                   protein_id=mCP14291.2 isoform=CRA_b"
FT                   /protein_id="EDL18729.1"
FT   assembly_gap    19583078..19583097
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19594493..19594808
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    19606031..19606050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19609928..19609979
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    19657222..19657518
FT                   /estimated_length=297
FT                   /gap_type="unknown"
FT   assembly_gap    19661748..19661791
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    19669634..19669932
FT                   /estimated_length=299
FT                   /gap_type="unknown"
FT   assembly_gap    19683200..19683548
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    19684313..19684332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19687195..19687299
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    19724022..19724041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19742932..19743407
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   gene            complement(19756449..19817124)
FT                   /locus_tag="mCG_18357"
FT                   /note="gene_id=mCG18357.2"
FT   mRNA            complement(join(19756449..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19768184..19768298,19769048..19769106,19807480..19807736,
FT                   19808002..19808074,19809959..19810107,19812699..19812791,
FT                   19814789..19814900,19816999..19817124))
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, transcript variant mCT14079"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT14079.2 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(19756449..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19807480..19807736,19808002..19808074,19809959..19810107,
FT                   19812699..19812791,19814789..19814900))
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, transcript variant mCT178214"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT178214.0 created
FT                   on 31-DEC-2002"
FT   mRNA            complement(join(19756611..19756997,19757018..19757687,
FT                   19758495..19758655,19761161..19761246,19762069..19762235,
FT                   19763258..19763332,19768184..19768298,19769048..19769106,
FT                   19807480..19807736,19808002..19808074,19809959..19810107,
FT                   19812699..19812791,19814789..>19814900))
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, transcript variant mCT191216"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT191216.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(19757053..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19807480..19807736,19808002..19808074,19812699..19812791,
FT                   19814789..>19814900))
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, transcript variant mCT191217"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT191217.0 created
FT                   on 09-MAR-2004"
FT   mRNA            complement(join(19757104..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19768184..19768298,19769048..19769106,19807480..19807736,
FT                   19808002..19808074,19812699..19812791,19814789..19814900))
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, transcript variant mCT178213"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT178213.0 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(19757241..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19768184..19768298,19769048..19769106,19807480..19807736,
FT                   19808002..19808074,19809959..19810107,19812699..19812791,
FT                   19814789..>19814900))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, isoform CRA_d"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT191216.0
FT                   protein_id=mCP112220.0 isoform=CRA_d"
FT                   /protein_id="EDL18726.1"
FT   CDS             complement(join(19757241..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19807480..19807736,19808002..19808074,19809959..19810107,
FT                   19812699..19812791,19814789..19814891))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, isoform CRA_c"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT178214.0
FT                   protein_id=mCP101136.0 isoform=CRA_c"
FT                   /protein_id="EDL18725.1"
FT   CDS             complement(join(19757241..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19768184..19768298,19769048..19769106,19807480..19807736,
FT                   19808002..19808074,19809959..19810107,19812699..19812791,
FT                   19814789..19814891))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, isoform CRA_a"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT14079.2
FT                   protein_id=mCP14263.2 isoform=CRA_a"
FT                   /protein_id="EDL18723.1"
FT                   NVTGEESSGSMAKVKERL"
FT   CDS             complement(join(19757241..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19807480..19807736,19808002..19808074,19812699..19812791,
FT                   19814789..>19814806))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, isoform CRA_e"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT191217.0
FT                   protein_id=mCP112221.0 isoform=CRA_e"
FT                   /protein_id="EDL18727.1"
FT                   "
FT   CDS             complement(join(19757241..19757687,19758495..19758655,
FT                   19761161..19761246,19762069..19762235,19763258..19763332,
FT                   19768184..19768298,19769048..19769106,19807480..19807736,
FT                   19808002..19808035))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18357"
FT                   /product="mCG18357, isoform CRA_b"
FT                   /note="gene_id=mCG18357.2 transcript_id=mCT178213.0
FT                   protein_id=mCP101135.0 isoform=CRA_b"
FT                   /protein_id="EDL18724.1"
FT                   MAKVKERL"
FT   assembly_gap    19794432..19794548
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    19828891..19829095
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   gene            19829190..>19855103
FT                   /gene="Ccnk"
FT                   /locus_tag="mCG_115906"
FT                   /note="gene_id=mCG115906.1"
FT   mRNA            join(19829190..19829251,19831767..19831798,
FT                   19838986..19839106,19839788..19839869,19841674..19841805,
FT                   19846293..19846398,19846963..19847020,19847688..19847857,
FT                   19848204..19848472,19848960..19848993,19851929..19852003,
FT                   19854858..>19855103)
FT                   /gene="Ccnk"
FT                   /locus_tag="mCG_115906"
FT                   /product="cyclin K"
FT                   /note="gene_id=mCG115906.1 transcript_id=mCT117016.1
FT                   created on 29-JAN-2003"
FT   assembly_gap    19834458..19834477
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(19839837..19839869,19841674..19841805,
FT                   19846293..19846398,19846963..19847020,19847688..19847857,
FT                   19848204..19848472,19848960..19848993,19851929..19852003,
FT                   19854858..>19855103)
FT                   /codon_start=1
FT                   /gene="Ccnk"
FT                   /locus_tag="mCG_115906"
FT                   /product="cyclin K"
FT                   /note="gene_id=mCG115906.1 transcript_id=mCT117016.1
FT                   protein_id=mCP50237.1"
FT                   /protein_id="EDL18722.1"
FT   assembly_gap    19853250..19853552
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    19855167..19855386
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   gene            complement(19858138..19864389)
FT                   /locus_tag="mCG_18349"
FT                   /note="gene_id=mCG18349.2"
FT   mRNA            complement(join(19858138..19859201,19859889..19859987,
FT                   19860601..19860696,19864282..19864389))
FT                   /locus_tag="mCG_18349"
FT                   /product="mCG18349"
FT                   /note="gene_id=mCG18349.2 transcript_id=mCT12921.2 created
FT                   on 29-JAN-2003"
FT   CDS             complement(19858773..19858973)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18349"
FT                   /product="mCG18349"
FT                   /note="gene_id=mCG18349.2 transcript_id=mCT12921.2
FT                   protein_id=mCP14285.1"
FT                   /protein_id="EDL18721.1"
FT   gene            <19868353..19869056
FT                   /locus_tag="mCG_1047996"
FT                   /note="gene_id=mCG1047996.1"
FT   mRNA            <19868353..19869056
FT                   /locus_tag="mCG_1047996"
FT                   /product="mCG1047996"
FT                   /note="gene_id=mCG1047996.1 transcript_id=mCT165700.1
FT                   created on 05-FEB-2003"
FT   CDS             <19868484..19868843
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047996"
FT                   /product="mCG1047996"
FT                   /note="gene_id=mCG1047996.1 transcript_id=mCT165700.1
FT                   protein_id=mCP50424.0"
FT                   /protein_id="EDL18720.1"
FT                   LALRSSLSDWYRLAP"
FT   assembly_gap    19884211..19884344
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    19885529..19886478
FT                   /estimated_length=950
FT                   /gap_type="unknown"
FT   assembly_gap    19887782..19888357
FT                   /estimated_length=576
FT                   /gap_type="unknown"
FT   assembly_gap    19888848..19889034
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    19901644..19901663
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19903824..19903843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19908636..19908655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19917801..19917820
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<19927358..19928067)
FT                   /locus_tag="mCG_115914"
FT                   /note="gene_id=mCG115914.1"
FT   mRNA            complement(<19927358..19928067)
FT                   /locus_tag="mCG_115914"
FT                   /product="mCG115914"
FT                   /note="gene_id=mCG115914.1 transcript_id=mCT117024.1
FT                   created on 29-JAN-2003"
FT   CDS             complement(<19927358..19927810)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115914"
FT                   /product="mCG115914"
FT                   /note="gene_id=mCG115914.1 transcript_id=mCT117024.1
FT                   protein_id=mCP50280.1"
FT                   /protein_id="EDL18719.1"
FT   assembly_gap    19928142..19928540
FT                   /estimated_length=399
FT                   /gap_type="unknown"
FT   assembly_gap    19951228..19951840
FT                   /estimated_length=613
FT                   /gap_type="unknown"
FT   assembly_gap    19952853..19952872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19954432..19954451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19960459..>19982392
FT                   /locus_tag="mCG_18356"
FT                   /note="gene_id=mCG18356.1"
FT   mRNA            join(19960459..19960940,19965893..19966539,
FT                   19970661..19970804,19972664..19972992,19973536..19973662,
FT                   19974175..19974320,19976024..19976105,19981306..19981388,
FT                   19981848..>19982392)
FT                   /locus_tag="mCG_18356"
FT                   /product="mCG18356"
FT                   /note="gene_id=mCG18356.1 transcript_id=mCT14078.1 created
FT                   on 29-JAN-2003"
FT   CDS             join(19960668..19960940,19965893..19966539,
FT                   19970661..19970804,19972664..19972992,19973536..19973662,
FT                   19974175..19974320,19976024..19976105,19981306..19981388,
FT                   19981848..19982392)
FT                   /codon_start=1
FT                   /locus_tag="mCG_18356"
FT                   /product="mCG18356"
FT                   /note="gene_id=mCG18356.1 transcript_id=mCT14078.1
FT                   protein_id=mCP14260.2"
FT                   /protein_id="EDL18717.1"
FT   assembly_gap    19963981..19964000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19967096..19967115
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19967999..>19982211)
FT                   /locus_tag="mCG_145969"
FT                   /note="gene_id=mCG145969.0"
FT   mRNA            complement(join(19967999..19968437,19976375..19976471,
FT                   19982032..>19982211))
FT                   /locus_tag="mCG_145969"
FT                   /product="mCG145969"
FT                   /note="gene_id=mCG145969.0 transcript_id=mCT186077.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(join(19976382..19976471,19982032..>19982184))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145969"
FT                   /product="mCG145969"
FT                   /note="gene_id=mCG145969.0 transcript_id=mCT186077.0
FT                   protein_id=mCP107377.0"
FT                   /protein_id="EDL18718.1"
FT   gene            19984523..20016889
FT                   /gene="Cyp46a1"
FT                   /locus_tag="mCG_18352"
FT                   /note="gene_id=mCG18352.2"
FT   mRNA            join(19984523..19985053,19988615..19988798,
FT                   19996550..19996630,19997241..19997322,19999801..19999874,
FT                   20000316..20000402,20005675..20005813,20006407..20006517,
FT                   20007267..20007417,20007593..20007655,20009996..20010068,
FT                   20012059..20012143,20012603..20012713,20015059..20015147,
FT                   20015774..20015840,20016170..20016889)
FT                   /gene="Cyp46a1"
FT                   /locus_tag="mCG_18352"
FT                   /product="cytochrome P450, family 46, subfamily a,
FT                   polypeptide 1, transcript variant mCT14074"
FT                   /note="gene_id=mCG18352.2 transcript_id=mCT14074.2 created
FT                   on 23-JUL-2002"
FT   assembly_gap    19988499..19988518
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(<19988592..19988798,19996550..19996630,
FT                   19997241..19997322,19999801..19999874,20000316..20000402,
FT                   20005675..20005813,20006407..20006517,20007267..20007417,
FT                   20007593..20007655,20009996..20010068,20012059..20012143,
FT                   20012603..20012713,20015059..20015147,20015774..20015840,
FT                   20016170..20016889)
FT                   /gene="Cyp46a1"
FT                   /locus_tag="mCG_18352"
FT                   /product="cytochrome P450, family 46, subfamily a,
FT                   polypeptide 1, transcript variant mCT191212"
FT                   /note="gene_id=mCG18352.2 transcript_id=mCT191212.0 created
FT                   on 09-MAR-2004"
FT   CDS             join(<19988626..19988798,19996550..19996630,
FT                   19997241..19997322,19999801..19999874,20000316..20000402,
FT                   20005675..20005813,20006407..20006517,20007267..20007417,
FT                   20007593..20007655,20009996..20010068,20012059..20012143,
FT                   20012603..20012713,20015059..20015147,20015774..20015840,
FT                   20016170..20016340)
FT                   /codon_start=1
FT                   /gene="Cyp46a1"
FT                   /locus_tag="mCG_18352"
FT                   /product="cytochrome P450, family 46, subfamily a,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=mCG18352.2 transcript_id=mCT191212.0
FT                   protein_id=mCP112219.0 isoform=CRA_a"
FT                   /protein_id="EDL18715.1"
FT                   C"
FT   CDS             join(19988680..19988798,19996550..19996630,
FT                   19997241..19997322,19999801..19999874,20000316..20000402,
FT                   20005675..20005813,20006407..20006517,20007267..20007417,
FT                   20007593..20007655,20009996..20010068,20012059..20012143,
FT                   20012603..20012713,20015059..20015147,20015774..20015840,
FT                   20016170..20016340)
FT                   /codon_start=1
FT                   /gene="Cyp46a1"
FT                   /locus_tag="mCG_18352"
FT                   /product="cytochrome P450, family 46, subfamily a,
FT                   polypeptide 1, isoform CRA_b"
FT                   /note="gene_id=mCG18352.2 transcript_id=mCT14074.2
FT                   protein_id=mCP14292.2 isoform=CRA_b"
FT                   /protein_id="EDL18716.1"
FT   assembly_gap    20002055..20002344
FT                   /estimated_length=290
FT                   /gap_type="unknown"
FT   assembly_gap    20009600..20009728
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    20015905..20016034
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    20023963..20023982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            20025586..20187626
FT                   /locus_tag="mCG_115900"
FT                   /note="gene_id=mCG115900.1"
FT   mRNA            join(20025586..20025981,20120500..20120682,
FT                   20129789..20129921,20154388..20154517,20156998..20157147,
FT                   20158089..20158158,20159733..20159843,20160887..20160982,
FT                   20162291..20162318,20162444..20162532,20163136..20163235,
FT                   20164480..20164634,20169322..20169447,20169654..20169785,
FT                   20175693..20175760,20178299..20178387,20182652..20182749,
FT                   20182863..20182950,20184226..20184321,20185333..20185463,
FT                   20186102..20187575)
FT                   /locus_tag="mCG_115900"
FT                   /product="mCG115900, transcript variant mCT182153"
FT                   /note="gene_id=mCG115900.1 transcript_id=mCT182153.0
FT                   created on 04-JUN-2003"
FT   assembly_gap    20033914..20033963
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    20053564..20053583
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20067034..20067490
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    20071611..20071705
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    20078408..20078977
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    20095147..20095323
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    20105859..20108007
FT                   /estimated_length=2149
FT                   /gap_type="unknown"
FT   assembly_gap    20111094..20111113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20114107..20114147
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    20117472..20117491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20125273..20126418
FT                   /estimated_length=1146
FT                   /gap_type="unknown"
FT   assembly_gap    20127348..20127579
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    20129198..20129457
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    20130917..20144286
FT                   /estimated_length=13370
FT                   /gap_type="unknown"
FT   assembly_gap    20146269..20146288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20148670..20148689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20150527..20150546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20153124..20153143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(20154339..20154559,20157996..20158158,
FT                   20159733..20159843,20160887..20160982,20162291..20162318,
FT                   20162444..20162532,20163136..20163235,20164480..20164634,
FT                   20169322..20169447,20169654..20169785,20175693..20175760,
FT                   20178299..20178387,20182652..20182749,20182863..20182950,
FT                   20184226..20184321,20185333..20185463,20186102..20187626)
FT                   /locus_tag="mCG_115900"
FT                   /product="mCG115900, transcript variant mCT117013"
FT                   /note="gene_id=mCG115900.1 transcript_id=mCT117013.1
FT                   created on 04-JUN-2003"
FT   CDS             join(20154405..20154559,20157996..20158158,
FT                   20159733..20159843,20160887..20160982,20162291..20162318,
FT                   20162444..20162532,20163136..20163235,20164480..20164634,
FT                   20169322..20169447,20169654..20169785,20175693..20175760,
FT                   20178299..20178387,20182652..20182749,20182863..20182950,
FT                   20184226..20184321,20185333..20185463,20186102..20186227)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115900"
FT                   /product="mCG115900, isoform CRA_b"
FT                   /note="gene_id=mCG115900.1 transcript_id=mCT117013.1
FT                   protein_id=mCP50188.1 isoform=CRA_b"
FT                   /protein_id="EDL18714.1"
FT   CDS             join(20154405..20154517,20156998..20157147,
FT                   20158089..20158158,20159733..20159843,20160887..20160982,
FT                   20162291..20162318,20162444..20162532,20163136..20163235,
FT                   20164480..20164634,20169322..20169447,20169654..20169785,
FT                   20175693..20175760,20178299..20178387,20182652..20182749,
FT                   20182863..20182950,20184226..20184321,20185333..20185463,
FT                   20186102..20186227)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115900"
FT                   /product="mCG115900, isoform CRA_a"
FT                   /note="gene_id=mCG115900.1 transcript_id=mCT182153.0
FT                   protein_id=mCP105073.0 isoform=CRA_a"
FT                   /protein_id="EDL18713.1"
FT   assembly_gap    20162326..20162443
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    20179576..20179595
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20191958..20191998
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    20193251..20194622
FT                   /estimated_length=1372
FT                   /gap_type="unknown"
FT   assembly_gap    20196856..20197200
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    20202785..20202804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20204974..20205338
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    20206600..20206619
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20207860..20207879
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20216262..20221714
FT                   /estimated_length=5453
FT                   /gap_type="unknown"
FT   assembly_gap    20251184..20251203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            20254540..20337250
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /note="gene_id=mCG13049.2"
FT   mRNA            join(20254540..20254777,20297026..20297194,
FT                   20301633..20301810,20322020..20322083,20323138..20323197,
FT                   20324165..20324357,20324833..20324954,20328561..20328621,
FT                   20330223..20330286,20331927..20331993,20334782..20334848,
FT                   20335142..20335309,20336763..20337250)
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /product="Ena-vasodilator stimulated phosphoprotein,
FT                   transcript variant mCT171181"
FT                   /note="gene_id=mCG13049.2 transcript_id=mCT171181.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(20254755..20254777,20297026..20297194,
FT                   20301633..20301810,20322020..20322083,20323138..20323197,
FT                   20324165..20324357,20324833..20324954,20328561..20328621,
FT                   20330223..20330286,20331927..20331993,20334782..20334848,
FT                   20335142..20335309,20336763..20336780)
FT                   /codon_start=1
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /product="Ena-vasodilator stimulated phosphoprotein,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG13049.2 transcript_id=mCT171181.0
FT                   protein_id=mCP94100.0 isoform=CRA_d"
FT                   /protein_id="EDL18712.1"
FT                   KQVQKNKVLYQDCPSGRS"
FT   assembly_gap    20282056..20282299
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   mRNA            join(20284531..20284613,20297026..20297196,
FT                   20301656..20301810,20322020..20322083,20323138..20323160,
FT                   20324128..20324166,20324266..20324357,20324833..20324954,
FT                   20328561..20328621,20330223..20330286,20331927..20331993,
FT                   20332080..20332142,20334782..20334848,20335142..20335199,
FT                   20336763..20337230)
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /product="Ena-vasodilator stimulated phosphoprotein,
FT                   transcript variant mCT171182"
FT                   /note="gene_id=mCG13049.2 transcript_id=mCT171182.0 created
FT                   on 23-JUL-2002"
FT   mRNA            join(20284548..20284613,20297026..20297194,
FT                   20301633..20301810,20322020..20322083,20323138..20323196,
FT                   20324128..20324357,20324833..20324954,20328561..20328621,
FT                   20330223..20330286,20331927..20331993,20334782..20334848,
FT                   20335142..20335199,20336763..20337158)
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /product="Ena-vasodilator stimulated phosphoprotein,
FT                   transcript variant mCT13064"
FT                   /note="gene_id=mCG13049.2 transcript_id=mCT13064.2 created
FT                   on 23-JUL-2002"
FT   mRNA            join(20284548..20284613,20297026..20297194,
FT                   20301633..20301810,20322020..20322083,20323138..20323196,
FT                   20324128..20324200,20328561..20328621,20330223..20330286,
FT                   20331927..20331993,20334782..20334848,20335142..20335199,
FT                   20336763..20336803)
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /product="Ena-vasodilator stimulated phosphoprotein,
FT                   transcript variant mCT171180"
FT                   /note="gene_id=mCG13049.2 transcript_id=mCT171180.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(20284603..20284613,20297026..20297196,
FT                   20301656..20301810,20322020..20322083,20323138..20323160,
FT                   20324128..20324166,20324266..20324357,20324833..20324954,
FT                   20328561..20328621,20330223..20330286,20331927..20331993,
FT                   20332080..20332142,20334782..20334848,20335142..20335199,
FT                   20336763..20336800)
FT                   /codon_start=1
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /product="Ena-vasodilator stimulated phosphoprotein,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG13049.2 transcript_id=mCT171182.0
FT                   protein_id=mCP94098.0 isoform=CRA_b"
FT                   /protein_id="EDL18710.1"
FT   CDS             join(20284603..20284613,20297026..20297194,
FT                   20301633..20301810,20322020..20322083,20323138..20323196,
FT                   20324128..20324357,20324833..20324954,20328561..20328621,
FT                   20330223..20330286,20331927..20331993,20334782..20334848,
FT                   20335142..20335199,20336763..20336800)
FT                   /codon_start=1
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /product="Ena-vasodilator stimulated phosphoprotein,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG13049.2 transcript_id=mCT13064.2
FT                   protein_id=mCP14290.2 isoform=CRA_c"
FT                   /protein_id="EDL18711.1"
FT   CDS             join(20284603..20284613,20297026..20297194,
FT                   20301633..20301810,20322020..20322083,20323138..20323196,
FT                   20324128..20324200,20328561..20328621,20330223..20330286,
FT                   20331927..20331993,20334782..20334848,20335142..20335199,
FT                   20336763..20336800)
FT                   /codon_start=1
FT                   /gene="Evl"
FT                   /locus_tag="mCG_13049"
FT                   /product="Ena-vasodilator stimulated phosphoprotein,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG13049.2 transcript_id=mCT171180.0
FT                   protein_id=mCP94099.0 isoform=CRA_a"
FT                   /protein_id="EDL18709.1"
FT   gene            complement(20327281..20351025)
FT                   /gene="Degs2"
FT                   /locus_tag="mCG_13047"
FT                   /note="gene_id=mCG13047.1"
FT   mRNA            complement(join(20327281..20327889,20339202..20339344,
FT                   20340620..20341362,20350878..20351025))
FT                   /gene="Degs2"
FT                   /locus_tag="mCG_13047"
FT                   /product="degenerative spermatocyte homolog 2 (Drosophila),
FT                   lipid desaturase"
FT                   /note="gene_id=mCG13047.1 transcript_id=mCT13061.1 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(20327811..20327889,20339202..20339344,
FT                   20340620..20341362,20350878..20350959))
FT                   /codon_start=1
FT                   /gene="Degs2"
FT                   /locus_tag="mCG_13047"
FT                   /product="degenerative spermatocyte homolog 2 (Drosophila),
FT                   lipid desaturase"
FT                   /note="gene_id=mCG13047.1 transcript_id=mCT13061.1
FT                   protein_id=mCP14272.2"
FT                   /protein_id="EDL18708.1"
FT                   CEASHNLR"
FT   assembly_gap    20334956..20334975
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            20362499..20363522
FT                   /locus_tag="mCG_13052"
FT                   /note="gene_id=mCG13052.1"
FT   mRNA            20362499..20363522
FT                   /locus_tag="mCG_13052"
FT                   /product="mCG13052"
FT                   /note="gene_id=mCG13052.1 transcript_id=mCT13066.1 created
FT                   on 29-JAN-2003"
FT   CDS             20362602..20362820
FT                   /codon_start=1
FT                   /locus_tag="mCG_13052"
FT                   /product="mCG13052"
FT                   /note="gene_id=mCG13052.1 transcript_id=mCT13066.1
FT                   protein_id=mCP14296.1"
FT                   /protein_id="EDL18707.1"
FT   assembly_gap    20366879..20367080
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    20368219..20368238
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20389056..20389075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20391448..20391467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20393112..20393131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20411103..20411378
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    20418233..20418252
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20431557..20431700
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    20442043..20442062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <20442125..20467877
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /note="gene_id=mCG13054.2"
FT   mRNA            join(<20442125..20442348,20442690..20442862,
FT                   20455327..20455489,20461765..20461825,20463452..20463610,
FT                   20464319..20465352)
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /product="YY1 transcription factor, transcript variant
FT                   mCT171184"
FT                   /note="gene_id=mCG13054.2 transcript_id=mCT171184.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(<20442125..20442348,20442690..20442862,
FT                   20455327..20455489,20461765..20461825,20463452..20463610,
FT                   20464319..20464501)
FT                   /codon_start=1
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /product="YY1 transcription factor, isoform CRA_b"
FT                   /note="gene_id=mCG13054.2 transcript_id=mCT171184.0
FT                   protein_id=mCP94101.0 isoform=CRA_b"
FT                   /protein_id="EDL18704.1"
FT   mRNA            join(20442151..20442862,20455327..20455489,
FT                   20461765..20461825,20463452..20463610,20464319..20465595,
FT                   20467215..20467476)
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /product="YY1 transcription factor, transcript variant
FT                   mCT13068"
FT                   /note="gene_id=mCG13054.2 transcript_id=mCT13068.2 created
FT                   on 23-JUL-2002"
FT   CDS             join(20442184..20442862,20455327..20455489,
FT                   20461765..20461825,20463452..20463610,20464319..20464501)
FT                   /codon_start=1
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /product="YY1 transcription factor, isoform CRA_a"
FT                   /note="gene_id=mCG13054.2 transcript_id=mCT13068.2
FT                   protein_id=mCP14299.2 isoform=CRA_a"
FT                   /protein_id="EDL18703.1"
FT                   LKSHILTHAKAKNNQ"
FT   mRNA            join(<20442316..20442335,20442469..20442862,
FT                   20455327..20455489,20461765..20461825,20463452..20463493,
FT                   20464319..20464838,20465029..20465849,20466163..20466729,
FT                   20467013..20467877)
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /product="YY1 transcription factor, transcript variant
FT                   mCT171183"
FT                   /note="gene_id=mCG13054.2 transcript_id=mCT171183.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(<20442318..20442335,20442469..20442862,
FT                   20455327..20455489,20461765..20461825,20463452..20463493,
FT                   20464319..20464501)
FT                   /codon_start=1
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /product="YY1 transcription factor, isoform CRA_c"
FT                   /note="gene_id=mCG13054.2 transcript_id=mCT171183.0
FT                   protein_id=mCP94102.0 isoform=CRA_c"
FT                   /protein_id="EDL18705.1"
FT                   AKNNQ"
FT   mRNA            join(<20442430..20442639,20442779..20442862,
FT                   20455327..20455489,20461765..20461825,20463452..20463610,
FT                   20464319..20464825,20465339..20465595,20467217..20467491)
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /product="YY1 transcription factor, transcript variant
FT                   mCT171185"
FT                   /note="gene_id=mCG13054.2 transcript_id=mCT171185.0 created
FT                   on 23-JUL-2002"
FT   CDS             join(<20442432..20442639,20442779..20442862,
FT                   20455327..20455489,20461765..20461825,20463452..20463610,
FT                   20464319..20464501)
FT                   /codon_start=1
FT                   /gene="Yy1"
FT                   /locus_tag="mCG_13054"
FT                   /product="YY1 transcription factor, isoform CRA_d"
FT                   /note="gene_id=mCG13054.2 transcript_id=mCT171185.0
FT                   protein_id=mCP94103.0 isoform=CRA_d"
FT                   /protein_id="EDL18706.1"
FT                   KNNQ"
FT   assembly_gap    20443085..20443304
FT                   /estimated_length=220
FT                   /gap_type="unknown"
FT   gene            complement(20474734..20484639)
FT                   /gene="Slc25a29"
FT                   /locus_tag="mCG_13051"
FT                   /note="gene_id=mCG13051.1"
FT   mRNA            complement(join(20474734..20476340,20476526..20476609,
FT                   20479986..20480029,20484437..20484639))
FT                   /gene="Slc25a29"
FT                   /locus_tag="mCG_13051"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   palmitoylcarnitine transporter), member 29"
FT                   /note="gene_id=mCG13051.1 transcript_id=mCT13065.1 created
FT                   on 31-DEC-2002"
FT   CDS             complement(join(20475582..20476340,20476526..20476609,
FT                   20479986..20480029,20484437..20484470))
FT                   /codon_start=1
FT                   /gene="Slc25a29"
FT                   /locus_tag="mCG_13051"
FT                   /product="solute carrier family 25 (mitochondrial carrier,
FT                   palmitoylcarnitine transporter), member 29"
FT                   /note="gene_id=mCG13051.1 transcript_id=mCT13065.1
FT                   protein_id=mCP14288.2"
FT                   /protein_id="EDL18702.1"
FT   assembly_gap    20478273..20478954
FT                   /estimated_length=682
FT                   /gap_type="unknown"
FT   gene            20484864..20508177
FT                   /gene="AI132487"
FT                   /locus_tag="mCG_13053"
FT                   /note="gene_id=mCG13053.2"
FT   mRNA            join(20484864..20485428,20504705..20504748,
FT                   20505060..20505131,20505573..20505755,20506651..20506975,
FT                   20507303..20507861)
FT                   /gene="AI132487"
FT                   /locus_tag="mCG_13053"
FT                   /product="expressed sequence AI132487, transcript variant
FT                   mCT181735"
FT                   /note="gene_id=mCG13053.2 transcript_id=mCT181735.0 created
FT                   on 03-APR-2003"
FT   assembly_gap    20491153..20491172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20493057..20493076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            join(20502490..20502562,20504705..20504748,
FT                   20505060..20505131,20505573..20505755,20506651..20506975,
FT                   20507303..20508177)
FT                   /gene="AI132487"
FT                   /locus_tag="mCG_13053"
FT                   /product="expressed sequence AI132487, transcript variant
FT                   mCT13067"
FT                   /note="gene_id=mCG13053.2 transcript_id=mCT13067.1 created
FT                   on 03-APR-2003"
FT   CDS             join(20502535..20502562,20504705..20504748,
FT                   20505060..20505131,20505573..20505755,20506651..20506975,
FT                   20507303..20507583)
FT                   /codon_start=1
FT                   /gene="AI132487"
FT                   /locus_tag="mCG_13053"
FT                   /product="expressed sequence AI132487, isoform CRA_a"
FT                   /note="gene_id=mCG13053.2 transcript_id=mCT13067.1
FT                   protein_id=mCP14300.2 isoform=CRA_a"
FT                   /protein_id="EDL18700.1"
FT   CDS             join(20506933..20506975,20507303..20507583)
FT                   /codon_start=1
FT                   /gene="AI132487"
FT                   /locus_tag="mCG_13053"
FT                   /product="expressed sequence AI132487, isoform CRA_b"
FT                   /note="gene_id=mCG13053.2 transcript_id=mCT181735.0
FT                   protein_id=mCP104657.0 isoform=CRA_b"
FT                   /protein_id="EDL18701.1"
FT                   LLT"
FT   gene            complement(20511398..20539917)
FT                   /gene="Wars"
FT                   /locus_tag="mCG_13056"
FT                   /note="gene_id=mCG13056.2"
FT   mRNA            complement(join(20511398..20511700,20512651..20512775,
FT                   20513420..20513452,20515029..20515175,20520949..20521038,
FT                   20521414..20521533,20526835..20526943,20528477..20528690,
FT                   20534182..20534354,20539852..20539917))
FT                   /gene="Wars"
FT                   /locus_tag="mCG_13056"
FT                   /product="tryptophanyl-tRNA synthetase, transcript variant
FT                   mCT171186"
FT                   /note="gene_id=mCG13056.2 transcript_id=mCT171186.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(20511399..20512075,20512090..20512808,
FT                   20515029..20515171,20520852..20521038,20521414..20521533,
FT                   20526835..20526943,20528477..20528690,20534182..20534354,
FT                   20538951..20538990))
FT                   /gene="Wars"
FT                   /locus_tag="mCG_13056"
FT                   /product="tryptophanyl-tRNA synthetase, transcript variant
FT                   mCT171187"
FT                   /note="gene_id=mCG13056.2 transcript_id=mCT171187.0 created
FT                   on 23-JUL-2002"
FT   mRNA            complement(join(20511401..20511700,20512651..20512808,
FT                   20515029..20515171,20520852..20521038,20521414..20521533,
FT                   20526835..20526943,20528477..20528690,20534182..20534292,
FT                   20538959..20538988))
FT                   /gene="Wars"
FT                   /locus_tag="mCG_13056"
FT                   /product="tryptophanyl-tRNA synthetase, transcript variant
FT                   mCT13054"
FT                   /note="gene_id=mCG13056.2 transcript_id=mCT13054.2 created
FT                   on 23-JUL-2002"
FT   assembly_gap    20513394..20513413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20514780..20514799
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20515912..20518960
FT                   /estimated_length=3049
FT                   /gap_type="unknown"
FT   CDS             complement(join(20520990..20521038,20521414..20521533,
FT                   20526835..20526943,20528477..20528690,20534182..20534292))
FT                   /codon_start=1
FT                   /gene="Wars"
FT                   /locus_tag="mCG_13056"
FT                   /product="tryptophanyl-tRNA synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG13056.2 transcript_id=mCT171187.0
FT                   protein_id=mCP94105.0 isoform=CRA_a"
FT                   /protein_id="EDL18697.1"
FT   CDS             complement(join(20520990..20521038,20521414..20521533,
FT                   20526835..20526943,20528477..20528690,20534182..20534292))
FT                   /codon_start=1
FT                   /gene="Wars"
FT                   /locus_tag="mCG_13056"
FT                   /product="tryptophanyl-tRNA synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG13056.2 transcript_id=mCT13054.2
FT                   protein_id=mCP14302.1 isoform=CRA_a"
FT                   /protein_id="EDL18698.1"
FT   CDS             complement(join(20520990..20521038,20521414..20521533,
FT                   20526835..20526943,20528477..20528690,20534182..20534292))
FT                   /codon_start=1
FT                   /gene="Wars"
FT                   /locus_tag="mCG_13056"
FT                   /product="tryptophanyl-tRNA synthetase, isoform CRA_a"
FT                   /note="gene_id=mCG13056.2 transcript_id=mCT171186.0
FT                   protein_id=mCP94104.0 isoform=CRA_a"
FT                   /protein_id="EDL18699.1"
FT   assembly_gap    20522897..20523015
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    20553737..20553782
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   gene            20558342..20672609
FT                   /locus_tag="mCG_13048"
FT                   /note="gene_id=mCG13048.2"
FT   mRNA            join(20558342..20558527,20625138..20625285,
FT                   20637139..20637269,20669138..20669308,20670557..20670697,
FT                   20671393..20672609)
FT                   /locus_tag="mCG_13048"
FT                   /product="mCG13048"
FT                   /note="gene_id=mCG13048.2 transcript_id=mCT13062.2 created
FT                   on 29-JAN-2003"
FT   assembly_gap    20561226..20561245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20572390..20572409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20580331..20580651
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    20594306..20594325
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20599909..20600003
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    20633431..20634235
FT                   /estimated_length=805
FT                   /gap_type="unknown"
FT   CDS             join(20637255..20637269,20669138..20669308,
FT                   20670557..20670697,20671393..20671614)
FT                   /codon_start=1
FT                   /locus_tag="mCG_13048"
FT                   /product="mCG13048"
FT                   /note="gene_id=mCG13048.2 transcript_id=mCT13062.2
FT                   protein_id=mCP14286.2"
FT                   /protein_id="EDL18696.1"
FT   assembly_gap    20644437..20646500
FT                   /estimated_length=2064
FT                   /gap_type="unknown"
FT   assembly_gap    20649706..20649787
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   gene            complement(<20677135..>20712626)
FT                   /locus_tag="mCG_13050"
FT                   /note="gene_id=mCG13050.1"
FT   mRNA            complement(join(<20677135..20677427,20677611..20678517,
FT                   20679495..20679578,20681163..20681270,20681820..20681886,
FT                   20683019..20683180,20697070..20697098,20712585..>20712626))
FT                   /locus_tag="mCG_13050"
FT                   /product="mCG13050"
FT                   /note="gene_id=mCG13050.1 transcript_id=mCT13063.1 created
FT                   on 29-JAN-2003"
FT   CDS             complement(join(20677135..20677427,20677611..20678517,
FT                   20679495..20679578,20681163..20681270,20681820..20681886,
FT                   20683019..20683180,20697070..20697098,20712585..20712626))
FT                   /codon_start=1
FT                   /locus_tag="mCG_13050"
FT                   /product="mCG13050"
FT                   /note="gene_id=mCG13050.1 transcript_id=mCT13063.1
FT                   protein_id=mCP14294.1"
FT                   /protein_id="EDL18695.1"
FT   assembly_gap    20692913..20693148
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    20696590..20696767
FT                   /estimated_length=178
FT                   /gap_type="unknown"
FT   assembly_gap    20700670..20700837
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    20705123..20705324
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    20706871..20706983
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    20712389..20712552
FT                   /estimated_length=164
FT                   /gap_type="unknown"
FT   assembly_gap    20718298..20718416
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    20727238..20727624
FT                   /estimated_length=387
FT                   /gap_type="unknown"
FT   assembly_gap    20748230..20748337
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    20754495..20754705
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    20785094..20785735
FT                   /estimated_length=642
FT                   /gap_type="unknown"
FT   assembly_gap    20788633..20791280
FT                   /estimated_length=2648
FT                   /gap_type="unknown"
FT   assembly_gap    20794016..20794277
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    20801723..20802035
FT                   /estimated_length=313
FT                   /gap_type="unknown"
FT   assembly_gap    20804141..20804478
FT                   /estimated_length=338
FT                   /gap_type="unknown"
FT   assembly_gap    20810154..20810520
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    20838970..20839200
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    20853623..20853642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20855823..20855842
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20859869..20861017
FT                   /estimated_length=1149
FT                   /gap_type="unknown"
FT   assembly_gap    20865400..20865419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20868797..20868964
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    20870718..20872544
FT                   /estimated_length=1827
FT                   /gap_type="unknown"
FT   assembly_gap    20873221..20873351
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    20945246..20947436
FT                   /estimated_length=2191
FT                   /gap_type="unknown"
FT   assembly_gap    20962296..20962315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20963334..20963353
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20981003..20981193
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    21023105..21023376
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    21032187..21032586
FT                   /estimated_length=400
FT                   /gap_type="unknown"
FT   assembly_gap    21037150..21037302
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    21040605..21040624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21057362..21057395
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            21061642..21068635
FT                   /gene="Dlk1"
FT                   /locus_tag="mCG_13045"
FT                   /note="gene_id=mCG13045.2"
FT   mRNA            join(21061642..21061862,21063120..21063183,
FT                   21063628..21063758,21066207..21066348,21067734..21068635)
FT                   /gene="Dlk1"
FT                   /locus_tag="mCG_13045"
FT                   /product="delta-like 1 homolog (Drosophila)"
FT                   /note="gene_id=mCG13045.2 transcript_id=mCT13084.2 created
FT                   on 03-APR-2003"
FT   CDS             join(21061796..21061862,21063120..21063183,
FT                   21063628..21063758,21066207..21066348,21067734..21068487)
FT                   /codon_start=1
FT                   /gene="Dlk1"
FT                   /locus_tag="mCG_13045"
FT                   /product="delta-like 1 homolog (Drosophila)"
FT                   /note="gene_id=mCG13045.2 transcript_id=mCT13084.2
FT                   protein_id=mCP14258.2"
FT                   /db_xref="GOA:Q925U3"
FT                   /db_xref="InterPro:IPR000152"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="MGI:MGI:94900"
FT                   /db_xref="UniProtKB/TrEMBL:Q925U3"
FT                   /protein_id="EDL18694.1"
FT   assembly_gap    21078642..21078661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21086649..21086668
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21088869..21089678
FT                   /estimated_length=810
FT                   /gap_type="unknown"
FT   assembly_gap    21105122..21105369
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    21129022..21129041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21131740..21137311
FT                   /estimated_length=5572
FT                   /gap_type="unknown"
FT   assembly_gap    21141526..21141660
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    21149659..21151555
FT                   /estimated_length=1897
FT                   /gap_type="unknown"
FT   gene            21151599..21168977
FT                   /gene="Gtl2"
FT                   /locus_tag="mCG_13046"
FT                   /note="gene_id=mCG13046.2"
FT   mRNA            join(21151599..21152738,21156416..21156489,
FT                   21156590..21156747,21165153..21165236,21165556..21168977)
FT                   /gene="Gtl2"
FT                   /locus_tag="mCG_13046"
FT                   /product="GTL2, imprinted maternally expressed untranslated
FT                   mRNA"
FT                   /note="gene_id=mCG13046.2 transcript_id=mCT13085.2 created
FT                   on 31-DEC-2002"
FT   CDS             join(21152491..21152738,21156416..21156489,
FT                   21156590..21156747,21165153..21165233)
FT                   /codon_start=1
FT                   /gene="Gtl2"
FT                   /locus_tag="mCG_13046"
FT                   /product="GTL2, imprinted maternally expressed untranslated
FT                   mRNA"
FT                   /note="gene_id=mCG13046.2 transcript_id=mCT13085.2
FT                   protein_id=mCP14266.2"
FT                   /protein_id="EDL18693.1"
FT   assembly_gap    21154436..21156097
FT                   /estimated_length=1662
FT                   /gap_type="unknown"
FT   gene            21169699..21171663
FT                   /locus_tag="mCG_147613"
FT                   /note="gene_id=mCG147613.0"
FT   mRNA            join(21169699..21170554,21170571..21171663)
FT                   /locus_tag="mCG_147613"
FT                   /product="mCG147613"
FT                   /note="gene_id=mCG147613.0 transcript_id=mCT187876.0
FT                   created on 13-JAN-2004"
FT   CDS             21170808..21171089
FT                   /codon_start=1
FT                   /locus_tag="mCG_147613"
FT                   /product="mCG147613"
FT                   /note="gene_id=mCG147613.0 transcript_id=mCT187876.0
FT                   protein_id=mCP108990.0"
FT                   /protein_id="EDL18692.1"
FT   gene            complement(21176195..21178650)
FT                   /locus_tag="mCG_1048020"
FT                   /note="gene_id=mCG1048020.0"
FT   mRNA            complement(join(21176195..21176356,21178238..21178650))
FT                   /locus_tag="mCG_1048020"
FT                   /product="mCG1048020"
FT                   /note="gene_id=mCG1048020.0 transcript_id=mCT165724.0
FT                   created on 05-FEB-2003"
FT   CDS             complement(21178321..21178473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1048020"
FT                   /product="mCG1048020"
FT                   /note="gene_id=mCG1048020.0 transcript_id=mCT165724.0
FT                   protein_id=mCP50263.1"
FT                   /protein_id="EDL18691.1"
FT                   ASPWL"
FT   assembly_gap    21196581..21196771
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    21198162..21198356
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   gene            complement(<21198786..>21202352)
FT                   /locus_tag="mCG_1047978"
FT                   /note="gene_id=mCG1047978.1"
FT   mRNA            complement(<21198786..>21202352)
FT                   /locus_tag="mCG_1047978"
FT                   /product="mCG1047978"
FT                   /note="gene_id=mCG1047978.1 transcript_id=mCT165682.1
FT                   created on 04-FEB-2003"
FT   CDS             complement(<21198786..21202352)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1047978"
FT                   /product="mCG1047978"
FT                   /note="gene_id=mCG1047978.1 transcript_id=mCT165682.1
FT                   protein_id=mCP50419.1"
FT                   /protein_id="EDL18690.1"
FT   assembly_gap    21231314..21231333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21253375..21269030
FT                   /locus_tag="mCG_11475"
FT                   /note="gene_id=mCG11475.1"
FT   mRNA            join(21253375..21254002,21256405..21256493,
FT                   21257323..21257408,21258264..21258350,21259110..21259189,
FT                   21261671..21261747,21263164..21263249,21264103..21264155,
FT                   21265368..21265436,21267038..21267122,21268060..21269030)
FT                   /locus_tag="mCG_11475"
FT                   /product="mCG11475, transcript variant mCT11941"
FT                   /note="gene_id=mCG11475.1 transcript_id=mCT11941.2 created
FT                   on 29-JAN-2003"
FT   mRNA            join(<21253442..21254002,21256405..21256493,
FT                   21257323..21257408,21258264..21258350,21259110..21259189,
FT                   21261601..21261747,21263164..21263249,21264103..21264155,
FT                   21265368..21265436,21267038..21267122,21268060..21269029)
FT                   /locus_tag="mCG_11475"
FT                   /product="mCG11475, transcript variant mCT191235"
FT                   /note="gene_id=mCG11475.1 transcript_id=mCT191235.0 created
FT                   on 09-MAR-2004"
FT   CDS             21253482..21253712
FT                   /codon_start=1
FT                   /locus_tag="mCG_11475"
FT                   /product="mCG11475, isoform CRA_a"
FT                   /note="gene_id=mCG11475.1 transcript_id=mCT11941.2
FT                   protein_id=mCP14269.2 isoform=CRA_a"
FT                   /protein_id="EDL18688.1"
FT   CDS             join(<21261616..21261747,21263164..21263249,
FT                   21264103..21264155,21265368..21265436,21267038..21267081)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11475"
FT                   /product="mCG11475, isoform CRA_b"
FT                   /note="gene_id=mCG11475.1 transcript_id=mCT191235.0
FT                   protein_id=mCP112196.0 isoform=CRA_b"
FT                   /protein_id="EDL18689.1"
FT   assembly_gap    21271726..21271745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21287165..21287184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21288828..21288847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21295856..21295943
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            21305178..21312177
FT                   /locus_tag="mCG_147615"
FT                   /note="gene_id=mCG147615.0"
FT   mRNA            join(21305178..21305721,21308219..21312177)
FT                   /locus_tag="mCG_147615"
FT                   /product="mCG147615"
FT                   /note="gene_id=mCG147615.0 transcript_id=mCT187878.0
FT                   created on 13-JAN-2004"
FT   CDS             21311544..21311804
FT                   /codon_start=1
FT                   /locus_tag="mCG_147615"
FT                   /product="mCG147615"
FT                   /note="gene_id=mCG147615.0 transcript_id=mCT187878.0
FT                   protein_id=mCP108991.0"
FT                   /protein_id="EDL18687.1"
FT   assembly_gap    21317223..21317626
FT                   /estimated_length=404
FT                   /gap_type="unknown"
FT   assembly_gap    21320350..21320471
FT                   /estimated_length=122
FT                   /gap_type="unknown"
FT   gene            <21344760..21359025
FT                   /locus_tag="mCG_146212"
FT                   /note="gene_id=mCG146212.0"
FT   mRNA            join(<21344760..21344800,21347459..21347589,
FT                   21351470..21351593,21351840..21352068,21353135..21353196,
FT                   21353444..21353625,21357695..21357863,21358665..21359025)
FT                   /locus_tag="mCG_146212"
FT                   /product="mCG146212"
FT                   /note="gene_id=mCG146212.0 transcript_id=mCT186315.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<21347571..21347589,21351470..21351593,
FT                   21351840..21351987)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146212"
FT                   /product="mCG146212"
FT                   /note="gene_id=mCG146212.0 transcript_id=mCT186315.0
FT                   protein_id=mCP107383.0"
FT                   /protein_id="EDL18686.1"
FT   assembly_gap    21392607..21392649
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    21421082..21421101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21466539..21466558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21467946..21467965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21477218..21477549
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    21490737..21492064
FT                   /estimated_length=1328
FT                   /gap_type="unknown"
FT   gene            complement(21503449..21504191)
FT                   /locus_tag="mCG_11470"
FT                   /note="gene_id=mCG11470.1"
FT   mRNA            complement(21503449..21504191)
FT                   /locus_tag="mCG_11470"
FT                   /product="mCG11470"
FT                   /note="gene_id=mCG11470.1 transcript_id=mCT11936.1 created
FT                   on 29-JAN-2003"
FT   CDS             complement(21503734..21504150)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11470"
FT                   /product="mCG11470"
FT                   /note="gene_id=mCG11470.1 transcript_id=mCT11936.1
FT                   protein_id=mCP14284.2"
FT                   /protein_id="EDL18685.1"
FT   assembly_gap    21507380..21507440
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   gene            21513788..21515524
FT                   /locus_tag="mCG_147637"
FT                   /note="gene_id=mCG147637.0"
FT   mRNA            join(21513788..21513942,21514150..21515524)
FT                   /locus_tag="mCG_147637"
FT                   /product="mCG147637"
FT                   /note="gene_id=mCG147637.0 transcript_id=mCT187900.0
FT                   created on 13-JAN-2004"
FT   CDS             21514544..21514840
FT                   /codon_start=1
FT                   /locus_tag="mCG_147637"
FT                   /product="mCG147637"
FT                   /note="gene_id=mCG147637.0 transcript_id=mCT187900.0
FT                   protein_id=mCP109014.0"
FT                   /protein_id="EDL18684.1"
FT   assembly_gap    21529885..21529904
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21533810..21533829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21536242..21536261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21561540..21562015
FT                   /estimated_length=476
FT                   /gap_type="unknown"
FT   assembly_gap    21567428..21567447
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21568933..21568952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21570709..21570728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21592620..21592969
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    21609328..21609457
FT                   /estimated_length=130
FT                   /gap_type="unknown"
FT   assembly_gap    21615880..21621287
FT                   /estimated_length=5408
FT                   /gap_type="unknown"
FT   assembly_gap    21682288..21682500
FT                   /estimated_length=213
FT                   /gap_type="unknown"
FT   assembly_gap    21709004..21709042
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            complement(21754011..>21760689)
FT                   /locus_tag="mCG_145300"
FT                   /note="gene_id=mCG145300.0"
FT   mRNA            complement(join(21754011..21755326,21758878..21758947,
FT                   21760445..>21760689))
FT                   /locus_tag="mCG_145300"
FT                   /product="mCG145300"
FT                   /note="gene_id=mCG145300.0 transcript_id=mCT184724.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(21754244..>21754486)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145300"
FT                   /product="mCG145300"
FT                   /note="gene_id=mCG145300.0 transcript_id=mCT184724.0
FT                   protein_id=mCP105381.0"
FT                   /protein_id="EDL18683.1"
FT   assembly_gap    21758539..21758558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21780596..21785744)
FT                   /locus_tag="mCG_147640"
FT                   /note="gene_id=mCG147640.0"
FT   mRNA            complement(join(21780596..21784813,21785421..21785603,
FT                   21785678..21785744))
FT                   /locus_tag="mCG_147640"
FT                   /product="mCG147640"
FT                   /note="gene_id=mCG147640.0 transcript_id=mCT187903.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(21780913..21781191)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147640"
FT                   /product="mCG147640"
FT                   /note="gene_id=mCG147640.0 transcript_id=mCT187903.0
FT                   protein_id=mCP109016.0"
FT                   /protein_id="EDL18682.1"
FT   assembly_gap    21793811..21793976
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    21842060..21842079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21850472..21850491
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<21878400..>21881093)
FT                   /locus_tag="mCG_145306"
FT                   /note="gene_id=mCG145306.0"
FT   mRNA            complement(join(<21878400..21878593,21880486..21880770,
FT                   21881003..>21881093))
FT                   /locus_tag="mCG_145306"
FT                   /product="mCG145306"
FT                   /note="gene_id=mCG145306.0 transcript_id=mCT184730.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(<21878400..21878593,21880486..>21880686))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145306"
FT                   /product="mCG145306"
FT                   /note="gene_id=mCG145306.0 transcript_id=mCT184730.0
FT                   protein_id=mCP105386.0"
FT                   /protein_id="EDL18681.1"
FT   assembly_gap    21881376..21881935
FT                   /estimated_length=560
FT                   /gap_type="unknown"
FT   gene            21882532..21884392
FT                   /gene="Dio3"
FT                   /locus_tag="mCG_11477"
FT                   /note="gene_id=mCG11477.2"
FT   mRNA            21882532..21884392
FT                   /gene="Dio3"
FT                   /locus_tag="mCG_11477"
FT                   /product="deiodinase, iodothyronine type III"
FT                   /note="gene_id=mCG11477.2 transcript_id=mCT11943.2 created
FT                   on 21-JAN-2003"
FT   CDS             21882607..21883038
FT                   /codon_start=1
FT                   /gene="Dio3"
FT                   /locus_tag="mCG_11477"
FT                   /product="deiodinase, iodothyronine type III"
FT                   /note="gene_id=mCG11477.2 transcript_id=mCT11943.2
FT                   protein_id=mCP14283.2"
FT                   /protein_id="EDL18680.1"
FT   assembly_gap    21885395..21885898
FT                   /estimated_length=504
FT                   /gap_type="unknown"
FT   assembly_gap    21888766..21888785
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21905656..21906170
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    21907133..21907152
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21908315..21908334
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21911506..21913137
FT                   /locus_tag="mCG_117216"
FT                   /note="gene_id=mCG117216.1"
FT   mRNA            join(21911506..21911542,21911721..21911810,
FT                   21911890..21912233,21912847..21913137)
FT                   /locus_tag="mCG_117216"
FT                   /product="mCG117216"
FT                   /note="gene_id=mCG117216.1 transcript_id=mCT118352.1
FT                   created on 29-JAN-2003"
FT   CDS             join(21911740..21911810,21911890..21911962)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117216"
FT                   /product="mCG117216"
FT                   /note="gene_id=mCG117216.1 transcript_id=mCT118352.1
FT                   protein_id=mCP50084.1"
FT                   /protein_id="EDL18679.1"
FT                   TA"
FT   gene            complement(21925391..21926157)
FT                   /locus_tag="mCG_11476"
FT                   /note="gene_id=mCG11476.2"
FT   mRNA            complement(21925391..21926157)
FT                   /locus_tag="mCG_11476"
FT                   /product="mCG11476"
FT                   /note="gene_id=mCG11476.2 transcript_id=mCT11942.2 created
FT                   on 29-JAN-2003"
FT   CDS             complement(21925728..21925982)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11476"
FT                   /product="mCG11476"
FT                   /note="gene_id=mCG11476.2 transcript_id=mCT11942.2
FT                   protein_id=mCP14282.2"
FT                   /protein_id="EDL18678.1"
FT   assembly_gap    21998494..21999636
FT                   /estimated_length=1143
FT                   /gap_type="unknown"
FT   assembly_gap    22054171..22054190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <22054191..22185962
FT                   /gene="Ppp2r5c"
FT                   /locus_tag="mCG_11471"
FT                   /note="gene_id=mCG11471.2"
FT   mRNA            join(<22054191..22054261,22054847..22054912,
FT                   22072683..22072854,22133237..22133436,22146966..22147076,
FT                   22148486..22148578,22148662..22148792,22153952..22154011,
FT                   22155675..22155783,22157734..22157787,22164189..22164359,
FT                   22170621..22171948,22173587..22173802)
FT                   /gene="Ppp2r5c"
FT                   /locus_tag="mCG_11471"
FT                   /product="protein phosphatase 2, regulatory subunit B
FT                   (B56), gamma isoform, transcript variant mCT191223"
FT                   /note="gene_id=mCG11471.2 transcript_id=mCT191223.0 created
FT                   on 09-MAR-2004"
FT   mRNA            join(22054192..22054261,22072683..22072854,
FT                   22133237..22133436,22146966..22147076,22148486..22148578,
FT                   22148662..22148792,22153952..22154011,22155675..22155783,
FT                   22157734..22157787,22164189..22164359,22170621..22170748,
FT                   22171847..22171948,22173587..22173659,22177637..22177753,
FT                   22183301..22185962)
FT                   /gene="Ppp2r5c"
FT                   /locus_tag="mCG_11471"
FT                   /product="protein phosphatase 2, regulatory subunit B
FT                   (B56), gamma isoform, transcript variant mCT11937"
FT                   /note="gene_id=mCG11471.2 transcript_id=mCT11937.2 created
FT                   on 21-JAN-2003"
FT   CDS             join(<22054193..22054261,22054847..22054912,
FT                   22072683..22072854,22133237..22133436,22146966..22147076,
FT                   22148486..22148578,22148662..22148792,22153952..22154011,
FT                   22155675..22155783,22157734..22157787,22164189..22164359,
FT                   22170621..22170752)
FT                   /codon_start=1
FT                   /gene="Ppp2r5c"
FT                   /locus_tag="mCG_11471"
FT                   /product="protein phosphatase 2, regulatory subunit B
FT                   (B56), gamma isoform, isoform CRA_b"
FT                   /note="gene_id=mCG11471.2 transcript_id=mCT191223.0
FT                   protein_id=mCP112194.0 isoform=CRA_b"
FT                   /protein_id="EDL18673.1"
FT   CDS             join(22054235..22054261,22072683..22072854,
FT                   22133237..22133436,22146966..22147076,22148486..22148578,
FT                   22148662..22148792,22153952..22154011,22155675..22155783,
FT                   22157734..22157787,22164189..22164359,22170621..22170748,
FT                   22171847..22171948,22173587..22173659,22177637..22177753,
FT                   22183301..22183432)
FT                   /codon_start=1
FT                   /gene="Ppp2r5c"
FT                   /locus_tag="mCG_11471"
FT                   /product="protein phosphatase 2, regulatory subunit B
FT                   (B56), gamma isoform, isoform CRA_c"
FT                   /note="gene_id=mCG11471.2 transcript_id=mCT11937.2
FT                   protein_id=mCP14289.2 isoform=CRA_c"
FT                   /protein_id="EDL18674.1"
FT   gene            complement(22077892..22079454)
FT                   /locus_tag="mCG_147618"
FT                   /note="gene_id=mCG147618.0"
FT   mRNA            complement(22077892..22079454)
FT                   /locus_tag="mCG_147618"
FT                   /product="mCG147618"
FT                   /note="gene_id=mCG147618.0 transcript_id=mCT187881.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(22078551..22079072)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147618"
FT                   /product="mCG147618"
FT                   /note="gene_id=mCG147618.0 transcript_id=mCT187881.0
FT                   protein_id=mCP108994.0"
FT                   /protein_id="EDL18677.1"
FT                   HLPDSLSAGS"
FT   gene            complement(22083732..22093042)
FT                   /locus_tag="mCG_11472"
FT                   /note="gene_id=mCG11472.2"
FT   mRNA            complement(join(22083732..22083838,22090872..22091043,
FT                   22092971..22093042))
FT                   /locus_tag="mCG_11472"
FT                   /product="mCG11472, transcript variant mCT179357"
FT                   /note="gene_id=mCG11472.2 transcript_id=mCT179357.0 created
FT                   on 29-JAN-2003"
FT   CDS             complement(join(22083802..22083838,22090872..22090930))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11472"
FT                   /product="mCG11472, isoform CRA_b"
FT                   /note="gene_id=mCG11472.2 transcript_id=mCT179357.0
FT                   protein_id=mCP102279.0 isoform=CRA_b"
FT                   /protein_id="EDL18676.1"
FT                   /translation="MVFSALQLWATGAAAAWIARPQTPSEGNDLD"
FT   mRNA            complement(join(22086071..22086463,22090872..22091043,
FT                   22092391..22092487))
FT                   /locus_tag="mCG_11472"
FT                   /product="mCG11472, transcript variant mCT11938"
FT                   /note="gene_id=mCG11472.2 transcript_id=mCT11938.1 created
FT                   on 29-JAN-2003"
FT   CDS             complement(22086146..22086442)
FT                   /codon_start=1
FT                   /locus_tag="mCG_11472"
FT                   /product="mCG11472, isoform CRA_a"
FT                   /note="gene_id=mCG11472.2 transcript_id=mCT11938.1
FT                   protein_id=mCP14295.1 isoform=CRA_a"
FT                   /protein_id="EDL18675.1"
FT   mRNA            join(22092633..22092789,22133237..22133436,
FT                   22146966..22147076,22148486..22148578,22148662..22148792,
FT                   22153952..22154011,22155675..22155783,22157734..22157787,
FT                   22164189..22164359,22170621..22170748,22171847..22171948,
FT                   22173587..22173659,22183301..22185961)
FT                   /gene="Ppp2r5c"
FT                   /locus_tag="mCG_11471"
FT                   /product="protein phosphatase 2, regulatory subunit B
FT                   (B56), gamma isoform, transcript variant mCT179048"
FT                   /note="gene_id=mCG11471.2 transcript_id=mCT179048.0 created
FT                   on 21-JAN-2003"
FT   CDS             join(22092696..22092789,22133237..22133436,
FT                   22146966..22147076,22148486..22148578,22148662..22148792,
FT                   22153952..22154011,22155675..22155783,22157734..22157787,
FT                   22164189..22164359,22170621..22170748,22171847..22171948,
FT                   22173587..22173659,22183301..22183432)
FT                   /codon_start=1
FT                   /gene="Ppp2r5c"
FT                   /locus_tag="mCG_11471"
FT                   /product="protein phosphatase 2, regulatory subunit B
FT                   (B56), gamma isoform, isoform CRA_a"
FT                   /note="gene_id=mCG11471.2 transcript_id=mCT179048.0
FT                   protein_id=mCP101970.0 isoform=CRA_a"
FT                   /protein_id="EDL18672.1"
FT   assembly_gap    22126112..22126131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22127798..22128191
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    22129437..22129456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22136019..22144810
FT                   /estimated_length=8792
FT                   /gap_type="unknown"
FT   gene            22204346..22269704
FT                   /gene="Dync1h1"
FT                   /locus_tag="mCG_11473"
FT                   /note="gene_id=mCG11473.1"
FT   mRNA            join(22204346..22204751,22215238..22215325,
FT                   22216938..22217111,22217246..22217501,22217784..22217970,
FT                   22219301..22219572,22219659..22219886,22220581..22221657,
FT                   22222150..22222329,22223260..22223409,22224488..22224634,
FT                   22227470..22227610,22228382..22228558,22228686..22228796,
FT                   22228877..22228996,22229814..22230053,22230895..22231050,
FT                   22231188..22231301,22231679..22231789,22231863..22232076,
FT                   22232239..22232378,22232532..22232698,22232778..22232951,
FT                   22233453..22233618,22233699..22233887,22234564..22234758,
FT                   22235595..22235877,22236108..22236208,22237174..22237333,
FT                   22238456..22238699,22238850..22239033,22239281..22239493,
FT                   22240061..22240299,22240451..22240607,22241694..22241921,
FT                   22242689..22242919,22243101..22243241,22243453..22243686,
FT                   22243773..22243979,22244056..22244177,22244963..22245128,
FT                   22246075..22246238,22249146..22249160,22251166..22251300,
FT                   22251907..22252021,22252122..22252283,22252369..22252583,
FT                   22252681..22252885,22254398..22254571,22254658..22254777,
FT                   22254981..22255101,22257057..22257252,22257691..22257808,
FT                   22258323..22258538,22259196..22259408,22259504..22259631,
FT                   22259954..22260107,22260753..22260899,22260988..22261138,
FT                   22261252..22261505,22261584..22261718,22261810..22261904,
FT                   22262001..22262175,22262352..22262427,22263604..22263764,
FT                   22263934..22264045,22264135..22264319,22264513..22264626,
FT                   22265298..22265468,22265622..22265839,22265953..22266056,
FT                   22267316..22267527,22267863..22268016,22268444..22268586,
FT                   22268738..22268906,22269074..22269201,22269343..22269704)
FT                   /gene="Dync1h1"
FT                   /locus_tag="mCG_11473"
FT                   /product="dynein cytoplasmic 1 heavy chain 1, transcript
FT                   variant mCT11939"
FT                   /note="gene_id=mCG11473.1 transcript_id=mCT11939.2 created
FT                   on 22-JUL-2002"
FT   mRNA            join(22204346..22204751,22215238..22215325,
FT                   22216938..22217111,22217246..22217501,22217784..22217970,
FT                   22219301..22219572,22219659..22219886,22220581..22221657,
FT                   22222150..22222329,22223260..22223409,22224488..22224634,
FT                   22227470..22227610,22228382..22228558,22228686..22228796,
FT                   22228877..22228996,22229814..22230053,22230895..22231050,
FT                   22231188..22231301,22231679..22231789,22231863..22232076,
FT                   22232239..22232378,22232532..22232698,22232778..22232951,
FT                   22233453..22233618,22233699..22233887,22234564..22234758,
FT                   22235595..22235877,22236108..22236208,22237174..22237333,
FT                   22238456..22238699,22238850..22239033,22239281..22239493,
FT                   22240061..22240299,22240451..22240607,22241694..22241921,
FT                   22242689..22242919,22243101..22243241,22243453..22243686,
FT                   22243773..22243979,22244056..22244177,22244963..22245128,
FT                   22246075..22246238,22251166..22251300,22251907..22252021,
FT                   22252122..22252283,22252369..22252583,22252681..22252885,
FT                   22254398..22254571,22254658..22254777,22254981..22255101,
FT                   22257057..22257252,22257691..22257808,22258323..22258538,
FT                   22259196..22259408,22259504..22259631,22259954..22260107,
FT                   22260753..22260899,22260988..22261138,22261252..22261505,
FT                   22261584..22261718,22261810..22261904,22262001..22262175,
FT                   22262352..22262427,22263604..22263764,22263934..22264045,
FT                   22264135..22264319,22264513..22264626,22265298..22265468,
FT                   22265622..22265839,22265953..22266056,22267316..22267527,
FT                   22267863..22268016,22268444..22268586,22268738..22268906,
FT                   22269074..22269201,22269343..22269704)
FT                   /gene="Dync1h1"
FT                   /locus_tag="mCG_11473"
FT                   /product="dynein cytoplasmic 1 heavy chain 1, transcript
FT                   variant mCT171174"
FT                   /note="gene_id=mCG11473.1 transcript_id=mCT171174.0 created
FT                   on 22-JUL-2002"
FT   CDS             join(22204502..22204751,22215238..22215325,
FT                   22216938..22217111,22217246..22217501,22217784..22217970,
FT                   22219301..22219572,22219659..22219886,22220581..22221657,
FT                   22222150..22222329,22223260..22223409,22224488..22224634,
FT                   22227470..22227610,22228382..22228558,22228686..22228796,
FT                   22228877..22228996,22229814..22230053,22230895..22231050,
FT                   22231188..22231301,22231679..22231789,22231863..22232076,
FT                   22232239..22232378,22232532..22232698,22232778..22232951,
FT                   22233453..22233618,22233699..22233887,22234564..22234758,
FT                   22235595..22235877,22236108..22236208,22237174..22237333,
FT                   22238456..22238699,22238850..22239033,22239281..22239493,
FT                   22240061..22240299,22240451..22240607,22241694..22241921,
FT                   22242689..22242919,22243101..22243241,22243453..22243686,
FT                   22243773..22243979,22244056..22244177,22244963..22245128,
FT                   22246075..22246238,22249146..22249160,22251166..22251300,
FT                   22251907..22252021,22252122..22252283,22252369..22252583,
FT                   22252681..22252885,22254398..22254571,22254658..22254777,
FT                   22254981..22255101,22257057..22257252,22257691..22257808,
FT                   22258323..22258538,22259196..22259408,22259504..22259631,
FT                   22259954..22260107,22260753..22260899,22260988..22261138,
FT                   22261252..22261505,22261584..22261718,22261810..22261904,
FT                   22262001..22262175,22262352..22262427,22263604..22263764,
FT                   22263934..22264045,22264135..22264319,22264513..22264626,
FT                   22265298..22265468,22265622..22265839,22265953..22266056,
FT                   22267316..22267527,22267863..22268016,22268444..22268586,
FT                   22268738..22268906,22269074..22269201,22269343..22269471)
FT                   /codon_start=1
FT                   /gene="Dync1h1"
FT                   /locus_tag="mCG_11473"
FT                   /product="dynein cytoplasmic 1 heavy chain 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG11473.1 transcript_id=mCT11939.2
FT                   protein_id=mCP14261.2 isoform=CRA_a"
FT                   /protein_id="EDL18670.1"
FT                   EDPRSFYERGVAVLCTE"
FT   CDS             join(22204502..22204751,22215238..22215325,
FT                   22216938..22217111,22217246..22217501,22217784..22217970,
FT                   22219301..22219572,22219659..22219886,22220581..22221657,
FT                   22222150..22222329,22223260..22223409,22224488..22224634,
FT                   22227470..22227610,22228382..22228558,22228686..22228796,
FT                   22228877..22228996,22229814..22230053,22230895..22231050,
FT                   22231188..22231301,22231679..22231789,22231863..22232076,
FT                   22232239..22232378,22232532..22232698,22232778..22232951,
FT                   22233453..22233618,22233699..22233887,22234564..22234758,
FT                   22235595..22235877,22236108..22236208,22237174..22237333,
FT                   22238456..22238699,22238850..22239033,22239281..22239493,
FT                   22240061..22240299,22240451..22240607,22241694..22241921,
FT                   22242689..22242919,22243101..22243241,22243453..22243686,
FT                   22243773..22243979,22244056..22244177,22244963..22245128,
FT                   22246075..22246238,22251166..22251300,22251907..22252021,
FT                   22252122..22252283,22252369..22252583,22252681..22252885,
FT                   22254398..22254571,22254658..22254777,22254981..22255101,
FT                   22257057..22257252,22257691..22257808,22258323..22258538,
FT                   22259196..22259408,22259504..22259631,22259954..22260107,
FT                   22260753..22260899,22260988..22261138,22261252..22261505,
FT                   22261584..22261718,22261810..22261904,22262001..22262175,
FT                   22262352..22262427,22263604..22263764,22263934..22264045,
FT                   22264135..22264319,22264513..22264626,22265298..22265468,
FT                   22265622..22265839,22265953..22266056,22267316..22267527,
FT                   22267863..22268016,22268444..22268586,22268738..22268906,
FT                   22269074..22269201,22269343..22269471)
FT                   /codon_start=1
FT                   /gene="Dync1h1"
FT                   /locus_tag="mCG_11473"
FT                   /product="dynein cytoplasmic 1 heavy chain 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG11473.1 transcript_id=mCT171174.0
FT                   protein_id=mCP94092.0 isoform=CRA_b"
FT                   /protein_id="EDL18671.1"
FT                   FYERGVAVLCTE"
FT   assembly_gap    22218208..22218309
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    22249161..22249260
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            complement(22270497..22285334)
FT                   /locus_tag="mCG_11474"
FT                   /note="gene_id=mCG11474.1"
FT   mRNA            complement(join(22270497..22270590,22271295..22271800,
FT                   22273074..22273124,22273561..22273728,22275021..22275078,
FT                   22285292..22285334))
FT                   /locus_tag="mCG_11474"
FT                   /product="mCG11474"
FT                   /note="gene_id=mCG11474.1 transcript_id=mCT11940.1 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(22270587..22270590,22271295..22271800,
FT                   22273074..22273124,22273561..22273659))
FT                   /codon_start=1
FT                   /locus_tag="mCG_11474"
FT                   /product="mCG11474"
FT                   /note="gene_id=mCG11474.1 transcript_id=mCT11940.1
FT                   protein_id=mCP14268.1"
FT                   /db_xref="GOA:Q80ZT1"
FT                   /db_xref="MGI:MGI:1913573"
FT                   /db_xref="UniProtKB/TrEMBL:Q80ZT1"
FT                   /protein_id="EDL18669.1"
FT   assembly_gap    22270898..22271058
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    22279134..22279211
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    22282181..22282547
FT                   /estimated_length=367
FT                   /gap_type="unknown"
FT   assembly_gap    22283505..22283524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22293123..22298915)
FT                   /locus_tag="mCG_14932"
FT                   /note="gene_id=mCG14932.2"
FT   mRNA            complement(join(22293123..22293612,22293671..22294163,
FT                   22294628..22294678,22298766..22298816))
FT                   /locus_tag="mCG_14932"
FT                   /product="mCG14932, transcript variant mCT171190"
FT                   /note="gene_id=mCG14932.2 transcript_id=mCT171190.0 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(22293544..22294163,22294628..22294961,
FT                   22295118..22295386,22295534..22295681,22295826..22296016,
FT                   22296225..22296390,22296537..22296655,22296830..22296857,
FT                   22297085..22297218,22297570..22297807,22298037..22298198,
FT                   22298770..22298915))
FT                   /locus_tag="mCG_14932"
FT                   /product="mCG14932, transcript variant mCT171188"
FT                   /note="gene_id=mCG14932.2 transcript_id=mCT171188.0 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(22293544..22294163,22294628..22294961,
FT                   22295118..22295386,22295534..22295681,22295826..22296016,
FT                   22296225..22296390,22296537..22296857,22297085..22297218,
FT                   22297570..22297936,22298037..22298198,22298770..22298803))
FT                   /locus_tag="mCG_14932"
FT                   /product="mCG14932, transcript variant mCT21048"
FT                   /note="gene_id=mCG14932.2 transcript_id=mCT21048.1 created
FT                   on 22-JUL-2002"
FT   mRNA            complement(join(22293586..22294163,22294628..22294961,
FT                   22295118..22295386,22295534..22295683,22295912..22296016,
FT                   22296225..22296390,22296537..22296710,22298157..22298198,
FT                   22298770..22298800))
FT                   /locus_tag="mCG_14932"
FT                   /product="mCG14932, transcript variant mCT171189"
FT                   /note="gene_id=mCG14932.2 transcript_id=mCT171189.0 created
FT                   on 22-JUL-2002"
FT   CDS             complement(join(22294054..22294163,22294628..22294961,
FT                   22295118..22295386,22295534..22295683,22295912..22296016,
FT                   22296225..22296390,22296537..22296710,22298157..22298198))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14932"
FT                   /product="mCG14932, isoform CRA_a"
FT                   /note="gene_id=mCG14932.2 transcript_id=mCT171189.0
FT                   protein_id=mCP94106.0 isoform=CRA_a"
FT                   /protein_id="EDL18665.1"
FT   CDS             complement(join(22294054..22294163,22294628..22294961,
FT                   22295118..22295386,22295534..22295681,22295826..22296016,
FT                   22296225..22296390,22296537..22296655,22296830..22296857,
FT                   22297085..22297218,22297570..22297807,22298037..22298198))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14932"
FT                   /product="mCG14932, isoform CRA_c"
FT                   /note="gene_id=mCG14932.2 transcript_id=mCT171188.0
FT                   protein_id=mCP94107.0 isoform=CRA_c"
FT                   /protein_id="EDL18667.1"
FT   CDS             complement(join(22294054..22294163,22294628..22294961,
FT                   22295118..22295386,22295534..22295681,22295826..22296016,
FT                   22296225..22296390,22296537..22296857,22297085..22297218,
FT                   22297570..22297936,22298037..22298198))
FT                   /codon_start=1
FT                   /locus_tag="mCG_14932"
FT                   /product="mCG14932, isoform CRA_b"
FT                   /note="gene_id=mCG14932.2 transcript_id=mCT21048.1
FT                   protein_id=mCP14256.2 isoform=CRA_b"