Dbfetch

ID   CH466548; SV 1; linear; genomic DNA; CON; MUS; 26984737 BP.
XX
AC   CH466548;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 181000113612773 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-26984737
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-26984737
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; fa47c30f01d6b16451a58504f01e96b2.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000209.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000002881; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006299; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025952; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025955; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025958; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025961; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025968; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025969; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025981; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025982; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025997; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026014; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026019; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026024; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026027; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026029; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026031; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026034; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026100; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026135; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026179; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026180; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026182; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026185; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026193; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026199; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026207; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026209; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026235; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032883; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032968; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033227; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037805; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038331; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039323; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039342; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041075; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042807; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046994; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048495; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049339; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055197; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061816; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062939; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063558; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064272; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064294; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078974; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000102412; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016004; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016005; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016006; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016008; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016014; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016015; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016021; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016023; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016028; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016029; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016031; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016034; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016038; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016040; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016043; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016045; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016052; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016053; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016058; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016064; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016066; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016073; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016078; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016081; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016093; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016095; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016098; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016100; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016103; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016108; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016114; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016117; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016121; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016127; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016135; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016136; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016137; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016138; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016141; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016143; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016144; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016145; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016146; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016147; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016150; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016155; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016162; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016164; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016165; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016168; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016172; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016178; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016184; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016186; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016192; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016194; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016201; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018051; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0023438; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0015986; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0015987; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0015988; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0015990; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0015996; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0015997; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016003; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016006; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016011; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016012; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016014; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016017; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016021; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016023; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016026; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016028; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016035; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016036; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016041; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016047; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016049; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016056; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016061; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016064; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016076; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016081; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016083; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016086; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016091; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016097; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016100; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016104; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016110; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016118; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016119; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016120; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016121; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016124; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016126; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016127; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016128; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016129; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016130; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016133; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016138; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016145; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016147; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016148; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016151; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016155; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016161; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016167; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016169; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016175; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016177; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016178; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0016184; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0018024; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0023396; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0015942; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015943; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015944; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015946; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015952; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015953; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015959; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015962; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015967; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015968; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015970; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015973; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015977; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015979; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015982; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015984; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015991; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015992; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0015997; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016003; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016005; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016012; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016020; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016033; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016035; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016038; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016040; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016043; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016048; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016054; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016057; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016061; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016067; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016075; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016076; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016077; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016078; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016081; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016083; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016084; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016085; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016086; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016090; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016095; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016102; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016104; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016105; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016108; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016112; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016118; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016124; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016126; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016132; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016134; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016135; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0016141; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0017988; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0023361; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015943; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015944; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015945; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015947; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015953; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015954; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015961; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015966; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015967; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015969; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015972; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015976; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015978; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015981; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015983; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015990; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015991; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0015996; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016002; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016004; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016011; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016016; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016019; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016031; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016033; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016036; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016038; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016041; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016046; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016052; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016055; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016059; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016065; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016073; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016074; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016075; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016076; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016079; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016081; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016082; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016083; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016084; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016088; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016093; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016100; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016102; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016103; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016106; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016110; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016116; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016122; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016124; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016130; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016132; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016133; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016139; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017992; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0023401; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015775; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015776; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015777; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015779; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015785; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015786; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015791; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015793; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015798; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015799; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015801; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015804; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015808; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015810; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015813; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015815; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015822; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015823; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015828; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015834; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015836; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015843; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015848; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015851; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015863; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015865; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015868; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015870; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015872; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015877; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015883; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015886; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015890; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015896; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015904; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015905; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015906; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015907; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015910; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015912; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015913; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015914; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015915; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015924; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015931; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015933; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015934; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015937; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015941; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015947; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015953; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015955; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015961; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015964; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0015969; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017805; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0023162; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016394; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016395; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016396; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016398; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016404; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016405; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016411; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016414; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016419; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016420; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016422; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016425; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016429; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016431; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016434; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016436; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016443; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016444; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016449; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016455; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016457; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016464; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016469; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016472; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016484; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016486; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016489; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016491; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016494; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016499; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016505; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016508; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016512; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016518; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016526; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016527; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016528; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016529; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016532; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016534; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016535; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016536; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016537; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016538; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016546; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016553; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016555; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016556; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016559; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016563; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016569; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016575; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016577; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016583; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016585; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016586; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016592; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0018444; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0023843; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015356; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015357; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015358; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015360; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015366; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015367; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015375; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015380; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015383; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015386; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015390; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015392; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015395; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015397; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015404; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015405; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015409; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015410; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015418; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015425; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015430; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015433; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015446; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015448; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015451; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015453; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015456; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015461; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015467; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015470; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015474; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015480; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015488; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015489; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015490; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015491; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015494; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015496; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015497; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015498; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015499; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015508; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015515; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015517; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015518; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015521; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015525; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015531; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015537; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015539; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015545; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015547; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015548; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0015554; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017367; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0015746; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015747; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015748; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015750; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015756; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015757; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015762; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015765; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015770; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015771; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015773; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015776; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015780; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015782; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015785; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015787; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015794; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015795; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015800; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015806; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015808; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015815; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015820; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015823; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015835; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015837; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015840; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015842; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015845; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015850; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015856; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015859; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015863; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015869; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015877; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015878; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015879; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015880; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015883; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015885; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015886; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015887; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015888; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015892; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015897; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015904; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015906; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015907; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015910; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015914; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015920; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015926; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015928; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015934; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015936; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015937; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0015943; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0017780; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0023136; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0015847; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015848; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015849; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015851; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015857; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015858; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015864; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015866; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015871; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015872; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015874; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015877; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015881; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015883; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015886; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015888; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015895; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015896; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015901; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015907; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015909; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015916; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015921; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015924; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015936; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015938; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015941; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015943; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015946; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015951; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015957; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015960; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015964; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015970; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015978; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015979; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015980; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015981; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015984; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015986; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015987; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015988; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015989; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015993; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0015998; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016005; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016007; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016008; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016011; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016015; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016021; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016027; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016029; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016035; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016037; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016038; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0016044; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0017890; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0023267; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0015849; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015850; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015851; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015853; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015859; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015860; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015866; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015868; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015873; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015874; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015876; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015879; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015883; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015885; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015888; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015890; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015897; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015898; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015903; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015909; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015911; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015918; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015923; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015926; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015939; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015941; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015944; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015946; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015949; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015954; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015960; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015963; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015967; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015973; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015981; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015982; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015983; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015984; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015987; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015989; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015990; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015991; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015992; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0015996; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016001; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016008; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016010; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016011; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016014; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016018; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016024; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016030; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016032; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016038; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016040; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016041; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0016047; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0017882; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0015918; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015919; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015920; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015922; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015928; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015929; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015938; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015943; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015944; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015946; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015949; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015953; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015955; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015958; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015960; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015967; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015968; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015973; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015979; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015981; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015988; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015993; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0015996; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016008; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016010; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016013; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016015; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016018; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016023; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016029; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016032; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016036; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016042; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016050; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016051; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016052; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016053; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016056; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016058; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016059; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016060; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016061; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016065; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016070; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016077; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016079; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016080; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016083; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016087; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016093; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016099; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016101; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016107; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016109; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016110; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0016116; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0017961; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015869; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015870; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015871; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015873; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015879; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015880; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015886; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015888; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015893; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015894; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015896; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015899; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015903; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015905; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015908; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015910; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015917; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015918; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015923; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015929; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015931; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015938; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015946; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015959; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015961; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015964; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015966; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015969; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015974; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015980; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015983; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015987; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0015993; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016001; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016002; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016003; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016004; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016007; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016009; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016010; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016011; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016012; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016013; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016016; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016021; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016028; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016030; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016031; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016034; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016038; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016044; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016050; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016052; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016058; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016060; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016061; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016067; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017908; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0023255; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016442; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016443; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016444; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016446; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016452; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016453; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016461; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016466; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016467; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016469; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016472; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016476; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016478; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016481; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016483; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016490; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016491; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016496; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016502; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016504; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016511; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016516; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016519; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016531; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016533; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016536; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016538; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016541; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016546; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016552; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016555; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016559; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016565; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016573; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016574; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016575; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016576; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016579; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016581; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016582; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016583; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016584; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016585; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016588; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016593; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016600; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016602; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016603; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016606; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016610; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016616; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016622; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016624; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016630; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016632; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016633; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016639; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0018485; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0023885; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015142; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015143; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015144; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015146; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015152; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015153; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015161; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015166; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015167; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015169; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015172; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015176; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015178; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015181; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015183; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015190; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015191; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015197; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015203; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015205; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015212; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015217; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015220; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015235; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015238; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015240; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015242; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015247; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015254; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015257; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015261; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015267; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015275; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015276; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015277; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015278; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015281; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015283; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015284; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015285; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015286; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015287; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015290; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015295; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015302; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015304; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015305; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015308; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015312; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015318; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015324; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015326; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015332; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015334; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015335; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0015340; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017147; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0022413; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015419; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015420; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015421; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015423; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015429; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015430; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015436; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015438; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015443; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015444; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015446; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015449; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015453; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015455; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015458; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015460; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015467; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015468; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015473; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015479; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015481; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015488; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015496; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015508; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015510; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015513; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015515; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015518; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015523; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015529; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015532; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015536; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015542; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015550; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015551; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015552; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015553; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015556; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015558; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015559; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015560; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015561; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015562; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015570; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015577; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015579; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015580; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015583; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015587; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015593; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015599; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015601; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015607; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015609; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015610; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015615; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0017421; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027125; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027165; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027178; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027189; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027198; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027269; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027315; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027372; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027451; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037330; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063982; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070968; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072235; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077985; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087366; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097709; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102827; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109642; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113587; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113588; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113589; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113605; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113805; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114337; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114415; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117438; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119429; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122266; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123301; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123519; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148330; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168099; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168302; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169032; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171597; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178855; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000185594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186129; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000186857; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187184; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000187836; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188797; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188873; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188894; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000188952; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000190348; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193720; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212573; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019721; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019736; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019740; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019769; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019806; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019808; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019827; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019836; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019869; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019877; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019884; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019899; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019910; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019918; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019940; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019953; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019991; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0019999; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020031; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020067; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020076; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020118; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020160; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020174; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020240; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020244; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020261; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020269; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020280; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020289; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020340; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020352; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020374; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020406; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020442; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020443; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020445; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020447; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020472; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020475; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020479; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020480; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020486; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020492; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020517; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020545; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020594; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020598; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020599; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020608; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020623; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020675; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020724; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020741; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020793; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020803; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0020838; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0028118; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0046529; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0019695; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019710; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019714; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019743; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019777; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019779; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019800; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019809; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019842; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019850; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019857; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019872; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019883; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019891; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019914; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019927; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019967; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0019975; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020006; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020042; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020051; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020093; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020135; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020149; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020217; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020238; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020246; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020256; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020265; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020316; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020329; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020351; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020383; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020419; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020420; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020422; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020424; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020448; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020451; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020455; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020456; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020462; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020468; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020493; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020520; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020570; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020573; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020574; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020582; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020597; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020649; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020698; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020715; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020767; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020777; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020789; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0020814; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0028088; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0046504; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0019656; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019670; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019674; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019703; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019740; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019742; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019762; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019773; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019806; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019814; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019821; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019836; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019847; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019855; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019877; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019890; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019931; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019939; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0019968; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020003; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020012; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020051; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020107; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020176; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020180; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020197; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020205; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020215; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020224; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020275; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020287; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020309; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020341; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020377; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020378; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020380; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020382; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020406; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020410; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020414; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020415; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020421; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020451; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020479; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020533; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020534; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020542; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020557; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020609; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020658; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020675; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020727; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020737; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020749; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0020774; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0028048; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0046452; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019648; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019663; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019667; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019696; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019733; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019735; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019794; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019802; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019810; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019825; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019836; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019844; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019866; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019879; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019918; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019926; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019956; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0019992; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020001; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020040; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020082; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020096; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020164; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020168; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020187; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020195; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020205; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020214; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020265; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020277; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020299; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020331; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020367; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020369; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020371; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020373; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020396; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020400; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020404; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020405; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020411; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020441; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020469; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020518; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020521; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020522; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020530; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020544; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020596; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020645; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020662; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020714; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020724; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020736; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0020761; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0028067; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0046465; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019475; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019489; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019493; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019522; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019558; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019560; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019579; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019587; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019620; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019628; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019636; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019651; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019662; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019670; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019692; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019705; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019746; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019754; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019784; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019819; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019829; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019870; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019912; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019926; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019994; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0019998; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020016; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020024; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020031; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020040; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020091; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020103; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020123; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020155; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020191; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020192; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020194; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020196; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020221; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020224; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020228; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020229; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020235; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020292; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020345; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020346; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020354; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020369; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020421; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020470; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020487; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020538; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020559; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0020583; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0027864; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0046198; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020147; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020162; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020166; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020195; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020232; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020234; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020254; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020263; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020296; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020304; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020312; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020327; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020338; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020346; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020368; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020381; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020419; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020427; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020457; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020493; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020502; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020545; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020588; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020602; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020670; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020674; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020694; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020702; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020710; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020719; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020771; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020783; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020805; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020837; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020875; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020876; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020878; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020880; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020904; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020908; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020912; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020913; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020919; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020925; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0020978; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021027; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021030; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021031; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021039; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021054; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021106; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021155; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021169; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021222; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021232; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021244; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021270; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0028562; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0046950; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0018986; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019000; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019004; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019033; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019069; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019071; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019098; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019133; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019147; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019162; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019182; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019208; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019221; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019260; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019268; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019284; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019295; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019336; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019378; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019421; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019435; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019504; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019508; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019525; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019533; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019541; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019550; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019601; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019613; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019634; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019666; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019704; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019705; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019708; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019710; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019734; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019737; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019741; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019742; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019748; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019805; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019855; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019859; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019860; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019868; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019884; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019936; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0019985; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0020002; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0020054; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0020064; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0020076; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0020102; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0027476; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0019430; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019444; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019448; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019477; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019514; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019516; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019536; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019544; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019577; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019585; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019593; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019608; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019619; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019627; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019649; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019663; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019702; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019710; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019740; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019776; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019785; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019827; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019870; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019884; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019952; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019956; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019973; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019981; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0019991; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020000; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020051; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020063; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020083; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020115; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020152; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020154; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020156; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020158; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020183; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020186; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020190; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020191; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020197; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020227; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020254; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020303; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020306; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020307; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020315; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020330; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020382; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020431; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020448; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020500; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020509; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020521; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0020546; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0027791; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0046132; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0019544; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019559; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019563; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019592; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019627; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019629; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019650; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019657; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019691; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019699; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019706; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019721; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019732; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019740; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019763; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019776; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019816; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019824; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019855; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019891; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019900; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019942; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019985; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0019999; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020067; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020071; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020088; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020096; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020104; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020113; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020163; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020175; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020195; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020227; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020264; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020265; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020267; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020269; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020294; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020298; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020302; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020303; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020309; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020339; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020366; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020416; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020419; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020420; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020428; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020443; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020493; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020542; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020559; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020611; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020621; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020633; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0020659; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0027920; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0046248; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0019550; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019565; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019569; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019598; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019635; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019637; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019658; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019666; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019698; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019706; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019713; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019728; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019740; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019748; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019771; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019784; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019823; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019831; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019862; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019896; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019905; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019945; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0019989; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020003; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020071; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020075; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020092; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020100; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020111; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020120; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020172; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020184; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020206; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020239; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020276; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020277; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020279; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020281; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020304; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020308; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020312; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020313; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020319; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020347; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020374; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020424; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020427; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020428; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020436; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020451; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020503; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020552; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020569; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020621; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020631; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020643; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0020669; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0027908; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0019632; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019646; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019650; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019679; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019714; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019716; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019740; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019773; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019781; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019788; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019803; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019814; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019822; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019844; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019857; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019896; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019904; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019935; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019971; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0019980; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020020; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020061; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020075; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020143; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020147; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020164; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020172; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020183; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020192; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020244; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020256; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020278; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020310; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020346; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020347; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020349; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020351; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020376; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020379; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020383; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020384; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020390; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020420; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020448; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020497; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020501; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020502; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020510; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020525; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020577; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020626; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020643; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020695; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020705; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020717; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0020742; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0028032; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019521; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019536; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019540; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019565; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019602; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019604; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019624; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019633; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019665; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019673; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019680; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019695; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019707; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019715; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019737; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019750; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019791; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019799; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019829; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019865; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019874; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019912; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0019969; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020039; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020043; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020059; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020067; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020076; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020085; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020135; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020148; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020170; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020205; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020241; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020242; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020244; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020246; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020270; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020273; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020277; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020278; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020284; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020290; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020315; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020342; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020391; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020394; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020395; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020403; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020418; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020470; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020520; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020537; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020589; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020599; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020611; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0020637; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0027890; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0046194; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020204; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020219; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020223; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020252; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020289; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020291; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020318; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020351; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020359; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020366; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020381; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020392; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020400; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020423; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020436; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020475; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020483; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020512; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020548; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020557; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020599; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020641; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020655; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020723; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020727; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020744; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020752; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020763; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020772; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020823; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020835; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020857; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020890; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020926; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020927; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020929; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020931; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020955; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020958; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020962; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020963; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020969; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0020975; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021000; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021027; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021077; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021081; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021082; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021090; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021105; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021157; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021206; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021223; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021275; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021285; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021297; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021321; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0028595; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0047047; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018741; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018754; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018758; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018787; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018824; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018826; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018850; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018885; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018893; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018898; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018913; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018924; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018933; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018960; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0018974; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019012; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019020; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019049; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019085; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019094; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019137; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019180; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019194; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019263; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019281; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019289; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019296; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019305; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019356; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019368; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019389; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019421; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019458; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019461; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019464; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019466; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019492; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019495; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019499; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019500; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019506; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019511; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019536; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019563; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019613; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019617; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019618; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019626; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019641; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019693; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019742; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019759; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019810; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019820; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019832; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0019857; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0027175; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0045890; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019071; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019085; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019089; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019117; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019154; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019156; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019174; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019183; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019216; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019224; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019230; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019245; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019256; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019264; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019286; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019300; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019338; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019346; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019373; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019409; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019418; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019457; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019512; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019582; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019586; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019603; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019611; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019621; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019630; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019681; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019693; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019713; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019745; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019782; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019783; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019785; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019787; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019811; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019814; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019818; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019819; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019825; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019831; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019883; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019933; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019936; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019937; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019945; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0019960; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020012; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020061; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020078; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020131; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020141; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020153; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020175; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0027374; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..26984737
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    845..5956
FT                   /estimated_length=5112
FT                   /gap_type="unknown"
FT   assembly_gap    11839..12523
FT                   /estimated_length=685
FT                   /gap_type="unknown"
FT   assembly_gap    14177..14196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(38264..196185)
FT                   /gene="Myo1b"
FT                   /locus_tag="mCG_123680"
FT                   /note="gene_id=mCG123680.1"
FT   mRNA            complement(join(38264..39801,44195..44322,45657..45809,
FT                   46428..46560,48852..48958,51057..51191,52454..52528,
FT                   55388..55474,57573..57659,59442..59510,61847..61996,
FT                   62923..63016,64819..65019,66938..67164,68180..68380,
FT                   70589..70651,73066..73170,82269..82334,82941..83027,
FT                   85701..85819,86090..86237,88231..88334,89883..89981,
FT                   101764..101827,108903..108949,112859..112963,
FT                   123222..123316,152085..152200,171863..172006,
FT                   195999..196185))
FT                   /gene="Myo1b"
FT                   /locus_tag="mCG_123680"
FT                   /product="myosin IB"
FT                   /note="gene_id=mCG123680.1 transcript_id=mCT124915.1
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(39678..39801,44195..44322,45657..45809,
FT                   46428..46560,48852..48958,51057..51191,52454..52528,
FT                   55388..55474,57573..57659,59442..59510,61847..61996,
FT                   62923..63016,64819..65019,66938..67164,68180..68380,
FT                   70589..70651,73066..73170,82269..82334,82941..83027,
FT                   85701..85819,86090..86237,88231..88334,89883..89981,
FT                   101764..101827,108903..108949,112859..112963,
FT                   123222..123316,152085..152200,171863..171997))
FT                   /codon_start=1
FT                   /gene="Myo1b"
FT                   /locus_tag="mCG_123680"
FT                   /product="myosin IB"
FT                   /note="gene_id=mCG123680.1 transcript_id=mCT124915.1
FT                   protein_id=mCP74517.1"
FT                   /db_xref="GOA:P46735"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:107752"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46735"
FT                   /protein_id="EDK99961.1"
FT                   /translation="MAKMEVKSSLLDNMIGVGDMVLLEPLNEETFIDNLKKRFDHNEIY
FT                   TYIGSVVISVNPYRSLPIYSPEKVEDYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCI
FT                   LITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNS
FT                   SRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLYK
FT                   LKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFLDHEAEAVLEVVAAVLKL
FT                   GNIEFKPESRVNGLDESKIKDKNELKEICELTSIDQVVLERAFSFRTVEAKQEKVSTTL
FT                   NVAQAYYARDALAKNLYSRLFSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSF
FT                   EQFIINYCNEKLQQIFIELTLKEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILA
FT                   MLDEECLRPGTVTDETFLEKLNQVCATHQHFESRMSKCSRFLNDTTLPHSCFRIQHYAG
FT                   KVLYQVEGFVDKNNDLLYRDLSQAMWKAGHSLIKSLFPEGNPAKVNLKRPPTAGSQFKA
FT                   SVATLMRNLQTKNPNYIRCIKPNDKKAAHIFNESLVCHQIRYLGLLENVRVRRAGYAFR
FT                   QAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEHSFGRSKIFIRNPRTLF
FT                   QLEDLRKQRLEDLATLIQKIYRGWKCRTHFLLMKRSQVVIAAWYRRYAQQKRYQQIKSS
FT                   ALVIQSYIRGWKARKILRELKHQKRCKEAATTIAAYWHGTQARRELKRLKEEARRKHAV
FT                   AVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYLLEMKNKMPSLSPIDKNWP
FT                   SRPYLFLDSTHKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSV
FT                   GQPFQGAYLEINKNPKYKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLA
FT                   DQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKL
FT                   YRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP
FT                   "
FT   assembly_gap    39858..39974
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    57689..57829
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    95833..95852
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    179035..179054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    186233..186351
FT                   /estimated_length=119
FT                   /gap_type="unknown"
FT   assembly_gap    197217..197236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(229450..230211)
FT                   /pseudo
FT                   /locus_tag="mCG_123679"
FT                   /note="gene_id=mCG123679.1"
FT   mRNA            complement(229450..230211)
FT                   /pseudo
FT                   /locus_tag="mCG_123679"
FT                   /note="gene_id=mCG123679.1 transcript_id=mCT124914.1
FT                   created on 11-JUL-2002"
FT   gene            <297138..396006
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /note="gene_id=mCG123678.1"
FT   mRNA            join(297138..297625,300278..300406,302296..302440,
FT                   354143..354241,357574..357666,360689..360767,
FT                   363505..363590,365361..365512,367322..367480,
FT                   368588..368680,371365..371424,371709..371726,
FT                   371825..371918,372930..372974,385605..385688,
FT                   387207..387305,389144..389279,390672..390721,
FT                   390937..391031,391301..391437,391668..391859,
FT                   394028..394094,394490..394598,395732..396006)
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /product="signal transducer and activator of transcription
FT                   4, transcript variant mCT124913"
FT                   /note="gene_id=mCG123678.1 transcript_id=mCT124913.1
FT                   created on 11-JUL-2002"
FT   mRNA            join(<297138..297625,300278..300406,302296..302440,
FT                   354143..354241,357574..357666,360689..360767,
FT                   363505..363590,365361..365512,367322..367480,
FT                   368588..368680,371365..371424,371811..371918,
FT                   372930..372974,385605..385688,387207..387305,
FT                   389144..389279,390672..390721,390937..391031,
FT                   391301..391437,391668..391859,394028..394094,
FT                   394490..394598,395732..396006)
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /product="signal transducer and activator of transcription
FT                   4, transcript variant mCT189247"
FT                   /note="gene_id=mCG123678.1 transcript_id=mCT189247.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<297564..297625,300278..300406,302296..302440,
FT                   354143..354241,357574..357666,360689..360767,
FT                   363505..363590,365361..365512,367322..367480,
FT                   368588..368680,371365..371424,371811..371918,
FT                   372930..372945)
FT                   /codon_start=1
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /product="signal transducer and activator of transcription
FT                   4, isoform CRA_b"
FT                   /note="gene_id=mCG123678.1 transcript_id=mCT189247.0
FT                   protein_id=mCP110267.0 isoform=CRA_b"
FT                   /protein_id="EDK99963.1"
FT                   /translation="RPILTLDLCSATTWTERERASMSQWNQVQQLEIKFLEQVDQFYDD
FT                   NFPMEIRHLLAQWIETQDWEVASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNL
FT                   KRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPIQGPLEKSLQSSSVSERQRN
FT                   VEHKVSAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQGDKNSILVNQEVLTLQEM
FT                   LNSLDFKRKEALSKMTQIVNETDLLMNSMLLEELQDWKKRQQIACIGGPLHNGLDQLQN
FT                   CFTLLAESLFQLRQQLEKLQEQSTKMTYEGDPIPAQRAHLLERATFLIYNLFKNSFVVE
FT                   RQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVKASIDKFFSLAIEDLCFVE
FT                   LTSKLCPVRNLPMGASQWSLDICNPRR"
FT   assembly_gap    299881..299900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(300279..300406,302296..302440,354143..354241,
FT                   357574..357666,360689..360767,363505..363590,
FT                   365361..365512,367322..367480,368588..368680,
FT                   371365..371424,371709..371726,371825..371918,
FT                   372930..372974,385605..385688,387207..387305,
FT                   389144..389279,390672..390721,390937..391031,
FT                   391301..391437,391668..391859,394028..394094,
FT                   394490..394598,395732..395758)
FT                   /codon_start=1
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /product="signal transducer and activator of transcription
FT                   4, isoform CRA_a"
FT                   /note="gene_id=mCG123678.1 transcript_id=mCT124913.1
FT                   protein_id=mCP74782.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V157"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001217"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR012345"
FT                   /db_xref="InterPro:IPR013799"
FT                   /db_xref="InterPro:IPR013800"
FT                   /db_xref="InterPro:IPR013801"
FT                   /db_xref="InterPro:IPR015988"
FT                   /db_xref="InterPro:IPR029839"
FT                   /db_xref="MGI:MGI:103062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V157"
FT                   /protein_id="EDK99962.1"
FT                   /translation="MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIETQDWEV
FT                   ASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVV
FT                   ISNCLREERRILAAANMPIQGPLEKSLQSSSVSERQRNVEHKVSAIKNSVQMTEQDTKY
FT                   LEDLQDEFDYRYKTIQTMDQGDKNSILVNQEVLTLQEMLNSLDFKRKEALSKMTQIVNE
FT                   TDLLMNSMLLEELQDWKKRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRQQLEKLQE
FT                   QSTKMTYEGDPIPAQRAHLLERATFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQF
FT                   TVKLRLLIKLPELNYQVKVKASIDKNVSTLSNRRFVLCGTHVKAMSSEESSNGSLSVEF
FT                   RHLQPKEMKCSTGSKGNEGCHMVTEELHSITFETQICLYGLTINLETSSLPVVMISNVS
FT                   QLPNAWASIIWYNVSTNDSQNLVFFNNPPSVTLGQLLEVMSWQFSSYVGRGLNSEQLNM
FT                   LAEKLTVQSNYNDGHLTWAKFCKEHLPGKTFTFWTWLEAILDLIKKHILPLWIDGYIMG
FT                   FVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDQSENGEVRFHSVEPYNKGRLSA
FT                   LPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYV
FT                   PSVFIPISTIRSDSTEPQSPSDLLPMSPSAYAVLRENLSPTTIETAMNSPYSAE"
FT   assembly_gap    330155..330528
FT                   /estimated_length=374
FT                   /gap_type="unknown"
FT   assembly_gap    335395..335749
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    345713..345732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    350706..350725
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    368194..368213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    374383..374402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            405397..449855
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /note="gene_id=mCG123683.2"
FT   mRNA            join(405397..405543,407799..407937,408311..408442,
FT                   408731..408854,411409..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436749..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443909,444831..444930,448131..449810)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT124917"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT124917.1
FT                   created on 11-JUL-2002"
FT   mRNA            join(<408255..408442,408731..408891,411410..411540,
FT                   411933..412077,415339..415437,421392..421481,
FT                   424451..424529,425727..425818,426127..426278,
FT                   428042..428200,429425..429517,431749..431808,
FT                   432934..432963,433052..433145,433998..434039,
FT                   436142..436225,436749..436847,437751..437886,
FT                   439467..439516,440086..440180,441081..441226,
FT                   442692..442877,443834..444121)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT189275"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189275.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<408275..408442,408731..408891,411410..411540,
FT                   411933..412077,415339..415437,421392..421481,
FT                   424451..424529,425727..425818,426127..426278,
FT                   428042..428200,429425..429517,431749..431808,
FT                   432934..432963,433052..433145,433998..434039,
FT                   436142..436225,436749..436847,437751..437886,
FT                   439467..439516,440086..440180,441081..441226,
FT                   442692..442877,443834..443909,444831..444930,
FT                   448131..449811)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT189273"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189273.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<408308..408427,408731..408891,411410..411540,
FT                   411933..412077,415339..415437,421392..421481,
FT                   424451..424529,425727..425818,426127..426278,
FT                   428042..428200,429425..429517,431749..431808,
FT                   432934..432963,433052..433145,433998..434039,
FT                   436142..436225,436749..436847,437751..437886,
FT                   439467..439516,440086..440180,441081..441226,
FT                   442692..442877,443834..443909,444831..444930,
FT                   448131..449855)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT189274"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189274.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<408441..408612,408731..408854,411410..411540,
FT                   411933..412077,415339..415437,421392..421481,
FT                   424451..424529,425727..425818,426127..426278,
FT                   428042..428200,429425..429517,431749..431808,
FT                   432934..432963,433052..433145,433998..434039,
FT                   436142..436225,436731..436847,437751..437886,
FT                   439467..439516,440086..440180,441081..441226,
FT                   442692..442877,443834..443909,444831..444930,
FT                   448131..449578)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT189276"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189276.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<408813..408854,411410..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436731..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443909,444831..444930,448131..448145)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189276.0
FT                   protein_id=mCP110271.0 isoform=CRA_c"
FT                   /protein_id="EDK99967.1"
FT                   /translation="LLVLNPEPAPGDSPRMSQWFELQQLDSKFLEQVHQLYDDSFPMEI
FT                   RQYLAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRN
FT                   LQDNFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRN
FT                   VKDQVMCIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLD
FT                   NKRKEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIV
FT                   AETLQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCM
FT                   PTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILG
FT                   THTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPG
FT                   LVIDLEVFVPFQTTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWS
FT                   QLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFW
FT                   PWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITF
FT                   TWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDK
FT                   DHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFD
FT                   EMSRIVGPEFDSMMSTV"
FT   CDS             join(<408859..408891,411410..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436749..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443909,444831..444930,448131..448145)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189273.0
FT                   protein_id=mCP110268.0 isoform=CRA_a"
FT                   /protein_id="EDK99964.1"
FT                   /translation="VYVGTEAFGISRMSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQY
FT                   LAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQD
FT                   NFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKD
FT                   QVMCIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKR
FT                   KEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAET
FT                   LQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTH
FT                   PQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHT
FT                   KVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVI
FT                   DLETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQ
FT                   FSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILEL
FT                   IKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNG
FT                   GEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYS
FT                   RPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEMSRIVGPE
FT                   FDSMMSTV"
FT   CDS             join(<408859..408891,411410..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436749..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443909,444831..444930,448131..448145)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189274.0
FT                   protein_id=mCP110269.0 isoform=CRA_a"
FT                   /protein_id="EDK99965.1"
FT                   /translation="VYVGTEAFGISRMSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQY
FT                   LAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQD
FT                   NFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKD
FT                   QVMCIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKR
FT                   KEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAET
FT                   LQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTH
FT                   PQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHT
FT                   KVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVI
FT                   DLETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQ
FT                   FSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILEL
FT                   IKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNG
FT                   GEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYS
FT                   RPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEMSRIVGPE
FT                   FDSMMSTV"
FT   CDS             join(<408859..408891,411410..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436749..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443913)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189275.0
FT                   protein_id=mCP110270.0 isoform=CRA_b"
FT                   /protein_id="EDK99966.1"
FT                   /translation="VYVGTEAFGISRMSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQY
FT                   LAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQD
FT                   NFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKD
FT                   QVMCIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKR
FT                   KEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAET
FT                   LQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTH
FT                   PQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHT
FT                   KVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVI
FT                   DLETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQ
FT                   FSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILEL
FT                   IKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNG
FT                   GEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYS
FT                   RPKEAPEPMELDDPKRTGYIKTELISVSEV"
FT   CDS             join(411413..411540,411933..412077,415339..415437,
FT                   421392..421481,424451..424529,425727..425818,
FT                   426127..426278,428042..428200,429425..429517,
FT                   431749..431808,432934..432963,433052..433145,
FT                   433998..434039,436142..436225,436749..436847,
FT                   437751..437886,439467..439516,440086..440180,
FT                   441081..441226,442692..442877,443834..443909,
FT                   444831..444930,448131..448145)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT124917.1
FT                   protein_id=mCP74557.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q8C3V4"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001217"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR012345"
FT                   /db_xref="InterPro:IPR013799"
FT                   /db_xref="InterPro:IPR013800"
FT                   /db_xref="InterPro:IPR013801"
FT                   /db_xref="InterPro:IPR015988"
FT                   /db_xref="InterPro:IPR022752"
FT                   /db_xref="MGI:MGI:103063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C3V4"
FT                   /protein_id="EDK99968.1"
FT                   /translation="MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEH
FT                   AAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMI
FT                   IYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEQEIKTL
FT                   EELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLN
FT                   SIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAETLQQIRQQLKKLE
FT                   ELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQ
FT                   FTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGS
FT                   LAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVI
FT                   SNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNAD
FT                   QLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDG
FT                   CIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYT
FT                   KKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELD
FT                   DPKRTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEMSRIVGPEFDSMMSTV"
FT   assembly_gap    416334..416727
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   gene            complement(452299..>521752)
FT                   /locus_tag="mCG_123685"
FT                   /note="gene_id=mCG123685.1"
FT   mRNA            complement(join(452299..455162,457184..457247,
FT                   457333..457409,457745..457806,477527..477619,
FT                   478271..478402,479959..480135,485013..485063,
FT                   485591..485657,488559..488617,488703..488735,
FT                   496149..496207,501051..501214,503326..503405,
FT                   504413..504542,508336..508457,508791..508887,
FT                   521440..>521752))
FT                   /locus_tag="mCG_123685"
FT                   /product="mCG123685"
FT                   /note="gene_id=mCG123685.1 transcript_id=mCT124919.1
FT                   created on 01-APR-2003"
FT   CDS             complement(join(455006..455162,457184..457247,
FT                   457333..457409,457745..457806,477527..477619,
FT                   478271..478402,479959..480135,485013..485063,
FT                   485591..485657,488559..488617,488703..488735,
FT                   496149..496207,501051..501214,503326..503405,
FT                   504413..504542,508336..508457,508791..508887,
FT                   521440..>521750))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123685"
FT                   /product="mCG123685"
FT                   /note="gene_id=mCG123685.1 transcript_id=mCT124919.1
FT                   protein_id=mCP74803.1"
FT                   /protein_id="EDK99969.1"
FT                   /translation="LGTLCRRPRGGSRPTAGLVAAARLHPWWGGGGRAKGPGAGGLSSS
FT                   PSEILQELGKGGTPPQQQQQQQQQPGASPPAAPGPKDSPGETDAFGNSEGKEMVAAGDN
FT                   KIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQT
FT                   TSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVA
FT                   DYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVH
FT                   RYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKM
FT                   AGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTC
FT                   ESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSG
FT                   VAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDP
FT                   RREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEV
FT                   VKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDDGKGNQT
FT                   VHKNLDGLL"
FT   assembly_gap    521753..521872
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    527269..527288
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    578514..578608
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    591495..591776
FT                   /estimated_length=282
FT                   /gap_type="unknown"
FT   assembly_gap    612611..612647
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   gene            620709..627051
FT                   /locus_tag="mCG_146942"
FT                   /note="gene_id=mCG146942.0"
FT   mRNA            join(620709..620771,623568..627051)
FT                   /locus_tag="mCG_146942"
FT                   /product="mCG146942"
FT                   /note="gene_id=mCG146942.0 transcript_id=mCT187205.0
FT                   created on 13-JAN-2004"
FT   CDS             626670..626951
FT                   /codon_start=1
FT                   /locus_tag="mCG_146942"
FT                   /product="mCG146942"
FT                   /note="gene_id=mCG146942.0 transcript_id=mCT187205.0
FT                   protein_id=mCP109541.0"
FT                   /protein_id="EDK99970.1"
FT                   /translation="MSGKGSLLDKPSWASRYLISMENSVLGLYDHRAVSFMLEAWLVFQ
FT                   VRSLAGSWKSSKPQVCAHQVSGSRPALPYQTSWHGFTSHMFPGRVFSF"
FT   assembly_gap    634282..634404
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    692679..695641
FT                   /estimated_length=2963
FT                   /gap_type="unknown"
FT   gene            complement(746118..789182)
FT                   /gene="Nab1"
FT                   /locus_tag="mCG_123682"
FT                   /note="gene_id=mCG123682.1"
FT   mRNA            complement(join(746118..748127,750909..751025,
FT                   753606..753768,755711..755800,768060..768111,
FT                   769693..769826,778743..779577,789032..789182))
FT                   /gene="Nab1"
FT                   /locus_tag="mCG_123682"
FT                   /product="Ngfi-A binding protein 1"
FT                   /note="gene_id=mCG123682.1 transcript_id=mCT124916.1
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(748039..748127,750909..751025,
FT                   753606..753768,755711..755800,768060..768111,
FT                   769693..769826,778743..779558))
FT                   /codon_start=1
FT                   /gene="Nab1"
FT                   /locus_tag="mCG_123682"
FT                   /product="Ngfi-A binding protein 1"
FT                   /note="gene_id=mCG123682.1 transcript_id=mCT124916.1
FT                   protein_id=mCP74549.1"
FT                   /db_xref="GOA:Q61122"
FT                   /db_xref="InterPro:IPR006986"
FT                   /db_xref="InterPro:IPR006988"
FT                   /db_xref="InterPro:IPR006989"
FT                   /db_xref="MGI:MGI:107564"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61122"
FT                   /protein_id="EDK99971.1"
FT                   /translation="MATALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAG
FT                   EEEFLEIMALVGMASKPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSP
FT                   TWLGISCNSYERSSSSREPHLKIPKCAATTCVQSLGQGKSEVGSLALQSVSDSRLWQGH
FT                   HATESEHSLSPADLGSPASPKESSEALDAAAALSVAECVERMAPTLPKSDLSEVKELLK
FT                   NNKKLAKMIGHIFEMSDEDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQ
FT                   LCVKDNALLTRRDELFALARQVSREVTYKYTYRTTRLKCGERDELSPKRIKIEDGFPDF
FT                   QESVPTLFQQARAKSEELAGLGSQQAEKGMAKQMELLCAQAGYERLQQERRLTAGLYRQ
FT                   SSGEQSPDGGLPSDSSDGQGERPLNLRIPSVQNRQPHHFVVDGELSRLYSSEAKSHSSE
FT                   SLGILKDYPHSAFTLEKKVIKTEPEDSR"
FT   assembly_gap    790033..790052
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    795076..795095
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    811321..811730
FT                   /estimated_length=410
FT                   /gap_type="unknown"
FT   gene            <813478..873826
FT                   /locus_tag="mCG_145851"
FT                   /note="gene_id=mCG145851.0"
FT   mRNA            join(<813478..813733,827726..827804,843581..843641,
FT                   861087..861158,873590..873826)
FT                   /locus_tag="mCG_145851"
FT                   /product="mCG145851"
FT                   /note="gene_id=mCG145851.0 transcript_id=mCT185959.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<813628..813733,827726..827804,843581..843641,
FT                   861087..861158,873590..873595)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145851"
FT                   /product="mCG145851"
FT                   /note="gene_id=mCG145851.0 transcript_id=mCT185959.0
FT                   protein_id=mCP107691.0"
FT                   /protein_id="EDK99972.1"
FT                   /translation="VARNALQVREMEQITYRVSLQKLGAEQEKPESTRSGPGGKCGSSS
FT                   DVHWWWSQESESPQSMWPTSCLLELCPDHVHDSHLLQVHKRVSYGKSTEVKVLGVSQAQ
FT                   QQS"
FT   assembly_gap    840716..840735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(861054..>871335)
FT                   /locus_tag="mCG_144896"
FT                   /note="gene_id=mCG144896.0"
FT   mRNA            complement(join(861054..863528,866175..866302,
FT                   867414..867506,867614..867704,869818..869943,
FT                   871302..>871335))
FT                   /locus_tag="mCG_144896"
FT                   /product="mCG144896"
FT                   /note="gene_id=mCG144896.0 transcript_id=mCT184320.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(861368..>861637)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144896"
FT                   /product="mCG144896"
FT                   /note="gene_id=mCG144896.0 transcript_id=mCT184320.0
FT                   protein_id=mCP106125.0"
FT                   /protein_id="EDK99973.1"
FT                   /translation="YNTLEKGYFICLGVLLLGCLVLEVQRWALQLPRLLLYTVVTHQVV
FT                   AGNQTQVLWKSIQCSKPQNSLSGKIIIIIIIIIIIIIIILSWLW"
FT   assembly_gap    872181..872265
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            875595..876812
FT                   /pseudo
FT                   /locus_tag="mCG_115456"
FT                   /note="gene_id=mCG115456.1"
FT   mRNA            875595..876812
FT                   /pseudo
FT                   /locus_tag="mCG_115456"
FT                   /note="gene_id=mCG115456.1 transcript_id=mCT116562.0
FT                   created on 11-JUL-2002"
FT   gene            <921884..943067
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /note="gene_id=mCG115466.2"
FT   mRNA            join(<921884..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,936409..936634,
FT                   939898..940074,940854..943067)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT189270"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT189270.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<921885..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,936409..936507)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_d"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT189270.0
FT                   protein_id=mCP110245.0 isoform=CRA_d"
FT                   /protein_id="EDK99977.1"
FT                   /translation="TSAALAAMLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSL
FT                   KETDLIKTSVSDCYCYNQHSQIQWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESIL
FT                   SFIKCVTHNFWAPEEAEEITIVFSPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLV
FT                   FVTGIFLFLYAKTLSQSPVFYYSSGTVLGILMTLVFVLLMAKKHIPKAMWWLLDFVALL
FT                   PVTVTGLLLMRGAETFSCGP"
FT   mRNA            join(921891..921999,928513..928628,936409..936634,
FT                   939898..940074,940854..941081)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT173366"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT173366.0
FT                   created on 20-SEP-2002"
FT   mRNA            join(<921894..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934316..934384,
FT                   936409..936634,939898..940074,940854..941784)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT189269"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT189269.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<921894..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934316..934336)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_c"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT189269.0
FT                   protein_id=mCP110244.0 isoform=CRA_c"
FT                   /protein_id="EDK99976.1"
FT                   /translation="ALAAMLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSLKET
FT                   DLIKTSVSDCYCYNQHSQIQWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESILSFI
FT                   KCVTHNFWAPEEAEEITIVFSPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLVFVT
FT                   GIFLFLYAKTLSQSPVFYYSSGTVLGILMTLVFVLLMAKKHIPKFMFCAS"
FT   mRNA            join(921898..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934270..934384,
FT                   936409..936634,939898..940074,940854..943067)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT116573"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT116573.1
FT                   created on 20-SEP-2002"
FT   mRNA            join(921898..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934316..934384,
FT                   936409..936634,939898..940074,940854..941189,
FT                   942948..943066)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT173365"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT173365.0
FT                   created on 20-SEP-2002"
FT   CDS             join(921906..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934270..934384,
FT                   936409..936634,939898..940074,940854..940992)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_a"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT116573.1
FT                   protein_id=mCP74831.1 isoform=CRA_a"
FT                   /protein_id="EDK99974.1"
FT                   /translation="MLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSLKETDLIK
FT                   TSVSDCYCYNQHSQIQWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESILSFIKCVT
FT                   HNFWAPEEAEEITIVFSPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLVFVTGIFL
FT                   FLYAKTLSQSPVFYYSSGTVLGILMTLVFVLLMAKKHIPKYSTFGALMIGCWFASVYVL
FT                   CQLMEDLKWLWYGNRMYILGYVVVVGLCSFAACYSHGPLADEGSRDLLMWTLRLFSLAL
FT                   VYTGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYLRWKMRPWFTAEPQVARYLTDDEYRE
FT                   QAEAATARALEELRQACCRPDFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQY
FT                   GLGGAFLEEQLFSLQTDSLPAS"
FT   CDS             join(934336..934384,936409..936634,939898..940074,
FT                   940854..940992)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_b"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT173365.0
FT                   protein_id=mCP96284.0 isoform=CRA_b"
FT                   /protein_id="EDK99975.1"
FT                   /translation="MEDLKWLWYGNRMYILGYVVVVGLCSFAACYSHGPLADEGSRDLL
FT                   MWTLRLFSLALVYTGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYLRWKMRPWFTAEPQV
FT                   ARYLTDDEYREQAEAATARALEELRQACCRPDFPSWLAVSRLQAPKKFAEFVLGASHLS
FT                   PEEVSTHEKQYGLGGAFLEEQLFSLQTDSLPAS"
FT   CDS             join(936495..936634,939898..940074,940854..940992)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_e"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT173366.0
FT                   protein_id=mCP96285.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q8BSW9"
FT                   /db_xref="InterPro:IPR019358"
FT                   /db_xref="MGI:MGI:2444113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BSW9"
FT                   /protein_id="EDK99978.1"
FT                   /translation="MWTLRLFSLALVYTGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYL
FT                   RWKMRPWFTAEPQVARYLTDDEYREQAEAATARALEELRQACCRPDFPSWLAVSRLQAP
FT                   KKFAEFVLGASHLSPEEVSTHEKQYGLGGAFLEEQLFSLQTDSLPAS"
FT   gene            complement(947456..>1018861)
FT                   /gene="2210010L05Rik"
FT                   /locus_tag="mCG_115461"
FT                   /note="gene_id=mCG115461.1"
FT   mRNA            complement(join(947456..949695,951957..952237,
FT                   953540..953638,954466..954627,967800..967897,
FT                   999519..1001110,1018378..1018559,1018632..>1018861))
FT                   /gene="2210010L05Rik"
FT                   /locus_tag="mCG_115461"
FT                   /product="RIKEN cDNA 2210010L05"
FT                   /note="gene_id=mCG115461.1 transcript_id=mCT116567.1
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(949492..949695,951957..952237,
FT                   953540..953638,954466..954627,967800..967897,
FT                   999519..>1001062))
FT                   /codon_start=1
FT                   /gene="2210010L05Rik"
FT                   /locus_tag="mCG_115461"
FT                   /product="RIKEN cDNA 2210010L05"
FT                   /note="gene_id=mCG115461.1 transcript_id=mCT116567.1
FT                   protein_id=mCP74624.1"
FT                   /protein_id="EDK99979.1"
FT                   /translation="AMAADDKVAILTDDEEEQKRKYVLADPFNGICREPEPPSNETPSS
FT                   TETSAIPEEEIDWIEKHCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQ
FT                   SGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFSLLCWVLFNLGIGFVKPATLRCLP
FT                   KIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTAL
FT                   TLTSEPTRRPQTEAITHPVTGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTL
FT                   VYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWG
FT                   LAMLSVGIGIDYTHIDVLIDGKGCKPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNH
FT                   FNNSDGKGKEVEIPQVERDNSTESSEETPTAATHSQAFNFWDLIKLLCSVQYGSVLFVA
FT                   WFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVL
FT                   YIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQG
FT                   ILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWLAVPDEEED
FT                   KTMLAERIPVPSSPVPIATIDLVQQQTEDVMPRVEARLPPKKTKHQEEQEDVNKPAWGV
FT                   SSSPWVTFVYALYQVKELIQLTRESRASEIQPLQGTSENREASPAGGAQRAPRETHSAS
FT                   PRNQPSPDTAASQTQSSPAHPSATPHGQESGEKQAQPTVGEH"
FT   assembly_gap    954209..954228
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    958986..959515
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    976505..976558
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    1018560..1018631
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    1029089..1029236
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    1030638..1030713
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   assembly_gap    1043792..1044034
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    1046382..1047128
FT                   /estimated_length=747
FT                   /gap_type="unknown"
FT   assembly_gap    1048591..1048610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1056348..1056367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1062540..1063224
FT                   /estimated_length=685
FT                   /gap_type="unknown"
FT   gene            complement(1079658..1108889)
FT                   /gene="Inpp1"
FT                   /locus_tag="mCG_115454"
FT                   /note="gene_id=mCG115454.1"
FT   mRNA            complement(join(1079658..1081409,1082880..1083054,
FT                   1085662..1085862,1088233..1088293,1090477..1090728,
FT                   1108602..1108889))
FT                   /gene="Inpp1"
FT                   /locus_tag="mCG_115454"
FT                   /product="inositol polyphosphate-1-phosphatase"
FT                   /note="gene_id=mCG115454.1 transcript_id=mCT116561.1
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(1080860..1081409,1082880..1083054,
FT                   1085662..1085862,1088233..1088293,1090477..1090680))
FT                   /codon_start=1
FT                   /gene="Inpp1"
FT                   /locus_tag="mCG_115454"
FT                   /product="inositol polyphosphate-1-phosphatase"
FT                   /note="gene_id=mCG115454.1 transcript_id=mCT116561.1
FT                   protein_id=mCP74580.1"
FT                   /protein_id="EDK99980.1"
FT                   /translation="MSDILLELLCVSEKAANIARACRQQETLFQLLIEEKKGAEKNKKF
FT                   AADFKTLADVLVQEVIKQNMENKFPGLGKKVFGEESNEFTNDLGEKITVELQSTEEETA
FT                   ELLSKVLNGNMPASEALAQVVHEDVDLTDPTLESLDISIPHESLGIWVDPIDSTYQYIK
FT                   GSANVKSNQGIFPSGLQCVTILIGVYDLQTGLPLMGVINQPFASQNLTTLRWKGQCYWG
FT                   LSYMGTNIHSLQLAISKSDSETQTENSDREFSSPFSAVISTSEKDTIKAALSRVCGGSV
FT                   FPAAGAGYKSLCVIQGLADIYIFSEDTTYKWDSCAAHAILRAMGGGIVDMKECLERSPD
FT                   TGLDLPQLLYHVENKGASGVELWANKGGLIAYRSRNRLDTFLSRLIQNLGPVKTQA"
FT   assembly_gap    1093765..1093784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1128921..1128940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1135049..1135183
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   gene            <1136382..1211952
FT                   /gene="Hibch"
FT                   /locus_tag="mCG_115463"
FT                   /note="gene_id=mCG115463.1"
FT   mRNA            join(<1136382..1136481,1145009..1145051,1151369..1151506,
FT                   1153609..1153693,1156890..1156970,1160247..1160299,
FT                   1176440..1176518,1192191..1192336,1193850..1193936,
FT                   1195647..1195705,1196376..1196457,1204736..1204855,
FT                   1207642..1207675,1211268..1211952)
FT                   /gene="Hibch"
FT                   /locus_tag="mCG_115463"
FT                   /product="3-hydroxyisobutyryl-Coenzyme A hydrolase"
FT                   /note="gene_id=mCG115463.1 transcript_id=mCT116569.1
FT                   created on 04-SEP-2002"
FT   CDS             join(<1136444..1136481,1145009..1145051,1151369..1151506,
FT                   1153609..1153693,1156890..1156970,1160247..1160299,
FT                   1176440..1176518,1192191..1192336,1193850..1193936,
FT                   1195647..1195705,1196376..1196457,1204736..1204855,
FT                   1207642..1207675,1211268..1211383)
FT                   /codon_start=1
FT                   /gene="Hibch"
FT                   /locus_tag="mCG_115463"
FT                   /product="3-hydroxyisobutyryl-Coenzyme A hydrolase"
FT                   /note="gene_id=mCG115463.1 transcript_id=mCT116569.1
FT                   protein_id=mCP74634.1"
FT                   /protein_id="EDK99981.1"
FT                   /translation="AMGQPYAWRLLSRVSSFRRASVILQHLRMSMHTEAAEVLLERRGC
FT                   GGVITLNRPKFLNALSLNMIRQIYPQLKTWEQDPDTFLIIIKGAGGKAFCAGGDIKALS
FT                   EAKKARQNLTQDLFREEYILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERS
FT                   LFAMPETGIGLFPDVGGGYFLPRLQGKLGYFLALTGYRLKGRDVHRAGIATHFVDSEKL
FT                   RVLEEELLALKSPSAEDVAGVLESYHAKSKMDQDKSIIFEEHMDKINSCFSANTVEQII
FT                   ENLRQDGSPFAIEQMKVINKMSPTSLKITLRQLMEGSSKTLQEVLIMEYRITQACMEGH
FT                   DFHEGVRAVLIDKDQTPKWKPANLKDVTDEDLNSYFKSLGSSDLKF"
FT   assembly_gap    1181040..1183895
FT                   /estimated_length=2856
FT                   /gap_type="unknown"
FT   assembly_gap    1214502..1215099
FT                   /estimated_length=598
FT                   /gap_type="unknown"
FT   gene            complement(1215694..1253449)
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /note="gene_id=mCG115472.1"
FT   mRNA            complement(join(1215694..1216522,1253241..1253449))
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, transcript variant
FT                   mCT116579"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT116579.1
FT                   created on 04-SEP-2002"
FT   mRNA            complement(join(1215695..1216522,1242803..1242991))
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, transcript variant
FT                   mCT172696"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT172696.0
FT                   created on 04-SEP-2002"
FT   mRNA            complement(join(1215695..1216522,1238147..1238165))
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, transcript variant
FT                   mCT172697"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT172697.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(1216035..1216355)
FT                   /codon_start=1
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, isoform CRA_a"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT172697.0
FT                   protein_id=mCP95616.0 isoform=CRA_a"
FT                   /protein_id="EDK99982.1"
FT                   /translation="MGCMKSKETFPFPTTLDIDKLHESEEAFIPDDSSQYRTPSPGEQQ
FT                   QVQEVKKLPEPGAVIGALILEFADRLASEIVEDALQQWACENIQYYNIPYIESEGSDTT
FT                   IN"
FT   CDS             complement(1216035..1216355)
FT                   /codon_start=1
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, isoform CRA_a"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT116579.1
FT                   protein_id=mCP74781.1 isoform=CRA_a"
FT                   /protein_id="EDK99983.1"
FT                   /translation="MGCMKSKETFPFPTTLDIDKLHESEEAFIPDDSSQYRTPSPGEQQ
FT                   QVQEVKKLPEPGAVIGALILEFADRLASEIVEDALQQWACENIQYYNIPYIESEGSDTT
FT                   IN"
FT   CDS             complement(1216035..1216355)
FT                   /codon_start=1
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, isoform CRA_a"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT172696.0
FT                   protein_id=mCP95615.0 isoform=CRA_a"
FT                   /protein_id="EDK99984.1"
FT                   /translation="MGCMKSKETFPFPTTLDIDKLHESEEAFIPDDSSQYRTPSPGEQQ
FT                   QVQEVKKLPEPGAVIGALILEFADRLASEIVEDALQQWACENIQYYNIPYIESEGSDTT
FT                   IN"
FT   assembly_gap    1233415..1233434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1240691..1240710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1246461..1246480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1254534..1254606
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    1271358..1271588
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    1293833..1293949
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    1322068..1322087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1347415..1347434
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1351889..1358305
FT                   /gene="Gdf8"
FT                   /locus_tag="mCG_115453"
FT                   /note="gene_id=mCG115453.1"
FT   mRNA            join(1351889..1352367,1354109..1354482,1356477..1358305)
FT                   /gene="Gdf8"
FT                   /locus_tag="mCG_115453"
FT                   /product="growth differentiation factor 8"
FT                   /note="gene_id=mCG115453.1 transcript_id=mCT116559.0
FT                   created on 11-JUL-2002"
FT   CDS             join(1351992..1352367,1354109..1354482,1356477..1356857)
FT                   /codon_start=1
FT                   /gene="Gdf8"
FT                   /locus_tag="mCG_115453"
FT                   /product="growth differentiation factor 8"
FT                   /note="gene_id=mCG115453.1 transcript_id=mCT116559.0
FT                   protein_id=mCP74577.1"
FT                   /db_xref="GOA:Q540E2"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR015616"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="InterPro:IPR029034"
FT                   /db_xref="MGI:MGI:95691"
FT                   /db_xref="UniProtKB/TrEMBL:Q540E2"
FT                   /protein_id="EDK99985.1"
FT                   /translation="MMQKLQMYVYIYLFMLIAAGPVDLNEGSEREENVEKEGLCNACAW
FT                   RQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSD
FT                   GSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRP
FT                   VKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPES
FT                   NLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESR
FT                   CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPC
FT                   CTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS"
FT   assembly_gap    1361134..1361153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1369397..1369416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1373855..1373874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1384352..1384371
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1415982..1416200
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    1420720..1423557
FT                   /estimated_length=2838
FT                   /gap_type="unknown"
FT   assembly_gap    1443920..1444052
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    1445320..1445353
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   gene            complement(1448085..1477292)
FT                   /locus_tag="mCG_115476"
FT                   /note="gene_id=mCG115476.1"
FT   mRNA            complement(join(1448085..1448297,1452735..1452754,
FT                   1459641..1459663,1459791..1459861,1467173..1467230,
FT                   1471518..1471570,1472170..1472219,1474890..1474965,
FT                   1477229..1477292))
FT                   /locus_tag="mCG_115476"
FT                   /product="mCG115476"
FT                   /note="gene_id=mCG115476.1 transcript_id=mCT116583.1
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(1448256..1448297,1452735..1452754,
FT                   1459641..1459663,1459791..1459861,1467173..1467230,
FT                   1471518..1471570,1472170..1472219,1474890..1474965,
FT                   1477229..1477276))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115476"
FT                   /product="mCG115476"
FT                   /note="gene_id=mCG115476.1 transcript_id=mCT116583.1
FT                   protein_id=mCP74793.1"
FT                   /db_xref="GOA:Q9DA74"
FT                   /db_xref="MGI:MGI:1916647"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DA74"
FT                   /protein_id="EDK99986.1"
FT                   /translation="MAGAGSNGETLATRMEIIEMNDKLRNRQEIVNGLNIFLEENEEEA
FT                   YLEELEEESDMFEEEETEALNEDGSKEAHNNVRTSHKVSLRSIASMTDEERFNMRIKKF
FT                   GITSKEFRKSPVASCFGLPLSTGKENADMEKKRRRLERFGLS"
FT   assembly_gap    1456548..1456589
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    1468288..1470107
FT                   /estimated_length=1820
FT                   /gap_type="unknown"
FT   gene            complement(1478316..>1586778)
FT                   /gene="Pms1"
FT                   /locus_tag="mCG_115459"
FT                   /note="gene_id=mCG115459.1"
FT   mRNA            complement(join(1478316..1479171,1481773..1481933,
FT                   1484601..1484731,1486496..1486975,1496235..1497085,
FT                   1497249..1497392,1497636..1497758,1505904..1506020,
FT                   1546378..1546541,1557588..1557690,1564852..1565034,
FT                   1571724..1571875,1586668..>1586778))
FT                   /gene="Pms1"
FT                   /locus_tag="mCG_115459"
FT                   /product="postmeiotic segregation increased 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG115459.1 transcript_id=mCT116566.1
FT                   created on 20-SEP-2002"
FT   CDS             complement(join(1479007..1479171,1481773..1481933,
FT                   1484601..1484731,1486496..1486975,1496235..1497085,
FT                   1497249..1497392,1497636..1497758,1505904..1506020,
FT                   1546378..1546541,1557588..1557690,1564852..1565034,
FT                   1571724..>1571873))
FT                   /codon_start=1
FT                   /gene="Pms1"
FT                   /locus_tag="mCG_115459"
FT                   /product="postmeiotic segregation increased 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG115459.1 transcript_id=mCT116566.1
FT                   protein_id=mCP74619.0"
FT                   /protein_id="EDK99987.1"
FT                   /translation="TQVQARMKQLPAATVRLLSSSQTITSVVSVVKELIENSLDAGATS
FT                   IEVKLENYGFDKIEIRDNGEGIKAVDVPVMAVKYYTSKISSHEDLGNLTTYGFRGEALG
FT                   SICNVAEVVVTTRTSADDFSTQYVLDGSGHILSQKPSHLGQGTTVTALKLFKNLPVRKQ
FT                   FYSTAKKCKDELKNVQDLLISYGVLKPDVRITFVHNKAVIWQKSRVPDHRMALMSVLGT
FT                   AVMGNMESVEQHCEQSQIYLSGFFPKHDADHNSTSLSTPERSFIFINSRPVHQKDILKL
FT                   IRRYYNLKCLKESTRLYPIFFLKIDVPSAEVDINLTPDKSQVLLQNKESVLIALENLMM
FT                   TCYGPLPTTESSENNRVDISSANMVVSQTAETDVLFNKMESFGNNYPNADTSAIHFQKD
FT                   ESRKNIDHHLNEQINIGNYFDGHFSGDINKDTFQNIPMNNLSSETNQSNHSETHSVGSM
FT                   EHIQGENGRNGTGGSGGDGRETLPEKALEICADDWSKGNLCNSMGENIEPVKILVPQKS
FT                   LSCKVTSSHPRLEPETLSDGPCSRTSDVIHNRSGRLTAYDLISSRAVKKPMSASALFIQ
FT                   DHRTQFLTENPKTGLEDATEQIKARWETLSEEEKHKYEEKAKKDLERYNNQMKKAIEQE
FT                   TQVSLKDGRKKRATSSWGWTQKHKVKDSSNQPKLDELFQSQNEKKKSENIKITEIPFSM
FT                   ENLKANLKKQKEVDLEEKDEIYLIHSLKFPDSWLVTSRADVMLLNPYRVEEALLFKRLL
FT                   ENHKLLAEPLEKPIILTESLLNGSHYLEVLYKMSTVEERGSGSAYLCDPRLTANGFKIR
FT                   LTPGVSSTENYLEIEGMAQCLPFYGIMDLKEILNAIVNKNAKEIYECRPRKVINYLEGE
FT                   AVRLSRQLPMYLPREDVQDLIYRMKHQFGKEIKGCVHGRPFFHHLTHLPGTS"
FT   gene            <1485785..>1487366
FT                   /locus_tag="mCG_145849"
FT                   /note="gene_id=mCG145849.0"
FT   mRNA            join(<1485785..1485906,1486525..1486662,1487093..>1487366)
FT                   /locus_tag="mCG_145849"
FT                   /product="mCG145849"
FT                   /note="gene_id=mCG145849.0 transcript_id=mCT185957.0
FT                   created on 03-JUL-2003"
FT   CDS             <1487113..>1487366
FT                   /codon_start=1
FT                   /locus_tag="mCG_145849"
FT                   /product="mCG145849"
FT                   /note="gene_id=mCG145849.0 transcript_id=mCT185957.0
FT                   protein_id=mCP107689.0"
FT                   /protein_id="EDK99988.1"
FT                   /translation="DKLQTEHRNRPLKSSQKQMRKDCTCIHEARPSISRWELQESARRW
FT                   KALITLYHQNTDPCFQNNLKSRENPMCESSRENIKTLMN"
FT   assembly_gap    1511256..1511387
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    1550800..1550850
FT                   /estimated_length=51
FT                   /gap_type="unknown"
FT   gene            1586891..1600078
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /note="gene_id=mCG146958.1"
FT   mRNA            join(1586891..1586970,1588754..1588934,1595224..1595375,
FT                   1598596..1600078)
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /product="ORM1-like 1 (S. cerevisiae), transcript variant
FT                   mCT189319"
FT                   /note="gene_id=mCG146958.1 transcript_id=mCT189319.1
FT                   created on 29-SEP-2004"
FT   mRNA            join(1586891..1586970,1588754..1591737)
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /product="ORM1-like 1 (S. cerevisiae), transcript variant
FT                   mCT187221"
FT                   /note="gene_id=mCG146958.1 transcript_id=mCT187221.1
FT                   created on 29-SEP-2004"
FT   CDS             join(1588761..1588934,1595224..1595375,1598596..1598731)
FT                   /codon_start=1
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /product="ORM1-like 1 (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG146958.1 transcript_id=mCT189319.1
FT                   protein_id=mCP110308.1 isoform=CRA_a"
FT                   /protein_id="EDK99989.1"
FT                   /translation="MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSV
FT                   PVAWTLTNIIHNLGMYVFLHAVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTI
FT                   SPIILYFLASFYTKYDPTHFILNTASLLSVLIPKMPQLHGVRIFGINKY"
FT   CDS             1588761..1588973
FT                   /codon_start=1
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /product="ORM1-like 1 (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG146958.1 transcript_id=mCT187221.1
FT                   protein_id=mCP109557.1 isoform=CRA_b"
FT                   /protein_id="EDK99990.1"
FT                   /translation="MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSV
FT                   PVAWTLTNIIHNLVRTPSSFQYGEL"
FT   assembly_gap    1592654..1592673
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1603404..1616109
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /note="gene_id=mCG115464.1"
FT   mRNA            join(1603404..1603627,1604625..1604868,1607671..1608058,
FT                   1609712..1610065,1610849..1610979,1611265..1611336,
FT                   1612936..1613039,1615773..1616109)
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1,
FT                   transcript variant mCT116571"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT116571.1
FT                   created on 04-SEP-2002"
FT   mRNA            join(<1603423..1603627,1604625..1604868,1607676..1608058,
FT                   1609712..1610065,1610849..1610979,1612936..1613039,
FT                   1615773..1615919)
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1,
FT                   transcript variant mCT189268"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT189268.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<1603430..1603627,1604625..1604868,1607671..1608058,
FT                   1609712..1610065,1610849..1610979,1611265..1611336,
FT                   1612936..1613833)
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1,
FT                   transcript variant mCT189267"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT189267.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1603603..1603627,1604625..1604868,1607671..1608058,
FT                   1609712..1610065,1610849..1610979,1611265..1611336,
FT                   1612936..1613014)
FT                   /codon_start=1
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT189267.0
FT                   protein_id=mCP110242.0 isoform=CRA_b"
FT                   /protein_id="EDK99992.1"
FT                   /translation="FTLSPVTAGSICRVTNMLMLRRTAGAIPKPPKSKVYGFLRRFSVH
FT                   PRTLSCHKLVLGIETSCDDTGAAVVDETGNVLGEALHSQTQVHLKTGGIVPPVAQQLHR
FT                   ENIQRIVEETLSACRITPSDLSAIATTIKPGLALSLGVGLSFSLQLVNQFKKPFIPIHH
FT                   MEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVAR
FT                   RLSLIKHPECSTMSGGKAIEQLAKDGNRFHFTINPPMQNAKNCDFSFTGLQHITDKLIT
FT                   HKEKEEGIEKGQILSSAADIAAAVQHATACHLAKRTHRAILFCKQKNLLSPANAVLVVS
FT                   GGVASNLYIRKALEIVANATQCTLLCPPPRLCTDNGIMIAWNGIERLRAGLGVLHDVED
FT                   IRYEPKCPLGVDISREVAEAAIKVPRLKMAL"
FT   CDS             join(1604648..1604868,1607671..1608058,1609712..1610065,
FT                   1610849..1610979,1611265..1611336,1612936..1613014)
FT                   /codon_start=1
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT116571.1
FT                   protein_id=mCP74819.1 isoform=CRA_a"
FT                   /protein_id="EDK99991.1"
FT                   /translation="MLMLRRTAGAIPKPPKSKVYGFLRRFSVHPRTLSCHKLVLGIETS
FT                   CDDTGAAVVDETGNVLGEALHSQTQVHLKTGGIVPPVAQQLHRENIQRIVEETLSACRI
FT                   TPSDLSAIATTIKPGLALSLGVGLSFSLQLVNQFKKPFIPIHHMEAHALTIRLTNKVEF
FT                   PFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGG
FT                   KAIEQLAKDGNRFHFTINPPMQNAKNCDFSFTGLQHITDKLITHKEKEEGIEKGQILSS
FT                   AADIAAAVQHATACHLAKRTHRAILFCKQKNLLSPANAVLVVSGGVASNLYIRKALEIV
FT                   ANATQCTLLCPPPRLCTDNGIMIAWNGIERLRAGLGVLHDVEDIRYEPKCPLGVDISRE
FT                   VAEAAIKVPRLKMAL"
FT   CDS             join(<1604868..1604868,1607676..1608058,1609712..1610065,
FT                   1610849..1610979,1612936)
FT                   /codon_start=1
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT189268.0
FT                   protein_id=mCP110243.0 isoform=CRA_c"
FT                   /protein_id="EDK99993.1"
FT                   /translation="SGIVPPVAQQLHRENIQRIVEETLSACRITPSDLSAIATTIKPGL
FT                   ALSLGVGLSFSLQLVNQFKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLAL
FT                   VQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEQLAKDGNRFHFT
FT                   INPPMQNAKNCDFSFTGLQHITDKLITHKEKEEGIEKGQILSSAADIAAAVQHATACHL
FT                   AKRTHRAILFCKQKNLLSPANAVLVVSGGVASNLYIRKALEIVANATQCTLLCPPPRLC
FT                   TDNGIMIA"
FT   gene            complement(1616001..1632794)
FT                   /locus_tag="mCG_115474"
FT                   /note="gene_id=mCG115474.1"
FT   mRNA            complement(join(1616001..1616226,1619981..1620177,
FT                   1632577..1632794))
FT                   /locus_tag="mCG_115474"
FT                   /product="mCG115474"
FT                   /note="gene_id=mCG115474.1 transcript_id=mCT116581.1
FT                   created on 20-SEP-2002"
FT   CDS             complement(join(1620104..1620177,1632577..1632685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115474"
FT                   /product="mCG115474"
FT                   /note="gene_id=mCG115474.1 transcript_id=mCT116581.1
FT                   protein_id=mCP74789.1"
FT                   /protein_id="EDK99994.1"
FT                   /translation="MHIPGLRRNLHDGGPRTALTGSGVSQEFEPTLALSTGSHSMFLCP
FT                   LLPHLQCTCFPTSVN"
FT   assembly_gap    1629333..1629352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1635220..1643174)
FT                   /locus_tag="mCG_115470"
FT                   /note="gene_id=mCG115470.1"
FT   mRNA            complement(join(1635220..1635583,1637184..1637365,
FT                   1639050..1639162,1640591..1640666,1641484..1641537,
FT                   1643134..1643174))
FT                   /locus_tag="mCG_115470"
FT                   /product="mCG115470, transcript variant mCT171052"
FT                   /note="gene_id=mCG115470.1 transcript_id=mCT171052.0
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(1635220..1635583,1637184..1637365,
FT                   1637619..1639162,1640591..1640666,1641484..1641537,
FT                   1643134..1643174))
FT                   /locus_tag="mCG_115470"
FT                   /product="mCG115470, transcript variant mCT116577"
FT                   /note="gene_id=mCG115470.1 transcript_id=mCT116577.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(1635334..1635583,1637184..1637365,
FT                   1639050..1639070))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115470"
FT                   /product="mCG115470, isoform CRA_b"
FT                   /note="gene_id=mCG115470.1 transcript_id=mCT171052.0
FT                   protein_id=mCP93970.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TGY6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="MGI:MGI:1917646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TGY6"
FT                   /protein_id="EDK99996.1"
FT                   /translation="MCGICCSVILTGIGADEQLAGYSRHRARFQSLGLEGLNEEIAMEL
FT                   GRISSRNLGRDDRVIGDHGKEARFPFLDENVVSFLNSLPVWEKVDLTLPRGVGEKLILR
FT                   LAAMELGLPASALLPKRAIQFGSRIAKLEKSNEKASDKCGRLQILP"
FT   CDS             complement(join(1635334..1635583,1637184..1637365,
FT                   1637619..1639070))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115470"
FT                   /product="mCG115470, isoform CRA_a"
FT                   /note="gene_id=mCG115470.1 transcript_id=mCT116577.0
FT                   protein_id=mCP74853.1 isoform=CRA_a"
FT                   /protein_id="EDK99995.1"
FT                   /translation="MCGICCSVSFSIEHFSKELKEDLLHNLRRRGPNSSRQLLKSAVNY
FT                   QCLFSGHVLHLRGVLTIQPVEDEHGNVFLWNGEVFNGVKVEAEDNDTQVMFNSLSACKN
FT                   ESEILLLFSKVQGPWSFIYYQASSHHLWFGRDFFGRRSLLWQFSNLGKSFCLSSVGTQV
FT                   YGVADQWQEVPASGIFQIDLNSAAVSRSVILKLYPWRYISKEDIAEECGNDLTQTPAGL
FT                   PEFVSVVINEANLYLSKPVVPLNKKLPESPLEIQCRNSSSTSGTRETLEVFLTDEHTKK
FT                   IVQQFIAILNVSVKRRILCLAREENLASKEVLKTCSSKANIAILFSGGVDSMVIAALAD
FT                   RHIPLDEPIDLLNVAFVPKQKTGLPIPNIERKQQNHHEIPSEESSQSPAADEGPGEAEV
FT                   PDRVTGKAGLKELQSVNPSRTWNFVEINVSLEELQKLRRARICHLVQPLDTVLDDSIGC
FT                   AVWFASRGIGWLVTQDAVRSYKSSAKVILTGIGADEQLAGYSRHRARFQSLGLEGLNEE
FT                   IAMELGRISSRNLGRDDRVIGDHGKEARFPFLDENVVSFLNSLPVWEKVDLTLPRGVGE
FT                   KLILRLAAMELGLPASALLPKRAIQFGSRIAKLEKSNEKASDKCGRLQILP"
FT   assembly_gap    1643175..1643763
FT                   /estimated_length=589
FT                   /gap_type="unknown"
FT   assembly_gap    1649086..1649385
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   gene            complement(1686841..1952543)
FT                   /locus_tag="mCG_115458"
FT                   /note="gene_id=mCG115458.1"
FT   mRNA            complement(join(1686841..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718321..1718482,
FT                   1723386..1723586,1724446..1724607,1727926..1728102,
FT                   1734921..1735028,1737813..1738007,1739424..1739550,
FT                   1747031..1747366,1748166..1748299,1759115..1759305,
FT                   1763297..1763451,1770148..1770311,1773798..1773983,
FT                   1784482..1784662,1785590..1785936,1786720..1787050,
FT                   1791382..1791611,1793408..1794280,1808420..1808639,
FT                   1811056..1811182,1812169..1812337,1813749..1813904,
FT                   1814898..1815095,1818633..1818857,1821068..1821199,
FT                   1824381..1824557,1825335..1825517,1827457..1827606,
FT                   1830839..1831087,1834388..1834486,1837103..1837315,
FT                   1849021..1849148,1849260..1849362,1851883..1852051,
FT                   1855644..1855753,1857016..1857228,1867170..1867307,
FT                   1874446..1874615,1895750..1895940,1907681..1908315,
FT                   1925950..1926133,1930292..1930411,1933397..1933522,
FT                   1937275..1937350,1952357..1952543))
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, transcript variant mCT116564"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT116564.1
FT                   created on 01-OCT-2002"
FT   mRNA            complement(join(1686841..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718321..1718482,
FT                   1723386..1723586,1724446..1724592,1747030..1747366,
FT                   1748166..1748299,1759121..1759318,1763304..1763451,
FT                   1770148..1770296,1773798..1773983,1784482..1784662,
FT                   1785590..1785936,1786720..1787050,1791382..1791611,
FT                   1793408..1794280,1808420..1808599,1811061..1811182,
FT                   1812169..1812337,1824393..1824557,1825335..1825517,
FT                   1827457..1827606,1830839..1831087,1834388..1834486,
FT                   1837103..1837315,1849021..1849148,1849260..1849362,
FT                   1851883..1852051,1855644..1855753,1857016..1857228,
FT                   1867170..1867307,1874446..1874615,1895750..1895940,
FT                   1907681..1908315))
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, transcript variant mCT173363"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT173363.0
FT                   created on 01-OCT-2002"
FT   mRNA            complement(join(1686841..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718330..1718482,
FT                   1723386..1723586,1724455..1724595,1747078..1747366,
FT                   1748166..1748299,1759121..1759306,1763298..1763451,
FT                   1770148..1770311,1773798..1773958,1784478..1784662,
FT                   1785590..1785936,1786720..1787050,1791382..1791611,
FT                   1793408..1793977,1811121..1811182,1812169..1812337,
FT                   1814907..1815089,1825332..1825510,1827435..1827593,
FT                   1830847..1831087,1834388..1834486,1837049..1837315,
FT                   1849021..1849148,1849260..1849362,1851883..1852051,
FT                   1855644..1855744,1874449..1874624,1895750..1895940,
FT                   1907681..1907889))
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, transcript variant mCT173364"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT173364.0
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(1687603..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718321..1718482,
FT                   1723386..1723586,1724446..1724607,1727926..1728102,
FT                   1734921..1735028,1737813..1738007,1739424..1739550,
FT                   1747031..1747366,1748166..1748299,1759115..1759305,
FT                   1763297..1763451,1770148..1770311,1773798..1773983,
FT                   1784482..1784662,1785590..1785936,1786720..1787050,
FT                   1791382..1791611,1793408..1794280,1808420..1808639,
FT                   1811056..1811182,1812169..1812337,1813749..1813904,
FT                   1814898..1815095,1818633..1818857,1821068..1821199,
FT                   1824381..1824557,1825335..1825517,1827457..1827606,
FT                   1830839..1831087,1834388..1834486,1837103..1837315,
FT                   1849021..1849148,1849260..1849362,1851883..1852051,
FT                   1855644..1855753,1857016..1857228,1867170..1867307,
FT                   1874446..1874615,1895750..1895940,1907681..1908315,
FT                   1925950..1926133,1930292..1930411,1933397..1933522,
FT                   1937275..1937350,1952357..1952486))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, isoform CRA_a"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT116564.1
FT                   protein_id=mCP74592.1 isoform=CRA_a"
FT                   /protein_id="EDK99997.1"
FT                   /translation="MEDSWLEHVLQLVPEHLKVLTNSIKVLSDEIREDYLLSVKKSIVD
FT                   FVLKDPREKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLD
FT                   LWHSTFKKLRLVDIEEFHSCQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIFNQG
FT                   NKKKQLPTGKSTAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPLYPQRKKIQDA
FT                   LNPYLHLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNAL
FT                   AMTKKVHSMVEEFKQYIPLIQVFCNPGLRPRHWEAMSTIVGYPLQPSDDSTVFSFIDMN
FT                   LEPFLDRFGSISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQML
FT                   LDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSRD
FT                   IMSQMPEEGRRFTAVDKTWRDVMKTVVQVVVTIERMLERLKKSNELLELILKGLNEYLE
FT                   KKRLFFPRFFFLSNDELLEILSETKDPIRDAIVAYTKTSRISWVRDWPGQTVLCVSQTF
FT                   WTVEVQIAIPEGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDV
FT                   LASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTD
FT                   RCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFF
FT                   KGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAV
FT                   FITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATY
FT                   RLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHD
FT                   LPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHSMNLQMTDFFSEKILQIYEMMIVRH
FT                   GFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLV
FT                   SHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEII
FT                   QMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKE
FT                   FIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMDDFADENKQKERNDR
FT                   ESFSLLEGIFLFSLIWSVGATCTDDDRLKFDKILRELLEGPISNLTRNKFKLLSGTEQT
FT                   SSKVFIVPFPEKGTIYDYQFIPEGLGRWDKWIKDLADTPPIPKDVQFNEIIVPTLDTIR
FT                   YSALMNLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQ
FT                   NIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDL
FT                   KDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSNKSMFTIFSRILAWH
FT                   LRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLS
FT                   RPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLINYIQEILKNYMQEDFHDLFKNL
FT                   DFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPM
FT                   NLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKG
FT                   YGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDE
FT                   KQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAMSPIGDAFRIRLRK
FT                   FPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKRFHTSTINLSTS
FT                   FHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQ
FT                   SELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDEC
FT                   DADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPD
FT                   PTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKI
FT                   RNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAALHEVQ
FT                   DKLAKLQDTLELNKQKKADLEHQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLY
FT                   INLTGDILISSGVVAYLGAFTSNYRQNQTKQWSQSCKERDIPCSDDYSLMGTLGEAVTI
FT                   RAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPS
FT                   YVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPDFR
FT                   FYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQG
FT                   ADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKI
FT                   DITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRL
FT                   QILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNAINKTEWRFLLTGGIGLDN
FT                   PYTNPCTWLPQKSWDEICRLDDLPAFKTIREEFMRLKDGWKKVYDSMEPHHEMFPEDWG
FT                   NKANDFQRMLIIRCLRPDKASAGFVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCC
FT                   APLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVV
FT                   LQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPK
FT                   GLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPY
FT                   EFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFF
FT                   CTELVENPQYKFDSSGIYFVPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSE
FT                   TQLLFDNILLTQSHSSGSGTKSSDEVVNEVAGDILGKLPNNFDVEAAMRRYPTTYTQSM
FT                   NTVLVQEMGRFNKLLITIRESCINIQKAVKGLVVMSTELEEVVSSILNVKIPAMWMGKS
FT                   YPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIP
FT                   IDLLGFDYEVMDDKEYKKAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMW
FT                   LKPCKKSDIPRRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSVHPKEHWIGRGVA
FT                   LLCQLNS"
FT   CDS             complement(join(1687603..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718321..1718482,
FT                   1723386..1723586,1724446..1724592,1747030..1747366,
FT                   1748166..1748299,1759121..1759318,1763304..1763451,
FT                   1770148..1770296,1773798..1773983,1784482..1784662,
FT                   1785590..1785936,1786720..1787050,1791382..1791611,
FT                   1793408..1794280,1808420..1808599,1811061..1811182,
FT                   1812169..1812337,1824393..1824557,1825335..1825517,
FT                   1827457..1827549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, isoform CRA_b"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT173363.0
FT                   protein_id=mCP96283.0 isoform=CRA_b"
FT                   /protein_id="EDK99998.1"
FT                   /translation="MGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVD
FT                   AVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPH
FT                   MLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRIVFVDDVNMPAREVYG
FT                   AQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVT
FT                   INEFSNKSMFTIFSRILAWHLRIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQ
FT                   GVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLINYIQEILKNYMQEDFHD
FT                   LFKNLDFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNM
FT                   SKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQV
FT                   EISKGYGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNL
FT                   FALDEKQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAMSPIGDAFR
FT                   IRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKRFHTSTI
FT                   NLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQ
FT                   VATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKA
FT                   IKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKA
FT                   DKIPDPTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDF
FT                   VPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAA
FT                   LHEVQDKLAKLQDTLELNKQKKADLEHQVDLCSKKLERAEQLIGGLGGEKTRWSNSALE
FT                   LGHLYINLTGDILISSGVVAYLGAFTSNYRQWSQSCKERDIPCSDDYSLMGTLGEAVTI
FT                   RAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPS
FT                   YVRTLENCIQFGFLPLVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPD
FT                   FRFYITTKLRNPHYLPETSVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQG
FT                   ADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKI
FT                   DITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRK
FT                   LSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDF
FT                   RIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEF
FT                   KKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALR
FT                   YMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYI
FT                   DYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSHSSGSGTKSSDEVVNEV
FT                   AGDILGKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAVK
FT                   GLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPP
FT                   PVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDKEYKKAPEDGVYIHGLF
FT                   LDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPRRPSYVAPLYKTSERRGTLS
FT                   TTGHSTNFVIAMILPSVHPKEHWIGRGVALLCQLNS"
FT   CDS             complement(join(1687603..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718330..1718482,
FT                   1723386..1723586,1724455..1724595,1747078..1747366,
FT                   1748166..1748299,1759121..1759306,1763298..1763451,
FT                   1770148..1770311,1773798..1773958,1784478..1784662,
FT                   1785590..1785936,1786720..1787050,1791382..1791611,
FT                   1793408..1793977,1811121..1811182,1812169..1812337,
FT                   1814907..1815089,1825332..1825510,1827435..1827549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, isoform CRA_c"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT173364.0
FT                   protein_id=mCP96282.0 isoform=CRA_c"
FT                   /protein_id="EDK99999.1"
FT                   /translation="MGQLYGQFDLVSHEWSDGVLAVSFRAFAASSVRVCLLTYRKWLIF
FT                   DGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVGRWDKW
FT                   IKDLADTPPIPKDVQFNEIIVPTLDTIRYSALMNLLTTHQKPSIFVGPTGTGKSVIVFV
FT                   DDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPI
FT                   TPRYMRHFNIVTINLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHM
FT                   ADYSLFQVEISKGYGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLL
FT                   NAGEVPNLFALDEKQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAM
FT                   SPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMC
FT                   KRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLD
FT                   KLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVAN
FT                   DQAMAAKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAV
FT                   CILKGIKADKIPDPTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRK
FT                   SYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAME
FT                   GLRKKQAALHEVQDKLAKLQDTLELNKQKKADLEHQVERAEQLIGGLGGEKTRWSNSAL
FT                   ELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKQWSQSCKERDIPCSDDYSLMGTL
FT                   GEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLI
FT                   KLSDPSYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIE
FT                   YSPDFRFYITTKLRNPHYLPETSVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQAL
FT                   ILQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEET
FT                   EKKIDITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFSKLSSLSLGQGQG
FT                   PIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKELSAESTHPDFRIWLTSYPSPNFPV
FT                   SVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALV
FT                   QERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDELPYDALRYMTGECNYGGRVTDDWD
FT                   RRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIDYTKTLPLIPAPEVFGM
FT                   NANADITKDQSETQLLFDNILLTQSHSSGSGTKSSDEVVNEVAGDILGKLPNNFDVEAA
FT                   MRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAVKGLVVMSTELEEVVSSIL
FT                   NVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTG
FT                   AQQNYARKFTIPIDLLGFDYEVMDDKEYKKAPEDGVYIHGLFLDGASWDRKTKKLAESH
FT                   PKVLYDTVPVMWLKPCKKSDIPRRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSV
FT                   HPKEHWIGRGVALLCQLNS"
FT   assembly_gap    1781504..1781523
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1802112..1802168
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    1810773..1810904
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    1839496..1839975
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    1894759..1894778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1936557..1936660
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   gene            complement(<1987560..1996314)
FT                   /locus_tag="mCG_144888"
FT                   /note="gene_id=mCG144888.0"
FT   mRNA            complement(join(<1987560..1988058,1988162..1988224,
FT                   1991548..1991610,1996208..1996314))
FT                   /locus_tag="mCG_144888"
FT                   /product="mCG144888"
FT                   /note="gene_id=mCG144888.0 transcript_id=mCT184312.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(<1987560..1987870)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144888"
FT                   /product="mCG144888"
FT                   /note="gene_id=mCG144888.0 transcript_id=mCT184312.0
FT                   protein_id=mCP106115.0"
FT                   /protein_id="EDL00001.1"
FT                   /translation="MDTSQQEYQNQPGGQEKFSAVPLSMNGRSMKMQDQGRGAKLAMQA
FT                   SLPAIESNLYSLQTSHVLPQDLPRKTPHESVSPDISRNFHFSSFQRFTGSKLKIKYQIS
FT                   "
FT   assembly_gap    2007818..2007837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2018049..2018068
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2022857..2023079
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    2032850..2032869
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2046195..2075887)
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /note="gene_id=mCG113058.1"
FT   mRNA            complement(join(2046195..2048456,2051668..2051847,
FT                   2053275..2053323,2054718..2054844,2056607..2056751,
FT                   2062296..2062508,2067203..2067365,2075684..2075887))
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /product="serine/threonine kinase 17b (apoptosis-inducing),
FT                   transcript variant mCT114134"
FT                   /note="gene_id=mCG113058.1 transcript_id=mCT114134.1
FT                   created on 19-JUL-2002"
FT   mRNA            complement(join(2046792..2048456,2051668..2051847,
FT                   2053275..2053323,2054718..2054844,2056607..2056751,
FT                   2062296..2062508,2067203..2067365,2075760..>2075856))
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /product="serine/threonine kinase 17b (apoptosis-inducing),
FT                   transcript variant mCT189288"
FT                   /note="gene_id=mCG113058.1 transcript_id=mCT189288.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(2048174..2048456,2051668..2051847,
FT                   2053275..2053323,2054718..2054844,2056607..2056751,
FT                   2062296..2062508,2067203..2067365,2075760..>2075856))
FT                   /codon_start=1
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /product="serine/threonine kinase 17b (apoptosis-inducing),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG113058.1 transcript_id=mCT189288.0
FT                   protein_id=mCP110236.0 isoform=CRA_b"
FT                   /protein_id="EDL00003.1"
FT                   /translation="VRSVGQRLCGRRRESPHRGLADGDQPLWGRVRGKSLPREAGLAVI
FT                   NMSRRRFDCRSVSGLLTTTPQTPIKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQE
FT                   YAAKSLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYENATEIILVLEYAAGGE
FT                   IFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIK
FT                   IVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPF
FT                   VGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQ
FT                   QWDFGSLFHPEETSGSSQIQDLTLRSSEEKTSKSSCNGSCGAREDKENIPEDGSLVSKR
FT                   FRFDDSLPSPHELVPDLFC"
FT   CDS             complement(join(2048174..2048456,2051668..2051847,
FT                   2053275..2053323,2054718..2054844,2056607..2056751,
FT                   2062296..2062508,2067203..2067324))
FT                   /codon_start=1
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /product="serine/threonine kinase 17b (apoptosis-inducing),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG113058.1 transcript_id=mCT114134.1
FT                   protein_id=mCP74707.1 isoform=CRA_a"
FT                   /protein_id="EDL00002.1"
FT                   /translation="MSRRRFDCRSVSGLLTTTPQTPIKTENFNNFYTLTPKELGRGKFA
FT                   VVRQCISKSTGQEYAAKSLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYENAT
FT                   EIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQN
FT                   ILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIG
FT                   IIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKR
FT                   PTAESCLSHSWLQQWDFGSLFHPEETSGSSQIQDLTLRSSEEKTSKSSCNGSCGAREDK
FT                   ENIPEDGSLVSKRFRFDDSLPSPHELVPDLFC"
FT   assembly_gap    2076056..2076075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2076534..2076618
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    2094104..2094123
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2101471..2331159)
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /note="gene_id=mCG113057.2"
FT   mRNA            complement(join(2101471..2104068,2118193..2118305,
FT                   2119202..2119287,2121959..2122073,2122827..2122973,
FT                   2123939..2124068,2130329..2130427,2132031..2132183,
FT                   2142892..2143005,2144576..2144696,2156448..2156557,
FT                   2160243..2160326,2176739..2176835,2178993..2179095,
FT                   2182536..2182670,2195678..2195863,2204670..2204794,
FT                   2205196..2205299,2205911..2206061,2215278..2215373,
FT                   2216689..2218062,2218444..2218544,2222349..2222488,
FT                   2224498..2224667,2228437..2228512,2234085..2234179,
FT                   2242156..2242263,2330828..2331159))
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /product="HECT, C2 and WW domain containing E3 ubiquitin
FT                   protein ligase 2, transcript variant mCT114133"
FT                   /note="gene_id=mCG113057.2 transcript_id=mCT114133.2
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(2103957..2104068,2118193..2118305,
FT                   2119202..2119287,2121959..2122073,2122827..2122973,
FT                   2123939..2124068,2130329..2130427,2132031..2132183,
FT                   2142892..2143005,2144576..2144696,2156448..2156557,
FT                   2160243..2160326,2176739..2176835,2178993..2179095,
FT                   2182536..2182670,2195678..2195863,2204670..2204794,
FT                   2205196..2205299,2205911..2206061,2215278..2215373,
FT                   2216689..2218062,2218444..2218544,2222349..2222488,
FT                   2224498..2224667,2228437..2228512,2234085..2234179,
FT                   2242156..2242263,2330828..2331119))
FT                   /codon_start=1
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /product="HECT, C2 and WW domain containing E3 ubiquitin
FT                   protein ligase 2, isoform CRA_a"
FT                   /note="gene_id=mCG113057.2 transcript_id=mCT114133.2
FT                   protein_id=mCP74530.2 isoform=CRA_a"
FT                   /protein_id="EDL00004.1"
FT                   /translation="MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQNSMPENMALQR
FT                   ANSDTDLVTSESRSSLTASMYEYTLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPAN
FT                   FWDSKNRGVTGTQKGQIVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPA
FT                   VMMGAEGMEGGASGSLHSRKLVSFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFP
FT                   TCAHHGQERRSTIISNTTNPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKL
FT                   TIPVQRLLERQAGDQMLSYNLGRRLPADHVSGYLQFKVEVTSSAHEDASPEAVGTILGV
FT                   HTVNGDLGSPSDEEDMPGSHHDSTICANGPVSEDSVADGTPKHSFRTSSTLEIDTEDLI
FT                   STSSRNSPPRGRQDSLNDYLDAIEHNGPARPGAASSSERSMGASPKLRSSFPTDTRLNA
FT                   MLHIDSDEEDHEFQQDLGYPSSLEEEGGLIMCSRASRIDDGSLTSQTKPEDDNPVENED
FT                   ASIHETASLEERLENLPEVADGSLPSSTAPDENEANLEPQPSADQGSTELCSSQEVDQP
FT                   TSGADAGASDTSGGSRRAASETESLDQGSEPSQVSSETEPSDPARTESVSEASTRPEGE
FT                   SDPEGADSSCNESVTTQLSSVETRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPA
FT                   EGSQESVCTPSSLPAVQVPSREEEGSAAEAAALSEQGELGEVWQRRGSLEGAAAAAPAA
FT                   AATDSQPQEDGDAGDAQGACEGATAQEEGATGGSQTNGHQPLRSLPSVRQDVSRYQRVD
FT                   EALPPNWEARIDSHGRIFYVDHVNRTTTWQRPTAPPAPQVLQRSNSIQQMEQLNRRYQS
FT                   IRRTMTNERPEENTSAIDGAGEEADFHQASADFRRENVLPHSTSRSRLTLLLQSPPVKF
FT                   LISPEFFTVLHSNPSAYRMFTNNTCLKHMITKVRRDTHHFERYQHNRDLVGFLNMFANK
FT                   QLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDPRLPLQSSRPTSALVHRQHLTRQRSHS
FT                   AGEVGEDSRHAGPPVLPRPSSTFNTVSRPQYQDMVPVAYNDKIVAFLRQPNILEILQER
FT                   QPDLARNHSLREKIQFIRTEGTPGLVRLSSDADLVMLLSLFEEEIMSYVPPHALLHPSY
FT                   CQSPRGSPVSSPQNSPGTQRANARAPAPYKRDFEAKLRNFYRKLETKGYGQGPGKLKLI
FT                   IRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEEGLDYSGPSREFFFLVSRELFNPYY
FT                   GLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILGLALIHQYLLDAFFTRPFYKALL
FT                   RILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNEEVFGQITERELKPGGANIP
FT                   VTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDARELELVIAGTAE
FT                   IDLNDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSIPYEGFASL
FT                   RGSNGPRRFCVEKWGKITALPRAHTCFNRLDLPPYPSFSMLYEKLLTAVEETSTFGLE"
FT   assembly_gap    2109715..2109734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2143606..2143688
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    2184772..2184791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2207739..2207826
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   mRNA            complement(join(2222196..2222488,2224498..2224667,
FT                   2228437..2228512,2234085..2234179,2242156..2242263,
FT                   2330828..2331159))
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /product="HECT, C2 and WW domain containing E3 ubiquitin
FT                   protein ligase 2, transcript variant mCT194448"
FT                   /note="gene_id=mCG113057.2 transcript_id=mCT194448.0
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(2222345..2222488,2224498..2224667,
FT                   2228437..2228512,2234085..2234179,2242156..2242263,
FT                   2330828..2331119))
FT                   /codon_start=1
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /product="HECT, C2 and WW domain containing E3 ubiquitin
FT                   protein ligase 2, isoform CRA_b"
FT                   /note="gene_id=mCG113057.2 transcript_id=mCT194448.0
FT                   protein_id=mCP115477.0 isoform=CRA_b"
FT                   /db_xref="GOA:A3KPB7"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR032348"
FT                   /db_xref="MGI:MGI:2685817"
FT                   /db_xref="UniProtKB/TrEMBL:A3KPB7"
FT                   /protein_id="EDL00005.1"
FT                   /translation="MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQNSMPENMALQR
FT                   ANSDTDLVTSESRSSLTASMYEYTLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPAN
FT                   FWDSKNRGVTGTQKGQIVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPA
FT                   VMMGAEGMEGGASGSLHSRKLVSFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFP
FT                   TCAHHGQERRSTIISNTTNPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKL
FT                   TIPVQRLLERQAG"
FT   assembly_gap    2240708..2240877
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    2248917..2249478
FT                   /estimated_length=562
FT                   /gap_type="unknown"
FT   assembly_gap    2250442..2252246
FT                   /estimated_length=1805
FT                   /gap_type="unknown"
FT   assembly_gap    2254187..2254448
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    2265337..2265356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2274677..2274696
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2280647..2280666
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2309988..2310007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2320109..2322998
FT                   /estimated_length=2890
FT                   /gap_type="unknown"
FT   assembly_gap    2342025..2342044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2358269..2358402
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    2445399..2445510
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    2471148..2471234
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    2485220..2488221
FT                   /estimated_length=3002
FT                   /gap_type="unknown"
FT   assembly_gap    2490666..2490685
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2491701..2491807
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    2506513..2506532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2512786..2513056
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    2533215..2533234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2534535..2534554
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2536384..2536403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2538095..2538114
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2539260..2539279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2542299..2545324
FT                   /estimated_length=3026
FT                   /gap_type="unknown"
FT   gene            2545874..2567560
FT                   /locus_tag="mCG_113060"
FT                   /note="gene_id=mCG113060.1"
FT   mRNA            join(2545874..2546130,2555169..2555332,2558689..2558909,
FT                   2559020..2559198,2561075..2561143,2566251..2566367,
FT                   2567308..2567560)
FT                   /locus_tag="mCG_113060"
FT                   /product="mCG113060"
FT                   /note="gene_id=mCG113060.1 transcript_id=mCT114136.1
FT                   created on 04-SEP-2002"
FT   CDS             join(2546074..2546130,2555169..2555332,2558689..2558909,
FT                   2559020..2559198,2561075..2561143,2566251..2566367,
FT                   2567308..2567472)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113060"
FT                   /product="mCG113060"
FT                   /note="gene_id=mCG113060.1 transcript_id=mCT114136.1
FT                   protein_id=mCP74729.1"
FT                   /protein_id="EDL00006.1"
FT                   /translation="METNLLPGGPSYGLLDESGVQMETTVCRPVLSPTHINGTASETFT
FT                   VLQQKMRIVEEQTSSLRDDLIMLGYGDRRGQLETPNYLEDPASQKAISPIPNEVICPES
FT                   PGNLWRNYEFLVNRMCYLENLIQSLKMNIFHLQTEKESNPQKTAFLNDQLNIIQGEHSK
FT                   GLKLLQLEVMNLRQQLKVVKEEEDRAQDEMQRLTATLEIATETKKNAAVIEEELKTTKR
FT                   KMNLKIQELRRQLAQEKLVRESLETSASSMLLKVQEMGSVVEAERQQVHALQEKCTALH
FT                   SSMKTTQDLLAQEQRKNEDLGMTISQLKSDLSMQTLLRARMV"
FT   assembly_gap    2578115..2578134
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2605221..2605240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2618529..2657147
FT                   /locus_tag="mCG_113056"
FT                   /note="gene_id=mCG113056.1"
FT   mRNA            join(2618529..2619004,2641437..2641565,2643060..2643229,
FT                   2644128..2644221,2645105..2645274,2649424..2649550,
FT                   2652850..2653044,2653327..2653395,2653480..2653641,
FT                   2654570..2654656,2656325..2656444,2656712..2657147)
FT                   /locus_tag="mCG_113056"
FT                   /product="mCG113056"
FT                   /note="gene_id=mCG113056.1 transcript_id=mCT114132.1
FT                   created on 23-SEP-2002"
FT   CDS             join(2618678..2619004,2641437..2641565,2643060..2643229,
FT                   2644128..2644221,2645105..2645274,2649424..2649550,
FT                   2652850..2653044,2653327..2653395,2653480..2653641,
FT                   2654570..2654656,2656325..2656444,2656712..2656810)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113056"
FT                   /product="mCG113056"
FT                   /note="gene_id=mCG113056.1 transcript_id=mCT114132.1
FT                   protein_id=mCP74520.1"
FT                   /protein_id="EDL00007.1"
FT                   /translation="MPPRRRRSPERPTSSKSLEGSRFYVSNVKERAATVALPSVIPNVA
FT                   RRVSFAPTLPSMRMSQGMGDSRISLKTLLNAIKTMEGRLEGKIDILASRPFLSEESSNL
FT                   LKQDSMKSILGKNEEELAQAVKCRDAALKESQKLKGDLKALEDRESKKVGNFQKQLAEA
FT                   KEDNCKVTIMLENVLASHSKMQGALEKVQIELGRRDSEIAGLKKERSLNQQRVQKLEAE
FT                   VDQWQARMLIVEAQHGSEIEPLQKSLDITREDNRKLAMSLEQALQTNGHLQSKLDHLQE
FT                   KLESKERERQSLEAFKEQVAEESKVEAELHAERIEALRKQFQTERETAKKASQREVSEL
FT                   KKALDEANFRSVEVSRANRELRHKATELEKVVNSNKEKLKNQRAQIKLHLSAKANNAQN
FT                   MERMKQIEMELRQMEIIKDQYQKKNYEQSLSIQRFVSEMNTLQKEMELLTKSQYETSAR
FT                   NKQQELRLVAERKMRLELENRCKELEETIRHLKRCKEATENKLKEASVESEQITANLEE
FT                   AHRWFKCRFDGLQLELTKNRLQRLPREDRWLEENQDMMHNVATSQSVLHRWETKQKYHS
FT                   DTERKK"
FT   assembly_gap    2620770..2620883
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    2674649..2674809
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            complement(2678981..>2714112)
FT                   /locus_tag="mCG_113059"
FT                   /note="gene_id=mCG113059.1"
FT   mRNA            complement(join(2678981..2679235,2679250..2680001,
FT                   2681128..2681280,2685510..2685634,2686979..2687169,
FT                   2687836..2688073,2691093..2691228,2691931..2692032,
FT                   2692865..2693067,2694589..2694760,2695602..2695705,
FT                   2698707..2698779,2699215..2699362,2702606..2702771,
FT                   2703968..2704159,2705705..2705828,2709260..2709444,
FT                   2712985..2713096,2713966..>2714112))
FT                   /locus_tag="mCG_113059"
FT                   /product="mCG113059"
FT                   /note="gene_id=mCG113059.1 transcript_id=mCT114135.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(2679879..2680001,2681128..2681280,
FT                   2685510..2685634,2686979..2687169,2687836..2688073,
FT                   2691093..2691228,2691931..2692032,2692865..2693067,
FT                   2694589..2694760,2695602..2695705,2698707..2698779,
FT                   2699215..2699362,2702606..2702771,2703968..2704159,
FT                   2705705..2705828,2709260..2709444,2712985..2713096,
FT                   2713966..>2714112))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113059"
FT                   /product="mCG113059"
FT                   /note="gene_id=mCG113059.1 transcript_id=mCT114135.1
FT                   protein_id=mCP74711.1"
FT                   /protein_id="EDL00008.1"
FT                   /translation="CCSFPGPLRSVGPADMSGFSPELIDYLEGKISFEEFERRREERKT
FT                   REKKSVQEKGKSSPKENPDDSEVPSSSGIDSAKSQDKDANEGETSDGVSKSVHKVFASM
FT                   LGETEDDEEEEEEEEEEETAEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGL
FT                   MGEANIRFARGEHEEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAH
FT                   LNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGDHKMA
FT                   MDGYRRILNLLSPSDGERFMQLARDMAKSYYEANDSASAINIIEEAFSKHQGLVSMEDV
FT                   NIAAELYISNKQYDKALEVITDFSGIILEKETLEEGTSEENKAAETVTCSIPDSVPIDI
FT                   TVKLMVCLVHLNILEPLNPLLTTLVEQNPEDMGDLYLDVAEAFLDVGEYNSALPLLSAL
FT                   VCSERYNLAVVWLRHAECLKALGYMERAAESYSKVVDLAPLHLDARISLSILQQQLGRP
FT                   EKALEALEPMYDPDTLAQDANAAQQELKLLLHRSTLLFSQGKMYGYLDTLLTMLAMLLK
FT                   VAMNRAQVCLISSSKSGERHLYLIKVSRDKISDNNEQETSNYDAKAIFAVLTSVLPKED
FT                   WWNLLLKAIYTLSDLARFQEAELLVDSSLEYYSFYDDRQKRKELEYFGLSAAILDKNFR
FT                   KAYDYIRVMVMENVNKPQLWNIFNQVTMHSQDVRHHRFCLRLMLKNPDNHALCVLNGHN
FT                   AFVSGSFKHALGQYVQAFRAYPSEPLYNLCIGLTFIHMASQKYVLKRHALTVQGFSFLN
FT                   RYLSIRGPCQESFYNLGRGLHQLGLTHLAIHYYQKALALPPLVVEGIEVDQLDLRRDIA
FT                   YNMSLIYQSSGNTAMAQKLLYTYCVI"
FT   assembly_gap    2710143..2710162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2755700..2768608)
FT                   /locus_tag="mCG_113062"
FT                   /note="gene_id=mCG113062.1"
FT   mRNA            complement(join(2755700..2755788,2755855..2755972,
FT                   2757008..2757053,2761626..2761813,2765378..2765428,
FT                   2767231..2767366,2768411..2768608))
FT                   /locus_tag="mCG_113062"
FT                   /product="mCG113062"
FT                   /note="gene_id=mCG113062.1 transcript_id=mCT114140.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(2755862..2755972,2757008..2757053,
FT                   2761626..2761813,2765378..2765428,2767231..2767366,
FT                   2768411..2768532))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113062"
FT                   /product="mCG113062"
FT                   /note="gene_id=mCG113062.1 transcript_id=mCT114140.1
FT                   protein_id=mCP74762.1"
FT                   /protein_id="EDL00009.1"
FT                   /translation="MCFPLVSLILFLFGTCTAYWSGLLSSTSVQLLSSLWLALKRPAEL
FT                   PKDIKVMSPDLPVLTVVFLIVSWTTCGALAILLSYLYYVFKVVHLQASLTTFKNNQPVN
FT                   PKHSRRSEKKSNHHKDSAVQSLRLCANDAEDSLRMHSTVINLLTWVVLLSMPSLIYWLK
FT                   NLSYSDSRKHSHCFSKVQPLPLAVGVIAFGSSHLYRVPCFVIIPLVFHALCNFM"
FT   assembly_gap    2765909..2766131
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   gene            complement(<2785231..2832807)
FT                   /locus_tag="mCG_113061"
FT                   /note="gene_id=mCG113061.1"
FT   mRNA            complement(join(<2785231..2785272,2786600..2786708,
FT                   2787107..2787173,2787803..2787854,2787978..2788051,
FT                   2790022..2790097,2796477..2796554,2799501..2799552,
FT                   2800553..2800599,2803697..2803780,2805302..2805357,
FT                   2806039..2806144,2807207..2807273,2808604..2808656,
FT                   2811140..2811297,2818223..2818394,2823123..2823298,
FT                   2826161..2826314,2832620..2832807))
FT                   /locus_tag="mCG_113061"
FT                   /product="mCG113061"
FT                   /note="gene_id=mCG113061.1 transcript_id=mCT114137.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(<2785231..2785272,2786600..2786708,
FT                   2787107..2787173,2787803..2787854,2787978..2788051,
FT                   2790022..2790097,2796477..2796554,2799501..2799552,
FT                   2800553..2800599,2803697..2803780,2805302..2805357,
FT                   2806039..2806144,2807207..2807273,2808604..2808656,
FT                   2811140..2811297,2818223..2818394,2823123..2823298,
FT                   2826161..2826314,2832620..2832766))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113061"
FT                   /product="mCG113061"
FT                   /note="gene_id=mCG113061.1 transcript_id=mCT114137.1
FT                   protein_id=mCP74739.1"
FT                   /protein_id="EDL00010.1"
FT                   /translation="MFLHSVNLWNLAFYVFMVFLATLGLWDVFFGFEENKCSMSYMFEY
FT                   PEYQKIELPKKLTKRYPAYELYLYGEGSYAEEHKILPLTGIPVLFLPGNAGSYKQVRSI
FT                   GSIALRKAEDIDFKYHFDFFSVNFNEELVALYGGSLQKQTKFVHECIKAILKLYKGQEF
FT                   APTSVAIIGHSMGGLVARALLTLKNFKQDLINLLVTQATPHVAPVMPLDRFITEFYMNV
FT                   NNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHYTSALSVVSSAVPKTWVSTD
FT                   HLSIVWCKQLQLTTIRAFFDLIDADTKQITQKPKKKLSVLNHHFIRHPAKQFEENPSII
FT                   SDLTGTSMWVPVKVSRWSYVAYNESDKIYFAFPLANHRKIYTHAYCQSTMLDTNSWIFG
FT                   CINSTSMCRQGVDLSWKAELLPTIKSLTLRLQDYPSLSHIVVYVPSVHGSKFVVDCEFF
FT                   KKEARSMQLPVTHLFSFGLSSRKVTLNTNGLYYNIELLNFGQIYQAFKVNVVSKCTGSK
FT                   EEITSIYKLHIPWSYEDSLTIAQVPSSTDISLKLHVAQPENDSHVALLKMYTSSDCQYE
FT                   VTIKTSFPQILGQV"
FT   assembly_gap    2788710..2788729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2881619..2884714
FT                   /locus_tag="mCG_1035622"
FT                   /note="gene_id=mCG1035622.1"
FT   mRNA            join(2881619..2882318,2884023..2884714)
FT                   /locus_tag="mCG_1035622"
FT                   /product="mCG1035622"
FT                   /note="gene_id=mCG1035622.1 transcript_id=mCT153326.1
FT                   created on 30-OCT-2002"
FT   CDS             join(2882090..2882318,2884023..2884192)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035622"
FT                   /product="mCG1035622"
FT                   /note="gene_id=mCG1035622.1 transcript_id=mCT153326.1
FT                   protein_id=mCP74463.1"
FT                   /protein_id="EDL00011.1"
FT                   /translation="MQVYNKKEQSEEYNLKIKRNAPGNLMFEPWPVLKERKRLRKGLPW
FT                   NGVQEGNLRARPHPGKRKGLRNFQPLKSNNNDEKQLCPYDLCSPECVRRGGSIATTESK
FT                   SGSYRKHTQGEALRRRLGVGPWQTSHLI"
FT   assembly_gap    2905850..2905958
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    2911853..2911872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2922602..3201965)
FT                   /locus_tag="mCG_117548"
FT                   /note="gene_id=mCG117548.1"
FT   mRNA            complement(join(2922602..2923826,2924819..2924991,
FT                   2927060..2927151,2929134..2929216,2930471..2930553,
FT                   2931052..2931197,2933007..2933090,2934310..2934397,
FT                   2936392..2936608,2938045..2938162,2939290..2939377,
FT                   2942764..2942965,2956512..2956583,2998499..2998610,
FT                   3002975..3003055,3005219..3005359,3008413..3008481,
FT                   3010481..3010598,3011715..3011797,3018799..3018913,
FT                   3028371..3028449,3037798..3038010,3039182..3039324,
FT                   3041887..3041974,3042321..3042521,3053824..3053894,
FT                   3067958..3068036,3103674..3103757,3201717..3201965))
FT                   /locus_tag="mCG_117548"
FT                   /product="mCG117548"
FT                   /note="gene_id=mCG117548.1 transcript_id=mCT118695.1
FT                   created on 25-MAR-2003"
FT   CDS             complement(join(2923668..2923826,2924819..2924991,
FT                   2927060..2927151,2929134..2929216,2930471..2930553,
FT                   2931052..2931197,2933007..2933090,2934310..2934397,
FT                   2936392..2936608,2938045..2938162,2939290..2939377,
FT                   2942764..2942965,2956512..2956583,2998499..2998610,
FT                   3002975..3003055,3005219..3005359,3008413..3008481,
FT                   3010481..3010598,3011715..3011797,3018799..3018913,
FT                   3028371..3028449,3037798..3038010,3039182..3039324,
FT                   3041887..3041974,3042321..3042521,3053824..3053894,
FT                   3067958..3068036,3103674..3103757,3201717..3201743))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117548"
FT                   /product="mCG117548"
FT                   /note="gene_id=mCG117548.1 transcript_id=mCT118695.1
FT                   protein_id=mCP74677.1"
FT                   /protein_id="EDL00012.1"
FT                   /translation="MAVLKLCEQPPLVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPL
FT                   HVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARD
FT                   KNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKG
FT                   ANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVV
FT                   KHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAA
FT                   STHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGN
FT                   TPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGQKYS
FT                   IVSLFSNEHVLSAGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRT
FT                   PLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEE
FT                   LERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTG
FT                   FEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVE
FT                   ALVNQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLML
FT                   AVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSR
FT                   GRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVLLEQ
FT                   KCFRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAE
FT                   CLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHL
FT                   AISKGHEKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELLAKGACVLAV
FT                   DENGHTPALACAPNKDVADCLALILATMMTFSPSSTMTAVNFVCFRKDNLSRMTHSNLG
FT                   SRQEAEMVGVEVQANCQLFGNEISIVNTVSAPSAKASRSNGPRSPPGTAVRKEE"
FT   gene            2957119..3012301
FT                   /locus_tag="mCG_117554"
FT                   /note="gene_id=mCG117554.1"
FT   mRNA            join(2957119..2957314,2992449..2992544,2992996..2993135,
FT                   3004971..3005054,3012183..3012301)
FT                   /locus_tag="mCG_117554"
FT                   /product="mCG117554"
FT                   /note="gene_id=mCG117554.1 transcript_id=mCT118701.1
FT                   created on 04-SEP-2002"
FT   assembly_gap    2985299..2985560
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   CDS             join(2993052..2993135,3004971..3005054,3012183..3012221)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117554"
FT                   /product="mCG117554"
FT                   /note="gene_id=mCG117554.1 transcript_id=mCT118701.1
FT                   protein_id=mCP74697.1"
FT                   /protein_id="EDL00013.1"
FT                   /translation="METVHATHHLDREKASPENYALCAAGLKISKELESLGLAALLGIE
FT                   PKSREEGDYAMVVSLRYYAYCQS"
FT   assembly_gap    3055444..3055883
FT                   /estimated_length=440
FT                   /gap_type="unknown"
FT   assembly_gap    3058748..3059242
FT                   /estimated_length=495
FT                   /gap_type="unknown"
FT   assembly_gap    3063223..3063335
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    3077202..3077221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3083804..3083823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3108266..3108285
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3142122..3142302
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    3167582..3170106
FT                   /estimated_length=2525
FT                   /gap_type="unknown"
FT   assembly_gap    3203489..3203557
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    3207195..3207327
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    3223465..3223818
FT                   /estimated_length=354
FT                   /gap_type="unknown"
FT   assembly_gap    3233437..3237621
FT                   /estimated_length=4185
FT                   /gap_type="unknown"
FT   assembly_gap    3240977..3240996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3255293..3297929)
FT                   /gene="Sf3b1"
FT                   /locus_tag="mCG_117542"
FT                   /note="gene_id=mCG117542.1"
FT   mRNA            complement(join(3255293..3257613,3258060..3258276,
FT                   3260424..3260696,3264451..3264582,3265487..3265607,
FT                   3266938..3267049,3267133..3267315,3268160..3268381,
FT                   3269749..3269874,3270137..3270283,3270364..3270509,
FT                   3270766..3271036,3271134..3271220,3271505..3271684,
FT                   3273226..3273327,3273415..3273612,3275924..3276045,
FT                   3276293..3276505,3277602..3277839,3282210..3282380,
FT                   3284591..3284670,3286484..3286598,3286887..3286991,
FT                   3289339..3289505,3297789..3297929))
FT                   /gene="Sf3b1"
FT                   /locus_tag="mCG_117542"
FT                   /product="splicing factor 3b, subunit 1"
FT                   /note="gene_id=mCG117542.1 transcript_id=mCT118683.1
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(3257455..3257613,3258060..3258276,
FT                   3260424..3260696,3264451..3264582,3265487..3265607,
FT                   3266938..3267049,3267133..3267315,3268160..3268381,
FT                   3269749..3269874,3270137..3270283,3270364..3270509,
FT                   3270766..3271036,3271134..3271220,3271505..3271684,
FT                   3273226..3273327,3273415..3273612,3275924..3276045,
FT                   3276293..3276505,3277602..3277839,3282210..3282380,
FT                   3284591..3284670,3286484..3286598,3286887..3286991,
FT                   3289339..3289505,3297789..3297816))
FT                   /codon_start=1
FT                   /gene="Sf3b1"
FT                   /locus_tag="mCG_117542"
FT                   /product="splicing factor 3b, subunit 1"
FT                   /note="gene_id=mCG117542.1 transcript_id=mCT118683.1
FT                   protein_id=mCP74451.1"
FT                   /db_xref="GOA:G5E866"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015016"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1932339"
FT                   /db_xref="UniProtKB/TrEMBL:G5E866"
FT                   /protein_id="EDL00014.1"
FT                   /translation="MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYG
FT                   GSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPF
FT                   AEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTK
FT                   EEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAE
FT                   TPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGH
FT                   GGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDE
FT                   TPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPL
FT                   SDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVND
FT                   QPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALR
FT                   QITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILV
FT                   VIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVV
FT                   ASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGL
FT                   VDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYL
FT                   IPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILP
FT                   PFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMET
FT                   IEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLP
FT                   QICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEV
FT                   LGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAE
FT                   YVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQ
FT                   NRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYI
FT                   YAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPH
FT                   VIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHY
FT                   PRIYNDDKNTYIRYELDYIL"
FT   assembly_gap    3287424..3287443
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3291362..3291778
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    3295008..3295582
FT                   /estimated_length=575
FT                   /gap_type="unknown"
FT   gene            3323218..3343147
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /note="gene_id=mCG117544.1"
FT   mRNA            join(3323218..3323440,3331722..3331871,3334628..3334820,
FT                   3337944..3338045,3342083..3343147)
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /product="RIKEN cDNA 1500041J02, transcript variant
FT                   mCT118687"
FT                   /note="gene_id=mCG117544.1 transcript_id=mCT118687.1
FT                   created on 04-SEP-2002"
FT   mRNA            join(3323219..3323440,3334628..3334820,3337944..3338045,
FT                   3342083..3342400)
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /product="RIKEN cDNA 1500041J02, transcript variant
FT                   mCT172704"
FT                   /note="gene_id=mCG117544.1 transcript_id=mCT172704.0
FT                   created on 04-SEP-2002"
FT   CDS             join(3323325..3323440,3331722..3331871,3334628..3334820,
FT                   3337944..3338045,3342083..3342250)
FT                   /codon_start=1
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /product="RIKEN cDNA 1500041J02, isoform CRA_a"
FT                   /note="gene_id=mCG117544.1 transcript_id=mCT118687.1
FT                   protein_id=mCP74641.1 isoform=CRA_a"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="MGI:MGI:1915126"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J066"
FT                   /protein_id="EDL00015.1"
FT                   /translation="MIMAARTSQRALARVASGCHPKSTTVTEAPARGSARDVRHLAACG
FT                   VLINRTLPPCAAVLPKEICARTFFRISAPLVNKRKEYSERRILGYSMQEMYDVVSGMED
FT                   YQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFN
FT                   HLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACK
FT                   LYGPETNIPRELMLHEIHHT"
FT   CDS             join(3323325..3323440,3334628..3334820,3337944..3338045,
FT                   3342083..3342250)
FT                   /codon_start=1
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /product="RIKEN cDNA 1500041J02, isoform CRA_b"
FT                   /note="gene_id=mCG117544.1 transcript_id=mCT172704.0
FT                   protein_id=mCP95623.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="MGI:MGI:1915126"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8J7"
FT                   /protein_id="EDL00016.1"
FT                   /translation="MIMAARTSQRALARVASGCHPKSTTVTEAPARGSARDVRYSMQEM
FT                   YDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKA
FT                   SCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMV
FT                   AAFERRACKLYGPETNIPRELMLHEIHHT"
FT   gene            complement(3348277..3358559)
FT                   /locus_tag="mCG_117550"
FT                   /note="gene_id=mCG117550.1"
FT   mRNA            complement(join(3348277..3348887,3348976..3349154,
FT                   3349503..3349677,3350549..3350794,3351520..3351619,
FT                   3352107..3352275,3352505..3352598,3353514..3353609,
FT                   3354172..3354254,3354980..3355232,3357213..3357388,
FT                   3358436..3358559))
FT                   /locus_tag="mCG_117550"
FT                   /product="mCG117550, transcript variant mCT172709"
FT                   /note="gene_id=mCG117550.1 transcript_id=mCT172709.0
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(3348277..3348887,3348976..3349154,
FT                   3349503..3349677,3350549..3350794,3351520..3351619,
FT                   3352107..3352275,3352505..3352598,3353514..3353609,
FT                   3354172..3354254,3354980..3355232,3357213..3357388,
FT                   3358226..3358294))
FT                   /locus_tag="mCG_117550"
FT                   /product="mCG117550, transcript variant mCT118697"
FT                   /note="gene_id=mCG117550.1 transcript_id=mCT118697.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3348735..3348887,3348976..3349154,
FT                   3349503..3349677,3350549..3350794,3351520..3351619,
FT                   3352107..3352275,3352505..3352598,3353514..3353609,
FT                   3354172..3354254,3354980..3355232,3357213..3357386))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117550"
FT                   /product="mCG117550, isoform CRA_a"
FT                   /note="gene_id=mCG117550.1 transcript_id=mCT172709.0
FT                   protein_id=mCP95628.0 isoform=CRA_a"
FT                   /protein_id="EDL00017.1"
FT                   /translation="MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVD
FT                   LLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANN
FT                   TNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVT
FT                   TPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRG
FT                   YISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGE
FT                   ALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAH
FT                   DLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEKLNERLAKLSD
FT                   GVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPAN
FT                   EDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQSSSEVGYDAMLGDFVNMVEKG
FT                   IIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEKDPGMGAMGGMGGGMGGGMF"
FT   CDS             complement(join(3348735..3348887,3348976..3349154,
FT                   3349503..3349677,3350549..3350794,3351520..3351619,
FT                   3352107..3352275,3352505..3352598,3353514..3353609,
FT                   3354172..3354254,3354980..3355232,3357213..3357386))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117550"
FT                   /product="mCG117550, isoform CRA_a"
FT                   /note="gene_id=mCG117550.1 transcript_id=mCT118697.1
FT                   protein_id=mCP74692.1 isoform=CRA_a"
FT                   /protein_id="EDL00018.1"
FT                   /translation="MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVD
FT                   LLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANN
FT                   TNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVT
FT                   TPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRG
FT                   YISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGE
FT                   ALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAH
FT                   DLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEKLNERLAKLSD
FT                   GVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPAN
FT                   EDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQSSSEVGYDAMLGDFVNMVEKG
FT                   IIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEKDPGMGAMGGMGGGMGGGMF"
FT   gene            3358580..3361759
FT                   /locus_tag="mCG_117539"
FT                   /note="gene_id=mCG117539.1"
FT   mRNA            join(3358580..3358859,3359498..3359662,3361160..3361249,
FT                   3361517..3361759)
FT                   /locus_tag="mCG_117539"
FT                   /product="mCG117539"
FT                   /note="gene_id=mCG117539.1 transcript_id=mCT118680.1
FT                   created on 12-JUL-2002"
FT   CDS             join(3358857..3358859,3359498..3359662,3361160..3361249,
FT                   3361517..3361567)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117539"
FT                   /product="mCG117539"
FT                   /note="gene_id=mCG117539.1 transcript_id=mCT118680.1
FT                   protein_id=mCP74437.1"
FT                   /db_xref="GOA:Q4KL76"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="MGI:MGI:104680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KL76"
FT                   /protein_id="EDL00019.1"
FT                   /translation="MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQAT
FT                   VVAVGSGGKGKSGEIEPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDSDILGKYVD"
FT   assembly_gap    3367847..3367943
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    3374162..3374204
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    3379788..3379950
FT                   /estimated_length=163
FT                   /gap_type="unknown"
FT   assembly_gap    3385463..3385662
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    3390580..3390662
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   gene            complement(3390663..3391373)
FT                   /pseudo
FT                   /locus_tag="mCG_117545"
FT                   /note="gene_id=mCG117545.1"
FT   mRNA            complement(join(3390663..3391131,3391246..3391373))
FT                   /pseudo
FT                   /locus_tag="mCG_117545"
FT                   /note="gene_id=mCG117545.1 transcript_id=mCT118689.0
FT                   created on 23-SEP-2002"
FT   assembly_gap    3393945..3393964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3401844..3425403
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /note="gene_id=mCG117540.2"
FT   mRNA            join(<3401844..3401943,3407190..3407252,3415637..3415737,
FT                   3418832..3418874,3419061..3419147,3420659..3421595,
FT                   3423180..3425403)
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, transcript variant
FT                   mCT189318"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT189318.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3401845..3401943,3407190..3407252,3415637..3415737,
FT                   3418832..3418874,3419061..3419147,3420659..3420742)
FT                   /codon_start=1
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT189318.0
FT                   protein_id=mCP110302.0 isoform=CRA_b"
FT                   /protein_id="EDL00021.1"
FT                   /translation="HPGTDASRPDSGTMVMAEGTAVLRRNRPGTKAQDFYNWPDESFDE
FT                   MDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSE
FT                   CHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR"
FT   mRNA            join(3401846..3401943,3407190..3407252,3415637..3415737,
FT                   3418832..3418874,3419061..3419147,3420659..3420738,
FT                   3421484..3421595,3423180..3425402)
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, transcript variant
FT                   mCT118681"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT118681.1
FT                   created on 12-JUL-2002"
FT   mRNA            join(3401846..3401943,3407190..3407252,3415637..3415737,
FT                   3419061..3419147,3420659..3420738,3421484..3421595,
FT                   3423180..3425402)
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, transcript variant
FT                   mCT170542"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT170542.0
FT                   created on 12-JUL-2002"
FT   CDS             join(3401884..3401943,3407190..3407252,3415637..3415737,
FT                   3418832..3418874,3419061..3419147,3420659..3420738,
FT                   3421484..3421595,3423180..3423311)
FT                   /codon_start=1
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT118681.1
FT                   protein_id=mCP74441.1 isoform=CRA_c"
FT                   /protein_id="EDL00022.1"
FT                   /translation="MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQ
FT                   NIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATE
FT                   QWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRI
FT                   YRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGE
FT                   SEA"
FT   CDS             join(3401884..3401943,3407190..3407252,3415637..3415737,
FT                   3419061..3419094)
FT                   /codon_start=1
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, isoform CRA_d"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT170542.0
FT                   protein_id=mCP93460.0 isoform=CRA_d"
FT                   /protein_id="EDL00023.1"
FT                   /translation="MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQ
FT                   NIRADCSNIDKILEPPEGQDEGVWKYEHLRVNAIQIPVLR"
FT   mRNA            join(<3401900..3401943,3415637..3415737,3418832..3418874,
FT                   3419061..3419147,3420659..3420738,3421484..3421595,
FT                   3423180..>3423263)
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, transcript variant
FT                   mCT189317"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT189317.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3401902..3401943,3415637..3415737,3418832..3418874,
FT                   3419061..3419147,3420659..3420738,3421484..3421595,
FT                   3423180..>3423263)
FT                   /codon_start=1
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT189317.0
FT                   protein_id=mCP110301.0 isoform=CRA_a"
FT                   /protein_id="EDL00020.1"
FT                   /translation="TAVLRRNRPGTKAQYIQQNIRADCSNIDKILEPPEGQDEGVWKYE
FT                   HLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDG
FT                   AACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHR
FT                   FTKFVMKYNLMSKDNLIVPI"
FT   assembly_gap    3405290..3405625
FT                   /estimated_length=336
FT                   /gap_type="unknown"
FT   assembly_gap    3422019..3422038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(3431148..3431567)
FT                   /locus_tag="mCG_117537"
FT                   /note="gene_id=mCG117537.1"
FT   mRNA            complement(3431148..3431567)
FT                   /locus_tag="mCG_117537"
FT                   /product="mCG117537"
FT                   /note="gene_id=mCG117537.1 transcript_id=mCT118678.0
FT                   created on 14-AUG-2002"
FT   CDS             complement(3431245..3431556)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117537"
FT                   /product="mCG117537"
FT                   /note="gene_id=mCG117537.1 transcript_id=mCT118678.0
FT                   protein_id=mCP74435.1"
FT                   /protein_id="EDL00024.1"
FT                   /translation="MAKLIRNFAETAPSMVAAAVTYSKPRLATFWHYAKVELVPSTPGE
FT                   IPTAIQSVKKIIQSAKTGSFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYEV"
FT   gene            complement(3440669..3497309)
FT                   /locus_tag="mCG_117547"
FT                   /note="gene_id=mCG117547.1"
FT   mRNA            complement(join(3440669..3442587,3455454..3455532,
FT                   3464879..3464982,3466151..3466272,3474834..3475043,
FT                   3476987..3477266,3481801..3481912,3484647..3484830,
FT                   3496649..3497308))
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, transcript variant mCT118693"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT118693.1
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(3440669..3442587,3455454..3455532,
FT                   3464879..3464982,3466151..3466272,3471996..3472073,
FT                   3474834..3475043,3476987..3477266,3496649..3497305))
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, transcript variant mCT172706"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172706.0
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(3440669..3442587,3464938..3464982,
FT                   3466151..3466272,3474834..3475043,3476987..3477266,
FT                   3481801..3481912,3484647..3484830,3496649..3497305))
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, transcript variant mCT172707"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172707.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3442315..3442587,3464938..3464982,
FT                   3466151..3466272,3474834..3475043,3476987..3477266,
FT                   3481801..3481912,3484647..3484830,3496649..3496787))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, isoform CRA_c"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172707.0
FT                   protein_id=mCP95627.0 isoform=CRA_c"
FT                   /protein_id="EDL00027.1"
FT                   /translation="MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTL
FT                   QASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSR
FT                   LKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQC
FT                   YLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQ
FT                   TERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDA
FT                   NWLELTTFYYKQGFSLIDSFVCWETPKGDQLPKSLEGFFIYEEEGSGVPGSNRRGNDAI
FT                   VVEQWTVIEGCEIKTDYGPLLHTLRKGSRLLKGEDRNKVSSRSLGLDTNASQAAGGRAP
FT                   LEEGSLSPSRECWTKEERPAQSDSFSGFSSSDSVLRELDDGQFDQEEGVTQVTCM"
FT   CDS             complement(join(3442315..3442587,3455454..3455532,
FT                   3464879..3464982,3466151..3466272,3474834..3475043,
FT                   3476987..3477266,3481801..3481912,3484647..3484830,
FT                   3496649..3496787))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, isoform CRA_d"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT118693.1
FT                   protein_id=mCP74670.1 isoform=CRA_d"
FT                   /protein_id="EDL00028.1"
FT                   /translation="MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTL
FT                   QASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSR
FT                   LKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQC
FT                   YLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQ
FT                   TERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDA
FT                   NWLELTTFYYKQGFSLIDSFVCWETPKGDQLPKSLEGFFIYEEEGSGVPGSNRRGNDAI
FT                   VVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEGNLATKQVVFLQRP
FT                   VTWNSAAQTPERKGSRLLKGEDRNKVSSRSLGLDTNASQAAGGRAPLEEGSLSPSRECW
FT                   TKEERPAQSDSFSGFSSSDSVLRELDDGQFDQEEGVTQVTCM"
FT   CDS             complement(join(3442315..3442587,3455454..3455532,
FT                   3464879..3464982,3466151..3466272,3471996..3472073,
FT                   3474834..3475043,3476987..3477266,3496649..3496681))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, isoform CRA_b"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172706.0
FT                   protein_id=mCP95626.0 isoform=CRA_b"
FT                   /protein_id="EDL00026.1"
FT                   /translation="MNTPCWTLLYKINAAAKRGMKFVGLVSQCYLPSMHCNGASHDGVA
FT                   ESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQTERNSSPSYANPKRGE
FT                   APDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDANWLELTTFYYKQGFSL
FT                   IDSFVCWETPKGLPFDCVWILFLSRYLKKYRRLIKSKGDQLPKSLEGFFIYEEEGSGVP
FT                   GSNRRGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEGNLA
FT                   TKQVVFLQRPVTWNSAAQTPERKGSRLLKGEDRNKVSSRSLGLDTNASQAAGGRAPLEE
FT                   GSLSPSRECWTKEERPAQSDSFSGFSSSDSVLRELDDGQFDQEEGVTQVTCM"
FT   assembly_gap    3457553..3457572
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3469242..3469261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(3472303..3472865,3474834..3475043,
FT                   3476987..3477266,3481801..3481912,3484647..3484830,
FT                   3496649..3497309))
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, transcript variant mCT172705"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172705.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3472756..3472865,3474834..3475043,
FT                   3476987..3477266,3481801..3481912,3484647..3484830,
FT                   3496649..3496787))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, isoform CRA_a"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172705.0
FT                   protein_id=mCP95625.0 isoform=CRA_a"
FT                   /protein_id="EDL00025.1"
FT                   /translation="MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTL
FT                   QASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSR
FT                   LKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQC
FT                   YLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQ
FT                   TERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDA
FT                   NWLELTTFYYKQGFSLIDSFVCWETPKVAKLEAFQLSVSDKLPKGKQKYSFQSLSGIPA
FT                   SGLA"
FT   assembly_gap    3484178..3484197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3497201..3505560
FT                   /locus_tag="mCG_117552"
FT                   /note="gene_id=mCG117552.1"
FT   mRNA            join(3497201..3497278,3499036..3499232,3504913..3505560)
FT                   /locus_tag="mCG_117552"
FT                   /product="mCG117552"
FT                   /note="gene_id=mCG117552.1 transcript_id=mCT118699.0
FT                   created on 23-SEP-2002"
FT   CDS             join(3497255..3497278,3499036..3499232,3504913..3504925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117552"
FT                   /product="mCG117552"
FT                   /note="gene_id=mCG117552.1 transcript_id=mCT118699.0
FT                   protein_id=mCP74696.1"
FT                   /db_xref="MGI:MGI:3648163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UY33"
FT                   /protein_id="EDL00029.1"
FT                   /translation="MRFFLFLLNGLLCCYTVAMESLLVTGTNYGIGELFIKYPLPLSSA
FT                   CHFQVLKKHWIQKMTQQEHMGRYPGWFRGIVS"
FT   assembly_gap    3497692..3497711
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3506095..3506151
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   gene            3507717..3509632
FT                   /gene="Mars2"
FT                   /locus_tag="mCG_117543"
FT                   /note="gene_id=mCG117543.1"
FT   mRNA            3507717..3509632
FT                   /gene="Mars2"
FT                   /locus_tag="mCG_117543"
FT                   /product="methionine-tRNA synthetase 2 (mitochondrial)"
FT                   /note="gene_id=mCG117543.1 transcript_id=mCT118685.1
FT                   created on 23-SEP-2002"
FT   CDS             3507754..3509514
FT                   /codon_start=1
FT                   /gene="Mars2"
FT                   /locus_tag="mCG_117543"
FT                   /product="methionine-tRNA synthetase 2 (mitochondrial)"
FT                   /note="gene_id=mCG117543.1 transcript_id=mCT118685.1
FT                   protein_id=mCP74461.1"
FT                   /db_xref="GOA:A2RT28"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="MGI:MGI:2444136"
FT                   /db_xref="UniProtKB/TrEMBL:A2RT28"
FT                   /protein_id="EDL00030.1"
FT                   /translation="MLRQCARWVLTRTRFGRGCRRYGSCSPSASGDAGEARAYFTTPIF
FT                   YVNAAPHIGHLYSALLADALCRHRRLRVPGSASTRFSTGTDEHGLKIQQAAATAGLAPI
FT                   ELCDRVSAQFLQLFREADISSTDFIRTTEARHRVAVQHFWGVLEARGLLYKGIYEGWYC
FT                   ASDECFLPEAKVTRQVGPSGDPCPVSLESGHPVSWTKEENYIFKLSQFREPLQRWLGNN
FT                   PQAITPEPFHQAVLQWLEEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLT
FT                   VVGYPDADFKSWWPATSHIIGKDILKFHAIYWPALLLGAGLRPPHRIYVHSHWTVSGQK
FT                   MSKSLGNVVDPRTCLDRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGL
FT                   LNRCTAYRINPSGTYPSFCAACFPSEPGLTGPSVRVQAEDYALVTAVATLPKLVAGYYN
FT                   DFQIYKALEAVSSCVRQTNGFVQRHAPWKLNWESPEDAPWLGTVLHVALECLRVFGTLL
FT                   QPVTPNLADKLLSRLGVSTTERGLGELYFLPRFYGHPCPFEGRKLGPDTGLLFPRLDQS
FT                   RTRLVKAHRT"
FT   assembly_gap    3534356..3534384
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   gene            complement(<3570583..>3633973)
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /note="gene_id=mCG117546.1"
FT   mRNA            complement(join(<3570583..3570699,3575012..3575140,
FT                   3576190..3576237,3594164..3594235,3610990..3611117,
FT                   3616880..3616955,3619384..3619438,3626151..3626242,
FT                   3631119..3631262,3633802..>3633973))
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /product="bol, boule-like (Drosophila), transcript variant
FT                   mCT118691"
FT                   /note="gene_id=mCG117546.1 transcript_id=mCT118691.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3570583..3570699,3575012..3575140,
FT                   3576190..3576237,3594164..3594235,3610990..3611117,
FT                   3616880..3616955,3619384..3619438,3626151..3626242,
FT                   3631119..3631262,3633802..>3633972))
FT                   /codon_start=1
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /product="bol, boule-like (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG117546.1 transcript_id=mCT118691.1
FT                   protein_id=mCP74649.1 isoform=CRA_b"
FT                   /protein_id="EDL00032.1"
FT                   /translation="RAARPARRLRHCSRRRRRQGERVPDGRRAGSLPANAPSNLSFPRT
FT                   PEIRKMETESRAQSTNQTQTDSLSPSPNPVSPVPLNNPTSGPRYGTVIPNRIFVGGIDF
FT                   KTNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQEDAQKILQEAEKLNYKDK
FT                   KLNIGPAIRKQQVGIPRSSLMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPSWP
FT                   SRSISSSPVMVAQPVYQQPAYHYQAPAQCLPGQWQWGVPQSPASSAPFLYLQPSEVIYQ
FT                   PVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQAAYHQVYASSAIAMPAPMMQPEPIKVR
FT                   SLF"
FT   mRNA            complement(join(<3570583..3570699,3575012..3575140,
FT                   3576190..3576237,3594164..3594235,3610990..3611117,
FT                   3616880..3616955,3619384..3619438,3626151..3626242,
FT                   3631119..3631262,3632985..>3633211))
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /product="bol, boule-like (Drosophila), transcript variant
FT                   mCT172708"
FT                   /note="gene_id=mCG117546.1 transcript_id=mCT172708.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3570583..3570699,3575012..3575140,
FT                   3576190..3576237,3594164..3594235,3610990..3611117,
FT                   3616880..3616955,3619384..3619438,3626151..3626242,
FT                   3631119..3631262,3632985..>3633200))
FT                   /codon_start=1
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /product="bol, boule-like (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG117546.1 transcript_id=mCT172708.0
FT                   protein_id=mCP95624.0 isoform=CRA_a"
FT                   /protein_id="EDL00031.1"
FT                   /translation="PPLLAGLPDKISRWLAFFSLPHFGGEGGDPRVGVPVHDDPREPED
FT                   VVNPAICPIASACWPPRGRSTEAVTATQSTNQTQTDSLSPSPNPVSPVPLNNPTSGPRY
FT                   GTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQEDA
FT                   QKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSLMPAAGTMYLTTSTGYPYTYHNGVA
FT                   YFHTPEVTSVPPSWPSRSISSSPVMVAQPVYQQPAYHYQAPAQCLPGQWQWGVPQSPAS
FT                   SAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQAAYHQVYASSAI
FT                   AMPAPMMQPEPIKVRSLF"
FT   gene            3605920..3606313
FT                   /pseudo
FT                   /locus_tag="mCG_117538"
FT                   /note="gene_id=mCG117538.1"
FT   mRNA            3605920..3606313
FT                   /pseudo
FT                   /locus_tag="mCG_117538"
FT                   /note="gene_id=mCG117538.1 transcript_id=mCT118679.0
FT                   created on 12-JUL-2002"
FT   assembly_gap    3616433..3616452
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3634140..3634767
FT                   /estimated_length=628
FT                   /gap_type="unknown"
FT   assembly_gap    3637232..3638800
FT                   /estimated_length=1569
FT                   /gap_type="unknown"
FT   assembly_gap    3652321..3652457
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   gene            3676955..4022550
FT                   /locus_tag="mCG_113459"
FT                   /note="gene_id=mCG113459.1"
FT   mRNA            join(3676955..3677322,3965150..3967629,3971340..3971543,
FT                   3983022..3983097,3985095..3985204,4020885..4022550)
FT                   /locus_tag="mCG_113459"
FT                   /product="mCG113459"
FT                   /note="gene_id=mCG113459.1 transcript_id=mCT114543.1
FT                   created on 23-SEP-2002"
FT   assembly_gap    3679546..3679565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3691237..3693154
FT                   /locus_tag="mCG_141415"
FT                   /note="gene_id=mCG141415.1"
FT   mRNA            3691237..3693154
FT                   /locus_tag="mCG_141415"
FT                   /product="mCG141415"
FT                   /note="gene_id=mCG141415.1 transcript_id=mCT175131.1
FT                   created on 05-MAY-2003"
FT   CDS             3692522..3692725
FT                   /codon_start=1
FT                   /locus_tag="mCG_141415"
FT                   /product="mCG141415"
FT                   /note="gene_id=mCG141415.1 transcript_id=mCT175131.1
FT                   protein_id=mCP98050.1"
FT                   /protein_id="EDL00034.1"
FT                   /translation="MGWSSNWASYWLAIPSVSAPSLIPAFIVDRINFGLKVLWVGWCSY
FT                   CPTVVPAWLQELASSGSISPVL"
FT   assembly_gap    3695675..3695694
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3707102..3707121
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3709902..3710211
FT                   /estimated_length=310
FT                   /gap_type="unknown"
FT   assembly_gap    3713506..3713558
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   gene            complement(3714132..3715485)
FT                   /locus_tag="mCG_117541"
FT                   /note="gene_id=mCG117541.1"
FT   mRNA            complement(3714132..3715485)
FT                   /locus_tag="mCG_117541"
FT                   /product="mCG117541"
FT                   /note="gene_id=mCG117541.1 transcript_id=mCT118682.1
FT                   created on 12-JUL-2002"
FT   CDS             complement(3714493..3715443)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117541"
FT                   /product="mCG117541"
FT                   /note="gene_id=mCG117541.1 transcript_id=mCT118682.1
FT                   protein_id=mCP74449.1"
FT                   /protein_id="EDL00035.1"
FT                   /translation="MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDC
FT                   AQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDY
FT                   LDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFN
FT                   PLQIERILNKPGLKYRPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDRPWAK
FT                   PEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEL
FT                   SSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV"
FT   assembly_gap    3717182..3717675
FT                   /estimated_length=494
FT                   /gap_type="unknown"
FT   assembly_gap    3719923..3719942
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3735209..3737154
FT                   /estimated_length=1946
FT                   /gap_type="unknown"
FT   assembly_gap    3740283..3742490
FT                   /estimated_length=2208
FT                   /gap_type="unknown"
FT   assembly_gap    3746608..3749372
FT                   /estimated_length=2765
FT                   /gap_type="unknown"
FT   assembly_gap    3758286..3758305
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3834690..3834752
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    3851971..3851990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3854285..3854804
FT                   /estimated_length=520
FT                   /gap_type="unknown"
FT   assembly_gap    3872239..3872408
FT                   /estimated_length=170
FT                   /gap_type="unknown"
FT   assembly_gap    3880248..3880584
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    3885677..3886230
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    3900303..3900367
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(3912617..3915331)
FT                   /locus_tag="mCG_146956"
FT                   /note="gene_id=mCG146956.0"
FT   mRNA            complement(join(3912617..3914038,3914304..3915331))
FT                   /locus_tag="mCG_146956"
FT                   /product="mCG146956"
FT                   /note="gene_id=mCG146956.0 transcript_id=mCT187219.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(3913978..3914038,3914304..3914509))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146956"
FT                   /product="mCG146956"
FT                   /note="gene_id=mCG146956.0 transcript_id=mCT187219.0
FT                   protein_id=mCP109555.0"
FT                   /protein_id="EDL00036.1"
FT                   /translation="MEKPCLGEKKKRQTQFYSVFLDNLLPKTQGILKIFLIRYFPHLHF
FT                   QCYPKSPPYPPPTPLPYLPTPTFWPWHSLTRDSYIRSFNLNGD"
FT   assembly_gap    3933996..3934281
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    3948220..3948239
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3955523..3955621
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   CDS             join(3965209..3967629,3971340..3971543,3983022..3983097,
FT                   3985095..3985204,4020885..4021067)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113459"
FT                   /product="mCG113459"
FT                   /note="gene_id=mCG113459.1 transcript_id=mCT114543.1
FT                   protein_id=mCP74443.1"
FT                   /protein_id="EDL00033.1"
FT                   /translation="MPSEKKISSAHDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQA
FT                   LRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLD
FT                   LVANSADVANIWVSGLRYLVSRSKQPLDFIEGNQNTPRFMWLKTVFEAADVDGNGIMLE
FT                   DTSVELIKQLNPTLKESKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLL
FT                   VQISKNKEYLDANDLMLFLEAEQGVTHITEDMCLDIIRRYELSEDGRQKGFLAIDGFTQ
FT                   YLLSPECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIEDQFRGPADINGYVRALKMG
FT                   CRSIELDVSDGPDNEPILCNRNNMAMHLSFRSVLEVINKFAFVASEYPLILCLGNHCSL
FT                   PQQKVMAQQMKKVFGEKLYTEAPLSSESYLPSPEKLKNMIIVKGKKLPSESDLLEGEVT
FT                   DEDEEAEMSRRMSGDYNGEQKHIWLCRELSDLVSICKSVQHRDFELSMKTQNYWEMCSF
FT                   SETEASRIANEYPEDFVNYNKKFLSRVYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTP
FT                   GPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGIVPGVSPLVLHIKIISGQNF
FT                   PKPKGACAKGDVIDPYVCVEIHGIPADCCEQRTKTVQQNSDNPIFDETFEFQVNLPELT
FT                   MVRFVILDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRS
FT                   GGGKPQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVS
FT                   VKELCGLPPIASLKQCLLTLSSRLITSDSTPSVSLVMKDCFPYLEPLGAIPDVQKRMLA
FT                   AYDLMIQESRVLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKAIESFA
FT                   WNITVLKGQGDLLKNAKNEAVENIKQIQLACLSCGLSKGPGGGSEAKGKRSLEAIEEKE
FT                   SSEENGKL"
FT   assembly_gap    3977009..3977273
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    3979238..3979257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4046420..4048601
FT                   /estimated_length=2182
FT                   /gap_type="unknown"
FT   assembly_gap    4050010..4051049
FT                   /estimated_length=1040
FT                   /gap_type="unknown"
FT   assembly_gap    4052484..4052733
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    4092262..4092281
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4120151..4120170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4126778..4126797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4128144..4128238
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    4152303..4152386
FT                   /estimated_length=84
FT                   /gap_type="unknown"
FT   gene            <4159432..4183162
FT                   /locus_tag="mCG_144504"
FT                   /note="gene_id=mCG144504.0"
FT   mRNA            join(<4159432..4159745,4168658..4169077,4182277..4183162)
FT                   /locus_tag="mCG_144504"
FT                   /product="mCG144504"
FT                   /note="gene_id=mCG144504.0 transcript_id=mCT183928.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    4160456..4160475
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4164264..4164283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <4182441..4182737
FT                   /codon_start=1
FT                   /locus_tag="mCG_144504"
FT                   /product="mCG144504"
FT                   /note="gene_id=mCG144504.0 transcript_id=mCT183928.0
FT                   protein_id=mCP106111.0"
FT                   /protein_id="EDL00037.1"
FT                   /translation="NCYRKIIRGLKYTQFIFPPSICKNLMAFLTSRWLEICFILKRKLL
FT                   RIIKMIRSEWIRILNLQRFPECVRRLPKYHTIVCAYLLCYKKLLASKYQQVGL"
FT   assembly_gap    4193671..4194564
FT                   /estimated_length=894
FT                   /gap_type="unknown"
FT   gene            4198470..4239389
FT                   /locus_tag="mCG_145723"
FT                   /note="gene_id=mCG145723.0"
FT   mRNA            join(4198470..4198571,4201515..4201649,4223897..4224006,
FT                   4224707..4225068,4228041..4228218,4238141..4239389)
FT                   /locus_tag="mCG_145723"
FT                   /product="mCG145723, transcript variant mCT175132"
FT                   /note="gene_id=mCG145723.0 transcript_id=mCT175132.1
FT                   created on 09-JUL-2003"
FT   assembly_gap    4215584..4215670
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   mRNA            join(4227965..4228218,4237576..4237713,4238141..4239389)
FT                   /locus_tag="mCG_145723"
FT                   /product="mCG145723, transcript variant mCT186563"
FT                   /note="gene_id=mCG145723.0 transcript_id=mCT186563.0
FT                   created on 09-JUL-2003"
FT   CDS             join(4228207..4228218,4237576..4237713,4238141..4238350)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145723"
FT                   /product="mCG145723, isoform CRA_b"
FT                   /note="gene_id=mCG145723.0 transcript_id=mCT186563.0
FT                   protein_id=mCP107267.0 isoform=CRA_b"
FT                   /protein_id="EDL00039.1"
FT                   /translation="MCCGKILLKTHNLTVAVAVRLSLMIFGTGFDLSEMVHVALTLSGK
FT                   EKRNKIFCISSNSTTNHEAFPEAILSTPAFLAHNTPTEEICSPFQIYCPCVNSLSGMLL
FT                   SLLRVVSASQGTTSV"
FT   CDS             join(4228207..4228218,4238141..4238350)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145723"
FT                   /product="mCG145723, isoform CRA_a"
FT                   /note="gene_id=mCG145723.0 transcript_id=mCT175132.1
FT                   protein_id=mCP98051.1 isoform=CRA_a"
FT                   /protein_id="EDL00038.1"
FT                   /translation="MCCGIFCISSNSTTNHEAFPEAILSTPAFLAHNTPTEEICSPFQI
FT                   YCPCVNSLSGMLLSLLRVVSASQGTTSV"
FT   assembly_gap    4247997..4248213
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   gene            4285853..4287079
FT                   /locus_tag="mCG_1035631"
FT                   /note="gene_id=mCG1035631.1"
FT   mRNA            join(4285853..4285929,4286732..4287079)
FT                   /locus_tag="mCG_1035631"
FT                   /product="mCG1035631"
FT                   /note="gene_id=mCG1035631.1 transcript_id=mCT153335.1
FT                   created on 05-SEP-2002"
FT   CDS             4286812..4286994
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035631"
FT                   /product="mCG1035631"
FT                   /note="gene_id=mCG1035631.1 transcript_id=mCT153335.1
FT                   protein_id=mCP74687.1"
FT                   /protein_id="EDL00040.1"
FT                   /translation="MPTALPSGFLLCTRRLPSAHTPAPSSVLCLHIKHEELASMAPENK
FT                   LRFNQLDTCFYYGNL"
FT   assembly_gap    4294412..4294607
FT                   /estimated_length=196
FT                   /gap_type="unknown"
FT   assembly_gap    4313978..4313997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4342411..4342506
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    4359336..4364617
FT                   /estimated_length=5282
FT                   /gap_type="unknown"
FT   assembly_gap    4374988..4375007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4377166..4377305
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    4405092..4406804
FT                   /estimated_length=1713
FT                   /gap_type="unknown"
FT   assembly_gap    4419646..4419832
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    4473295..4473314
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4478718..4478737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4496447..4496486
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    4540154..4540817
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    4546002..4547810
FT                   /estimated_length=1809
FT                   /gap_type="unknown"
FT   assembly_gap    4571098..4571117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4604885..>4733283
FT                   /locus_tag="mCG_1035540"
FT                   /note="gene_id=mCG1035540.1"
FT   mRNA            join(<4604885..4604952,4662787..4662847,4663579..4663657,
FT                   4677688..4677830,4702184..4702276,4716482..4716528,
FT                   4716727..4716784,4733185..>4733283)
FT                   /locus_tag="mCG_1035540"
FT                   /product="mCG1035540"
FT                   /note="gene_id=mCG1035540.1 transcript_id=mCT153244.0
FT                   created on 31-OCT-2002"
FT   CDS             join(4604885..4604952,4662787..4662847,4663579..4663657,
FT                   4677688..4677830,4702184..4702276,4716482..4716528,
FT                   4716727..4716784,4733185..4733283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035540"
FT                   /product="mCG1035540"
FT                   /note="gene_id=mCG1035540.1 transcript_id=mCT153244.0
FT                   protein_id=mCP74717.0"
FT                   /protein_id="EDL00041.1"
FT                   /translation="MEPGHQGFGQTSEINMTQEEDRRNYEKLNVNITALGMNPEPATEY
FT                   EKLSRKILHVREDKAFLHRLILQAGKLAQAHFEDSIECVCSFLCTCDINGSSAGTCPIV
FT                   TQRPLYEAKVHSKQLHEYSDEVDLKAMRSSHCILMAVLQVTESKTTITGKQPFSFKMYH
FT                   NHLPVTRQNDEHKGKEERHPIDSYKVCQGPWKPSILSLCQESSQSNRAMPNN"
FT   assembly_gap    4647562..4651490
FT                   /estimated_length=3929
FT                   /gap_type="unknown"
FT   assembly_gap    4697783..4697911
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    4737005..4737024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4766835..4766854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4775911..4775930
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4797872..4799333
FT                   /estimated_length=1462
FT                   /gap_type="unknown"
FT   assembly_gap    4804053..4804072
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4835597..4835690
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    4845543..4845652
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    4855452..4855471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4873896..4873915
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4901360..4902743)
FT                   /gene="Hsfy2"
FT                   /locus_tag="mCG_1035541"
FT                   /note="gene_id=mCG1035541.1"
FT   mRNA            complement(4901360..4902743)
FT                   /gene="Hsfy2"
FT                   /locus_tag="mCG_1035541"
FT                   /product="heat shock transcription factor, Y linked 2"
FT                   /note="gene_id=mCG1035541.1 transcript_id=mCT153245.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(4901505..4902362)
FT                   /codon_start=1
FT                   /gene="Hsfy2"
FT                   /locus_tag="mCG_1035541"
FT                   /product="heat shock transcription factor, Y linked 2"
FT                   /note="gene_id=mCG1035541.1 transcript_id=mCT153245.1
FT                   protein_id=mCP74726.1"
FT                   /protein_id="EDL00042.1"
FT                   /translation="MKSSSRKEVLERKAPFRIFETDSMKSLVRQLNLYGFRKMRQNFQR
FT                   SASLPDFLAEEKGISASCKLQFYQNPNFLRDCPHLIERMKRRIGIKTVSRGAAPSLPDF
FT                   KNKHFRPDLVKMDDHSLGVAVQTSERNLLSSSSISNVYLRQKPSLAQGGSDTMDVIRSD
FT                   FSLATPSSFRPPEEILTHRPAPLNEVSSLCMDSQRIFTQANDSTVNFIITSITQNRGDM
FT                   SHLWNSCIEMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSNH
FT                   HSSS"
FT   assembly_gap    4903215..4903234
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4913084..4913161
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    4938226..4938245
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4944869..4944888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4975876..4975937
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    4980937..4986800
FT                   /estimated_length=5864
FT                   /gap_type="unknown"
FT   assembly_gap    5019460..5019479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5025872..5026171
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    5029742..5030052
FT                   /estimated_length=311
FT                   /gap_type="unknown"
FT   assembly_gap    5038934..5039284
FT                   /estimated_length=351
FT                   /gap_type="unknown"
FT   assembly_gap    5051811..5052089
FT                   /estimated_length=279
FT                   /gap_type="unknown"
FT   gene            complement(5062059..5237279)
FT                   /gene="Satb2"
FT                   /locus_tag="mCG_113907"
FT                   /note="gene_id=mCG113907.1"
FT   mRNA            complement(join(5062059..5063036,5097411..5097608,
FT                   5111682..5111837,5116277..5116489,5137365..5137837,
FT                   5157160..5157262,5163823..5163946,5164868..5164994,
FT                   5214023..5214199,5235598..5235825,5237057..5237279))
FT                   /gene="Satb2"
FT                   /locus_tag="mCG_113907"
FT                   /product="special AT-rich sequence binding protein 2"
FT                   /note="gene_id=mCG113907.1 transcript_id=mCT114996.1
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(5062575..5063036,5097411..5097608,
FT                   5111682..5111837,5116277..5116489,5137365..5137837,
FT                   5157160..5157262,5163823..5163946,5164868..5164994,
FT                   5214023..5214199,5235598..5235766))
FT                   /codon_start=1
FT                   /gene="Satb2"
FT                   /locus_tag="mCG_113907"
FT                   /product="special AT-rich sequence binding protein 2"
FT                   /note="gene_id=mCG113907.1 transcript_id=mCT114996.1
FT                   protein_id=mCP74488.1"
FT                   /db_xref="GOA:Q546B3"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003350"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR032355"
FT                   /db_xref="InterPro:IPR032392"
FT                   /db_xref="MGI:MGI:2679336"
FT                   /db_xref="UniProtKB/TrEMBL:Q546B3"
FT                   /protein_id="EDL00043.1"
FT                   /translation="MERRSESPCLRDSPDRRSGSPDVKGPPPVKVARLEQNGSPMGARG
FT                   RPNGAVAKAVGGLMIPVFCVVEQLDGSLEYDNREEHAEFVLVRKDVLFSQLVETALLAL
FT                   GYSHSSAAQAQGIIKLGRWNPLPLSYVTDAPDATVADMLQDVYHVVTLKIQLQSCSKLE
FT                   DLPAEQWNHATVRNALKELLKEMNQSTLAKECPLSQSMISSIVNSTYYANVSATKCQEF
FT                   GRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTP
FT                   IRNQVPALQPIMSPGLLSPQLSPQLVRQQIAMAHLINQQIAVSRLLAHQHPQAINQQFL
FT                   NHPPIPRAVKPEPTNSSVEVSPDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILR
FT                   KEEDPRTASQSLLVNLRAMQNFLNLPEVERDRIYQDERERSMNPNVSMVSSASSSPSSS
FT                   RTPQAKTSTPTTDLPIKVDGANVNITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWL
FT                   CELLRWKENPSPENRTLWENLCTIRRFLNLPQHERDVIYEEESRHHHSERMQHVVQLPP
FT                   EPVQVLHRQQSQPTKESSPPREEAPPPPPPTEDSCAKKPRSRTKISLEALGILQSFIHD
FT                   VGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEEL
FT                   LTESEENDSEEGSEEMYKVEAEEENADKSKAAPAETDQR"
FT   assembly_gap    5079080..5079117
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    5092853..5092872
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5097750..5097808
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    5108651..5108670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5135492..5135511
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5158247..5158266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5189444..5189531
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    5237299..5237357
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            <5237465..5315093
FT                   /locus_tag="mCG_141414"
FT                   /note="gene_id=mCG141414.0"
FT   mRNA            join(5237465..5237757,5267392..5267544,5269042..5269178,
FT                   5305346..5305464,5305602..5305772,5314881..5315093)
FT                   /locus_tag="mCG_141414"
FT                   /product="mCG141414, transcript variant mCT175130"
FT                   /note="gene_id=mCG141414.0 transcript_id=mCT175130.0
FT                   created on 25-MAR-2003"
FT   mRNA            join(<5237465..5237757,5267392..5267544,5269042..5269178,
FT                   5305346..5305464,5305602..5307528)
FT                   /locus_tag="mCG_141414"
FT                   /product="mCG141414, transcript variant mCT189307"
FT                   /note="gene_id=mCG141414.0 transcript_id=mCT189307.0
FT                   created on 08-MAR-2004"
FT   assembly_gap    5237985..5238055
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    5242034..5242088
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    5247496..5248030
FT                   /estimated_length=535
FT                   /gap_type="unknown"
FT   assembly_gap    5253804..5254179
FT                   /estimated_length=376
FT                   /gap_type="unknown"
FT   CDS             join(<5267398..5267544,5269042..5269178,5305346..5305439)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141414"
FT                   /product="mCG141414, isoform CRA_b"
FT                   /note="gene_id=mCG141414.0 transcript_id=mCT189307.0
FT                   protein_id=mCP110306.0 isoform=CRA_b"
FT                   /protein_id="EDL00045.1"
FT                   /translation="ALRSQKLKSTLSSCCLTIYMENSQLLLHHVCLHAATLLDTMTMDY
FT                   TSETAVKHQSLENGSETVKLPLTSPLPMPCRTSKDGLDAWKMPIHSRPVCWQMVLPQPD
FT                   SNRTVSVRPFLSEIYQEKQTH"
FT   CDS             join(5267455..5267544,5269042..5269178,5305346..5305439)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141414"
FT                   /product="mCG141414, isoform CRA_a"
FT                   /note="gene_id=mCG141414.0 transcript_id=mCT175130.0
FT                   protein_id=mCP98049.0 isoform=CRA_a"
FT                   /protein_id="EDL00044.1"
FT                   /translation="MENSQLLLHHVCLHAATLLDTMTMDYTSETAVKHQSLENGSETVK
FT                   LPLTSPLPMPCRTSKDGLDAWKMPIHSRPVCWQMVLPQPDSNRTVSVRPFLSEIYQEKQ
FT                   TH"
FT   assembly_gap    5279089..5279108
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5300199..5300255
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    5315826..5315846
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    5329171..5334112
FT                   /estimated_length=4942
FT                   /gap_type="unknown"
FT   assembly_gap    5339590..5339610
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    5341759..5341778
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5351910..5352114
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    5373987..5374785
FT                   /estimated_length=799
FT                   /gap_type="unknown"
FT   assembly_gap    5403435..5403454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5408528..5408799
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    5434573..5434613
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    5457271..5457290
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5465279..5479296)
FT                   /locus_tag="mCG_146961"
FT                   /note="gene_id=mCG146961.0"
FT   mRNA            complement(join(5465279..5467480,5469162..5469228,
FT                   5471013..5471202,5473103..5473342,5476709..5476942,
FT                   5478016..5478199,5479123..5479296))
FT                   /locus_tag="mCG_146961"
FT                   /product="mCG146961"
FT                   /note="gene_id=mCG146961.0 transcript_id=mCT187224.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(5467325..5467480,5469162..5469228,
FT                   5471013..5471152))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146961"
FT                   /product="mCG146961"
FT                   /note="gene_id=mCG146961.0 transcript_id=mCT187224.0
FT                   protein_id=mCP109560.0"
FT                   /protein_id="EDL00046.1"
FT                   /translation="MVSHSRGSLCCKEQVLDDLGIWSNGHLMTCANVSCRQQPCLPAAW
FT                   SDSCAVSQTSFRAKGFKALRFWTQGGILLQMREHPRPWWTLAMKAAACSTCLLGNNNST
FT                   RANVLFGEAMIVPLTS"
FT   assembly_gap    5469234..5469253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5487858..5488012
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    5490470..5490489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5515714..5515957
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    5531165..5531184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5543598..5543617
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5555871..5556804)
FT                   /pseudo
FT                   /locus_tag="mCG_1035543"
FT                   /note="gene_id=mCG1035543.1"
FT   mRNA            complement(5555871..5556804)
FT                   /pseudo
FT                   /locus_tag="mCG_1035543"
FT                   /note="gene_id=mCG1035543.1 transcript_id=mCT153247.1
FT                   created on 01-NOV-2002"
FT   assembly_gap    5581418..5582029
FT                   /estimated_length=612
FT                   /gap_type="unknown"
FT   assembly_gap    5598897..5599356
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   gene            complement(5625182..>5642377)
FT                   /locus_tag="mCG_1035637"
FT                   /note="gene_id=mCG1035637.1"
FT   mRNA            complement(join(5625182..5625494,5627397..5627594,
FT                   5640081..5640352,5642238..>5642377))
FT                   /locus_tag="mCG_1035637"
FT                   /product="mCG1035637"
FT                   /note="gene_id=mCG1035637.1 transcript_id=mCT153341.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(5625200..>5625406)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035637"
FT                   /product="mCG1035637"
FT                   /note="gene_id=mCG1035637.1 transcript_id=mCT153341.0
FT                   protein_id=mCP74708.0"
FT                   /protein_id="EDL00047.1"
FT                   /translation="VTDGKTEIRVTCKTNKTVNGNGLNMNLHSSFYQQNGQGLNNLSEP
FT                   QFPHNESHHSICFVSNKTHNLKQ"
FT   gene            5642504..5650250
FT                   /locus_tag="mCG_113905"
FT                   /note="gene_id=mCG113905.1"
FT   mRNA            join(5642504..5642779,5647576..5650250)
FT                   /locus_tag="mCG_113905"
FT                   /product="mCG113905"
FT                   /note="gene_id=mCG113905.1 transcript_id=mCT114994.0
FT                   created on 05-SEP-2002"
FT   CDS             5647591..5648397
FT                   /codon_start=1
FT                   /locus_tag="mCG_113905"
FT                   /product="mCG113905"
FT                   /note="gene_id=mCG113905.1 transcript_id=mCT114994.0
FT                   protein_id=mCP74477.1"
FT                   /protein_id="EDL00048.1"
FT                   /translation="MTRHPENYQWENWSLENIATILARRFPNSYIWVIKCSRMHLHKFS
FT                   CYDNFVKSNMFGAPEHTPDFGAFKHLYMLLVNAFNLTQNGMLFKNRSVWNKDCKASNCE
FT                   SNPSTSNGGQKENERTCEHVDEPSMSFPPLSLDGASFTLIGFSKGCVVLNQLLFELKEA
FT                   KKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLEEFAQTGITVHTHVTPYQVHDP
FT                   MRSWIGKEHKKFVQILRDLGMQVTSQIHFAKETPSIENHFRVHEVF"
FT   gene            complement(5653072..5671842)
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /note="gene_id=mCG113906.1"
FT   mRNA            complement(join(5653072..5653585,5655475..5655591,
FT                   5658183..5658320,5658880..5658924,5661560..5661629,
FT                   5666221..5666356,5671505..5671842))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT114995"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT114995.1
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(5653083..5653585,5655475..5655591,
FT                   5656282..5656369,5658183..5658320,5658880..5658924,
FT                   5661560..5661629,5666221..5666356,5671505..5671795))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT172695"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT172695.0
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(<5653499..5653585,5655475..5655591,
FT                   5656282..5656369,5658183..5658320,5658503..5658527,
FT                   5658880..5658924,5661560..5661629,5666221..5666356,
FT                   5671505..>5671564))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT189312"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT189312.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<5653499..5653585,5655475..5655591,
FT                   5656282..5656369,5658183..5658320,5658503..5658527,
FT                   5658880..5658924,5661560..5661629,5666221..5666356,
FT                   5671505..>5671564))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_c"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT189312.0
FT                   protein_id=mCP110294.0 isoform=CRA_c"
FT                   /db_xref="GOA:G3UW53"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR029612"
FT                   /db_xref="MGI:MGI:1915986"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW53"
FT                   /protein_id="EDL00051.1"
FT                   /translation="PVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQ
FT                   VGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHLEKTQGS
FT                   RKNSFTGKDVADIRQQFPSLGGDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNF
FT                   LIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDV
FT                   LFIPALWFHNVVSEEFGVGVNIFWKHLPSECYD"
FT   mRNA            complement(join(5656280..5656369,5658183..5658320,
FT                   5658418..5658527,5658880..5658924,5661560..5661629,
FT                   5666221..5666356,5671505..>5671595))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT189313"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT189313.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(5658284..5658320,5658880..5658924,
FT                   5661560..5661629,5666221..5666356,5671505..5671582))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_a"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT114995.1
FT                   protein_id=mCP74481.1 isoform=CRA_a"
FT                   /protein_id="EDL00049.1"
FT                   /translation="MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWT
FT                   VDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHL
FT                   EKTQGRMLQTSDSSSHH"
FT   CDS             complement(join(5658284..5658320,5658880..5658924,
FT                   5661560..5661629,5666221..5666356,5671505..5671582))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_a"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT172695.0
FT                   protein_id=mCP95613.0 isoform=CRA_a"
FT                   /protein_id="EDL00053.1"
FT                   /translation="MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWT
FT                   VDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHL
FT                   EKTQGRMLQTSDSSSHH"
FT   mRNA            complement(join(5658458..5658924,5661560..5661629,
FT                   5666221..5666356,5671505..5671842))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT172694"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT172694.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(5658461..5658527,5658880..5658924,
FT                   5661560..5661629,5666221..5666356,5671505..>5671594))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_d"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT189313.0
FT                   protein_id=mCP110295.0 isoform=CRA_d"
FT                   /protein_id="EDL00052.1"
FT                   /translation="VNFTMAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCT
FT                   SKWTVDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTT
FT                   YGHLEKTQGSRKNSFTGKVGCCCWAFPIIGL"
FT   CDS             complement(join(5658876..5658924,5661560..5661629,
FT                   5666221..5666356,5671505..5671582))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_b"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT172694.0
FT                   protein_id=mCP95614.0 isoform=CRA_b"
FT                   /protein_id="EDL00050.1"
FT                   /translation="MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWT
FT                   VDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHL
FT                   EKTQGR"
FT   assembly_gap    5669248..5669267
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5671665..5681082
FT                   /locus_tag="mCG_113908"
FT                   /note="gene_id=mCG113908.1"
FT   mRNA            join(<5671665..5672343,5675033..5675104,5676846..5676972,
FT                   5678363..5678510,5680780..5681082)
FT                   /locus_tag="mCG_113908"
FT                   /product="mCG113908"
FT                   /note="gene_id=mCG113908.1 transcript_id=mCT114997.0
FT                   created on 05-SEP-2002"
FT   CDS             join(<5671882..5672343,5675033..5675104,5676846..5676972,
FT                   5678363..5678510,5680780..5680858)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113908"
FT                   /product="mCG113908"
FT                   /note="gene_id=mCG113908.1 transcript_id=mCT114997.0
FT                   protein_id=mCP74495.0"
FT                   /protein_id="EDL00054.1"
FT                   /translation="KVTNMALAARLLPLPLLSRPLPGPVTRLRTLGSTEVRLTLTEICC
FT                   LCRRRLGSSAAPIPRYTRAWTSPALRSWSSRRSLLGRVEHPPALASLPASPSRSYSTEE
FT                   QPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQAFAYVSKLL
FT                   SQCKFDLLEELVAKEVLQILKEKVTSLSDNHKNALAADIDDIVYTSTGDISIYYDEKGR
FT                   KFVNILMCFWYLTSANIPSESLSGANVFQVKLGDQSVETKQLLSASYEFQREFTQGVKP
FT                   DWTIARIEHSKLLE"
FT   assembly_gap    5697663..5699250
FT                   /estimated_length=1588
FT                   /gap_type="unknown"
FT   assembly_gap    5704438..5705666
FT                   /estimated_length=1229
FT                   /gap_type="unknown"
FT   assembly_gap    5707180..5707550
FT                   /estimated_length=371
FT                   /gap_type="unknown"
FT   assembly_gap    5712460..5712546
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    5721311..5722018
FT                   /estimated_length=708
FT                   /gap_type="unknown"
FT   assembly_gap    5723579..5725105
FT                   /estimated_length=1527
FT                   /gap_type="unknown"
FT   assembly_gap    5740491..5740510
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5766056..5766241
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    5767315..5769604
FT                   /estimated_length=2290
FT                   /gap_type="unknown"
FT   assembly_gap    5774893..5774957
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   gene            complement(<5790102..5823358)
FT                   /locus_tag="mCG_1035639"
FT                   /note="gene_id=mCG1035639.1"
FT   mRNA            complement(join(<5790102..5790228,5790945..5791069,
FT                   5799287..5799370,5801764..5801987,5802430..5802629,
FT                   5806097..5806224,5822695..5823358))
FT                   /locus_tag="mCG_1035639"
FT                   /product="mCG1035639"
FT                   /note="gene_id=mCG1035639.1 transcript_id=mCT153343.1
FT                   created on 01-NOV-2002"
FT   CDS             complement(join(5790102..5790228,5790945..5791069,
FT                   5799287..5799370,5801764..5801987,5802430..5802629,
FT                   5806097..5806224))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035639"
FT                   /product="mCG1035639"
FT                   /note="gene_id=mCG1035639.1 transcript_id=mCT153343.1
FT                   protein_id=mCP74724.1"
FT                   /protein_id="EDL00055.1"
FT                   /translation="MDLTGNSVDDRLKDDGNPWHLSSSYLWGHLNLCSHGNESLSLWWM
FT                   NKAIAQRTLRQVSTTGNQKTRECLRNLSLNYTFANCQCAWPSPKCQQLKGDPSIIPFKN
FT                   QAESATRTSLFLWQPAHAKAEADDSGEEKYKEGNEACYSCFSCTNRGNRIVEPRGWSGI
FT                   YEATKSYAHLQRAIMESVLREVILNIFVKRLGLLGVEITSVLCALSACSAYLSSNAYYS
FT                   KVQSSWFPADSGQYFRADLVFTLFESPAEGLRPLGFNLDVPATSTNLTLPMAVFALSSQ
FT                   VLCPSHLSLTSAKS"
FT   assembly_gap    5806862..5807104
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    5869017..5869036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5898437..5898617
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    5906095..5906234
FT                   /estimated_length=140
FT                   /gap_type="unknown"
FT   assembly_gap    5926413..5926432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5970124..5970597
FT                   /estimated_length=474
FT                   /gap_type="unknown"
FT   assembly_gap    5977367..5977386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5996529..5996596
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    5997729..5997748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6038486..6211157
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /note="gene_id=mCG117473.1"
FT   mRNA            join(6038486..6038729,6063547..6063584,6096326..6096426,
FT                   6119592..6119652,6143686..6143794,6146884..6146933,
FT                   6149881..6150127,6164812..6165018,6166267..6166402,
FT                   6187560..6187618,6202108..6202217,6204569..6204671,
FT                   6207217..6207437,6210261..6211156)
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, transcript variant
FT                   mCT118614"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT118614.1
FT                   created on 05-SEP-2002"
FT   mRNA            join(6038982..6039039,6063547..6063596,6096342..6096426,
FT                   6119592..6119652,6143686..6143794,6146884..6146933,
FT                   6149881..6150127,6166267..6166402,6187560..6187618,
FT                   6202108..6202217,6204569..6204671,6207217..6207437,
FT                   6210261..6211156)
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, transcript variant
FT                   mCT172703"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT172703.0
FT                   created on 05-SEP-2002"
FT   assembly_gap    6039112..6039245
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   mRNA            join(<6063545..6063596,6096342..6096426,6119592..6119652,
FT                   6143686..6143794,6146884..6146933,6149881..6150127,
FT                   6164812..6165018,6166267..6166402,6187560..6187618,
FT                   6202108..6202217,6204569..6204671,6207217..6207437,
FT                   6210261..6211157)
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, transcript variant
FT                   mCT189246"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT189246.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<6063545..6063596,6096342..6096426,6119592..6119652,
FT                   6143686..6143794,6146884..6146933,6149881..6150127,
FT                   6164812..6165018,6166267..6166402,6187560..6187618,
FT                   6202108..6202217,6204569..6204671,6207217..6207437,
FT                   6210261..6210656)
FT                   /codon_start=1
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, isoform CRA_c"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT189246.0
FT                   protein_id=mCP110251.0 isoform=CRA_c"
FT                   /protein_id="EDL00058.1"
FT                   /translation="RRLQNPGCFQEHLCGFPGPVVRAASPGLSRCNYMAGTQETGASAS
FT                   KAYTPRRKMAELNTHVNIKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGS
FT                   AIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEVGPLQPQAPLVQNGHMNG
FT                   CEKDSSSPDSTREKLALTPREKKISILEEPPRAQRGVTEGGRLLQQKMSLDGNPRAIHG
FT                   PSERSDGPQWSAGQPCNPSKPKAKTSPVKSNAPAAHLEIKPDELAKKRGPNIEKSVKDL
FT                   QRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEEAMDILT
FT                   ARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCDIEQLKA
FT                   QILICGEITHPKNSYSSRTPCSSLLPLLNTHAVASGKQGNFARKSSGHNKPSEGKAANP
FT                   KMVSGLANTADACHQTMPTNKQQNGPSSQRRRFNPQYHNRLNGPAKSQGGGNEADPMAK
FT                   SNSRHEHRRQPHNGFRPKNKGGAKNQEAPLGTKAPEAPPHSEKARRRQHAADNLEARPF
FT                   RGNVSRVSQCNLCPSRIEVSTEATVLSVPAVTLVA"
FT   assembly_gap    6073743..6073762
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(6096389..6096426,6119592..6119652,6143686..6143794,
FT                   6146884..6146933,6149881..6150127,6166267..6166402,
FT                   6187560..6187618,6202108..6202217,6204569..6204671,
FT                   6207217..6207437,6210261..6210656)
FT                   /codon_start=1
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, isoform CRA_b"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT172703.0
FT                   protein_id=mCP95621.0 isoform=CRA_b"
FT                   /protein_id="EDL00057.1"
FT                   /translation="MAGTQETGASASKAYTPRRKMAELNTHVNIKEKIYAVRSVVPNKS
FT                   NNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDA
FT                   KDKVERPEVGPLQPQAPLVQNGHMNGCEKDSSSPDSTREKLALTPREKKISILEEPPRA
FT                   QRGVTGPNIEKSVKDLQRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSL
FT                   MAEMDKVKEEAMDILTARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEE
FT                   LGKAARFSCDIEQLKAQILICGEITHPKNSYSSRTPCSSLLPLLNTHAVASGKQGNFAR
FT                   KSSGHNKPSEGKAANPKMVSGLANTADACHQTMPTNKQQNGPSSQRRRFNPQYHNRLNG
FT                   PAKSQGGGNEADPMAKSNSRHEHRRQPHNGFRPKNKGGAKNQEAPLGTKAPEAPPHSEK
FT                   ARRRQHAADNLEARPFRGNVSRVSQCNLCPSRIEVSTEATVLSVPAVTLVA"
FT   assembly_gap    6099725..6100008
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   mRNA            join(6109843..6109955,6119592..6119652,6143686..6143794,
FT                   6146884..6146933,6149881..6150127,6164812..6165018,
FT                   6166267..6166402,6187560..6187618,6202108..6202217,
FT                   6204569..6204671,6207217..6207437,6210264..6211157)
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, transcript variant
FT                   mCT172702"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT172702.0
FT                   created on 05-SEP-2002"
FT   CDS             join(6119614..6119652,6143686..6143794,6146884..6146933,
FT                   6149881..6150127,6164812..6165018,6166267..6166402,
FT                   6187560..6187618,6202108..6202217,6204569..6204671,
FT                   6207217..6207437,6210261..6210656)
FT                   /codon_start=1
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, isoform CRA_d"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT118614.1
FT                   protein_id=mCP74446.1 isoform=CRA_d"
FT                   /protein_id="EDL00059.1"
FT                   /translation="MAELNTHVNIKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQ
FT                   AFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEVGPLQPQAPLVQ
FT                   NGHMNGCEKDSSSPDSTREKLALTPREKKISILEEPPRAQRGVTEGGRLLQQKMSLDGN
FT                   PRAIHGPSERSDGPQWSAGQPCNPSKPKAKTSPVKSNAPAAHLEIKPDELAKKRGPNIE
FT                   KSVKDLQRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEE
FT                   AMDILTARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCD
FT                   IEQLKAQILICGEITHPKNSYSSRTPCSSLLPLLNTHAVASGKQGNFARKSSGHNKPSE
FT                   GKAANPKMVSGLANTADACHQTMPTNKQQNGPSSQRRRFNPQYHNRLNGPAKSQGGGNE
FT                   ADPMAKSNSRHEHRRQPHNGFRPKNKGGAKNQEAPLGTKAPEAPPHSEKARRRQHAADN
FT                   LEARPFRGNVSRVSQCNLCPSRIEVSTEATVLSVPAVTLVA"
FT   CDS             join(6119614..6119652,6143686..6143794,6146884..6146933,
FT                   6149881..6150127,6164812..6165018,6166267..6166402,
FT                   6187560..6187618,6202108..6202217,6204569..6204671,
FT                   6207217..6207437,6210264..6210656)
FT                   /codon_start=1
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, isoform CRA_a"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT172702.0
FT                   protein_id=mCP95622.0 isoform=CRA_a"
FT                   /protein_id="EDL00056.1"
FT                   /translation="MAELNTHVNIKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQ
FT                   AFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEVGPLQPQAPLVQ
FT                   NGHMNGCEKDSSSPDSTREKLALTPREKKISILEEPPRAQRGVTEGGRLLQQKMSLDGN
FT                   PRAIHGPSERSDGPQWSAGQPCNPSKPKAKTSPVKSNAPAAHLEIKPDELAKKRGPNIE
FT                   KSVKDLQRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEE
FT                   AMDILTARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCD
FT                   IEQLKAQILICGEITHPKNSYSSRTPCSSLLPLLNTHAVASGKQGNFARKSSGHNKPSE
FT                   GKAANPKMVSGLANTADACHQTMPTNKQNGPSSQRRRFNPQYHNRLNGPAKSQGGGNEA
FT                   DPMAKSNSRHEHRRQPHNGFRPKNKGGAKNQEAPLGTKAPEAPPHSEKARRRQHAADNL
FT                   EARPFRGNVSRVSQCNLCPSRIEVSTEATVLSVPAVTLVA"
FT   assembly_gap    6133396..6133415
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6219453..>6283035)
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /note="gene_id=mCG117471.1"
FT   mRNA            complement(join(6219453..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229522..6229733,
FT                   6231690..6231916,6267031..6267085,6277671..6277744,
FT                   6279703..6283035))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT118612"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT118612.1
FT                   created on 11-APR-2003"
FT   mRNA            complement(join(6219453..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229522..6229733,
FT                   6231690..6231916,6234214..6234249))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT172699"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT172699.0
FT                   created on 11-APR-2003"
FT   mRNA            complement(join(6220265..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229544..6229733,
FT                   6231690..6231916,6267031..6267085,6277671..6277744,
FT                   6279703..>6283035))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT189244"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT189244.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6220521..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229522..6229733,
FT                   6231690..6231882))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_a"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT172699.0
FT                   protein_id=mCP95618.0 isoform=CRA_a"
FT                   /db_xref="GOA:E0CZ26"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="MGI:MGI:3603813"
FT                   /db_xref="UniProtKB/TrEMBL:E0CZ26"
FT                   /protein_id="EDL00060.1"
FT                   /translation="MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFK
FT                   DSMLASMFSGRFPLKTDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEAD
FT                   YFGIPYPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSG
FT                   ASCESRIIGVYATKTDGTDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMM
FT                   DAFDAWEGKGVSYWRVPHELIECWTLEERPLHGSLRHMAPIRKRRLIALREEDEGVNCK
FT                   TGPKPVRFLGPSTSTQIKVKNSASVRVSPANAAQISSQATANRSHRGSCGKAAQCSVAT
FT                   GASGHAPASPDAQSSENQATHPPPAKVLLSEKKSPPPRVIKLRRTPLRGGPSLPTASAG
FT                   GQACFPQPPSLEASSSLGVQMETRKDQPDG"
FT   CDS             complement(join(6220521..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229522..6229733,
FT                   6231690..6231882))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_a"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT118612.1
FT                   protein_id=mCP74859.1 isoform=CRA_a"
FT                   /db_xref="GOA:E0CZ26"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="MGI:MGI:3603813"
FT                   /db_xref="UniProtKB/TrEMBL:E0CZ26"
FT                   /protein_id="EDL00063.1"
FT                   /translation="MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFK
FT                   DSMLASMFSGRFPLKTDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEAD
FT                   YFGIPYPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSG
FT                   ASCESRIIGVYATKTDGTDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMM
FT                   DAFDAWEGKGVSYWRVPHELIECWTLEERPLHGSLRHMAPIRKRRLIALREEDEGVNCK
FT                   TGPKPVRFLGPSTSTQIKVKNSASVRVSPANAAQISSQATANRSHRGSCGKAAQCSVAT
FT                   GASGHAPASPDAQSSENQATHPPPAKVLLSEKKSPPPRVIKLRRTPLRGGPSLPTASAG
FT                   GQACFPQPPSLEASSSLGVQMETRKDQPDG"
FT   CDS             complement(join(6220521..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229544..>6229564))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_c"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT189244.0
FT                   protein_id=mCP110249.0 isoform=CRA_c"
FT                   /protein_id="EDL00062.1"
FT                   /translation="DGDIFFKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGV
FT                   YATKTDGTDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMMDAFDAWEGKG
FT                   VSYWRVPHELIECWTLEERPLHGSLRHMAPIRKRRLIALREEDEGVNCKTGPKPVRFLG
FT                   PSTSTQIKVKNSASVRVSPANAAQISSQATANRSHRGSCGKAAQCSVATGASGHAPASP
FT                   DAQSSENQATHPPPAKVLLSEKKSPPPRVIKLRRTPLRGGPSLPTASAGGQACFPQPPS
FT                   LEASSSLGVQMETRKDQPDG"
FT   mRNA            complement(join(6224247..6226188,6227261..6227454,
FT                   6229522..6229733,6231690..6231916,6234214..6234246))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT181812"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT181812.0
FT                   created on 11-APR-2003"
FT   CDS             complement(join(6226083..6226188,6227261..6227454,
FT                   6229522..6229733,6231690..6231882))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_d"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT181812.0
FT                   protein_id=mCP104734.0 isoform=CRA_d"
FT                   /protein_id="EDL00064.1"
FT                   /translation="MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFK
FT                   DSMLASMFSGRFPLKTDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEAD
FT                   YFGIPYPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSG
FT                   ASCESRIIGVYATKTDGTDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMM
FT                   DAFDAWEGKGMG"
FT   mRNA            complement(join(6227757..6229733,6231690..6231916,
FT                   6234214..6234273))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT181813"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT181813.0
FT                   created on 11-APR-2003"
FT   CDS             complement(join(6229453..6229733,6231690..6231882))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_b"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT181813.0
FT                   protein_id=mCP104735.0 isoform=CRA_b"
FT                   /protein_id="EDL00061.1"
FT                   /translation="MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFK
FT                   DSMLASMFSGRFPLKTDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEAD
FT                   YFGIPYPYSLSDHLANEMETYSLRSNIELKKVLAFSQVSKYIFIMYKAICCFA"
FT   gene            6260188..>6279863
FT                   /locus_tag="mCG_117470"
FT                   /note="gene_id=mCG117470.1"
FT   mRNA            join(6260188..6260502,6262259..6262384,6264127..6264302,
FT                   6265382..6265459,6267058..6267143,6277584..6277819,
FT                   6279436..>6279863)
FT                   /locus_tag="mCG_117470"
FT                   /product="mCG117470"
FT                   /note="gene_id=mCG117470.1 transcript_id=mCT118611.1
FT                   created on 06-SEP-2002"
FT   assembly_gap    6260979..6261059
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   CDS             join(6262261..6262384,6264127..6264302,6265382..6265459,
FT                   6267058..6267143,6277584..6277819,6279436..>6279863)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117470"
FT                   /product="mCG117470"
FT                   /note="gene_id=mCG117470.1 transcript_id=mCT118611.1
FT                   protein_id=mCP74856.1"
FT                   /protein_id="EDL00065.1"
FT                   /translation="MEYPGIKVDTVTSGIQRRVKGRIAKTNLNVSLASKIKAKILNNSS
FT                   IFKISLKHNNRALARALSKEKENSRRITTEKMQLQKEVEKLNFENTFLRLKLNTLNKKL
FT                   VEIESHVSNDLLTAIEISSLSEFHQGSFLLSATKKQRNSKQCKPAHLPYARVLLTSEND
FT                   DDDGADDKWQTKCNNRTISKTSPDSTSSVSRQPSSLHQCNLKAFPPKEDNQKTCGSGHL
FT                   EHTSSVDILPNESHSDQSPKSSLSEMKTAPSPSLRREKLSHGNVTMRKKCVSSTPDILY
FT                   VTDLDHQPTSSPGSNWNNEIHGHTNETSNNTQRNAECFLDLPSESSSEPDAKRMELVQK
FT                   NTDSFHFQKTVYDAADMELTATDIGKIVAVSKSKKN"
FT   assembly_gap    6276117..6276136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6281004..6289975
FT                   /locus_tag="mCG_145852"
FT                   /note="gene_id=mCG145852.0"
FT   mRNA            join(<6281004..6282060,6283666..6283825,6288865..6289975)
FT                   /locus_tag="mCG_145852"
FT                   /product="mCG145852"
FT                   /note="gene_id=mCG145852.0 transcript_id=mCT185960.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<6281004..6282060,6283666..6283825,6288865..6288868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145852"
FT                   /product="mCG145852"
FT                   /note="gene_id=mCG145852.0 transcript_id=mCT185960.0
FT                   protein_id=mCP107692.0"
FT                   /protein_id="EDL00066.1"
FT                   /translation="KSEMLLGLKKHDPNMQPACQDDSKAGKKLRQKVNRKTEIISKITQ
FT                   IHENDRGSTHDSLNKKLCQKVNISKIISQMNQIYETINEDGNGFKSSIKDCEDIKSCDF
FT                   GEINSNKKENYDPIQDPCTLVKKTKRKGSCKAGSSLAGAKNRCGLQLTDSSQVQSVPLD
FT                   SGLRHHPNEADSGPGEQTNLPKMQKQSAGRSLGDAFSVSLGKEGSRPAKAVSKMTPKSK
FT                   KRKLPLGCSPETHGTVEITPNTDLAKAVDSQQTEKENYLEKEKIAKRKPDFCTKVLKPL
FT                   SETCSSNIKNSSLDSMCKSSLPLSISSRKTLMLEESSSLESTCIFQVGDAAHEKITTGT
FT                   RNPHHRTQKSTPGSRTSLVLVDTSSVSDTNPANPENESEGQSSHPMRRKRQCVPLNLTE
FT                   PSLRRQV"
FT   gene            6294046..6370613
FT                   /gene="Aox1"
FT                   /locus_tag="mCG_117465"
FT                   /note="gene_id=mCG117465.1"
FT   mRNA            join(6294046..6294135,6305482..6305539,6307588..6307684,
FT                   6311181..6311289,6313409..6313535,6317710..6317771,
FT                   6318694..6318783,6320260..6320340,6321460..6321604,
FT                   6322178..6322270,6323081..6323232,6323425..6323518,
FT                   6325242..6325351,6326178..6326362,6327418..6327580,
FT                   6329320..6329412,6332472..6332641,6332934..6333048,
FT                   6334243..6334365,6337380..6337476,6340266..6340390,
FT                   6341645..6341778,6342628..6342715,6345705..6345791,
FT                   6346214..6346405,6349637..6349864,6356697..6356792,
FT                   6358624..6358752,6359358..6359432,6361163..6361215,
FT                   6362069..6362183,6366788..6366853,6368522..6368710,
FT                   6369168..6369335,6370231..6370613)
FT                   /gene="Aox1"
FT                   /locus_tag="mCG_117465"
FT                   /product="aldehyde oxidase 1"
FT                   /note="gene_id=mCG117465.1 transcript_id=mCT118606.1
FT                   created on 12-JUL-2002"
FT   CDS             join(6294094..6294135,6305482..6305539,6307588..6307684,
FT                   6311181..6311289,6313409..6313535,6317710..6317771,
FT                   6318694..6318783,6320260..6320340,6321460..6321604,
FT                   6322178..6322270,6323081..6323232,6323425..6323518,
FT                   6325242..6325351,6326178..6326362,6327418..6327580,
FT                   6329320..6329412,6332472..6332641,6332934..6333048,
FT                   6334243..6334365,6337380..6337476,6340266..6340390,
FT                   6341645..6341778,6342628..6342715,6345705..6345791,
FT                   6346214..6346405,6349637..6349864,6356697..6356792,
FT                   6358624..6358752,6359358..6359432,6361163..6361215,
FT                   6362069..6362183,6366788..6366853,6368522..6368710,
FT                   6369168..6369335,6370231..6370281)
FT                   /codon_start=1
FT                   /gene="Aox1"
FT                   /locus_tag="mCG_117465"
FT                   /product="aldehyde oxidase 1"
FT                   /note="gene_id=mCG117465.1 transcript_id=mCT118606.1
FT                   protein_id=mCP74785.1"
FT                   /db_xref="GOA:G3X8P9"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014313"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016208"
FT                   /db_xref="InterPro:IPR022407"
FT                   /db_xref="MGI:MGI:88035"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8P9"
FT                   /protein_id="EDL00067.1"
FT                   /translation="MDPIQLLFYVNGQKVVEKNVDPEMMLLPYLRKNLRLTGTKYGCGG
FT                   GGCGACTVMISRYNPSTKAIRHHPVNACLTPICSLHGTAVTTVEGLGNTRTRLHPIQER
FT                   IAKCHGTQCGFCTPGMVMSMYALLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTF
FT                   CKASGCCQSKENGVCCLDQEINGLAESQEEDKTSPELFSEEEFLPLDPTQELIFPPELM
FT                   RIAEKQPPKTRVFYGERVTWISPVTLKELVEAKFKYPQAPIVMGYTSVGPEVKFKGVFH
FT                   PIIISPDRIEELGVISQARDGLTLGAGLSLDQVKDILADIVQKLPEEKTQTYRALLKHL
FT                   RTLAGSQIRNMASLGGHIVSRHLDSDLNPLLAVGNCTLNLLSKDGERRIPLSEEFLRKC
FT                   PEADLKPQEVLVSVNIPWSRKWEFVSAFRQAQRQQNALAIVNSGMRVLFREGGGVIEEL
FT                   SILYGGVGSTIISAKNSCQRLIGRPWNEGMLDTACRLVLDEVTLAASAPGGKVEFKRTL
FT                   IISFLFKFYLEVSQGLKREDPGHSPSLAGNHESALDDLHSKHPWRTLTHQNVDPAQLPQ
FT                   DPIGRPIMHLSGIKHATGEAIYCDDMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLP
FT                   GVVDIITADHLQEANTFGTETFLATDEVHCVGHLVCAVIADSETRAKQAAKQVKVVYQD
FT                   LAPLILTIEEAIQHKSFFKSERKLECGNVDEAFKIVDQILEGEIHIGGQEHFYMETQSM
FT                   LVVPKGEDGEIDIYVSTQFPKYIQDIVAATLKLSANKVMCHVRRVGGAFGGKVGKTSIL
FT                   AAITAFAASKHGRAVRCILERGEDMLITGGRHPYLGKYKAGFMNDGRILALDVEHYCNG
FT                   GCSLDESLWVIEMGLLKLDNAYKFPNLRCRGWACRTNLPSNTALRGFGFPQAGLVTEAC
FT                   ITEVAIKCGLSPEQVRTINMYKHVDTTHYKQEFSAKALSECWRECMAKCSYFERKAAIG
FT                   KFNAENSWKKRGMAVIPLKFPVGIGSVAMGQAAALVHIYLDGSALVSHGGIEMGQGVHT
FT                   KMIQVVSRELRMPMSSVHLRGTSTETVPNTNASGGSVVADLNGLAVKDACQTLLKRLEP
FT                   IISKNPQGTWKDWAQTAFDQSISLSAVGYFRGYESNIDWEKGEGHPFEYFVFGAACSEV
FT                   EIDCLTGDHKNIRTNIVMDVGHSINPALDIGQVEGAFIQGMGLYTIEELSYSPQGTLYS
FT                   RGPNQYKIPAICDIPTEMHISFLPPSEHSNTLYSSKGLGESGVFLGCSVFFAIHDAVKA
FT                   ARQERGISGPWKLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNIPV"
FT   assembly_gap    6303977..6304093
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    6331700..6331719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6371158..6371272
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   gene            6377370..6465000
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /note="gene_id=mCG117463.1"
FT   mRNA            join(6377370..6377546,6379105..6379162,6382832..6382928,
FT                   6383715..6383823,6385212..6385338,6389252..6389313,
FT                   6391861..6391941,6402449..6402529,6405584..6405728,
FT                   6406526..6406618,6410280..6410431,6411050..6411143,
FT                   6414151..6414260,6416414..6416598,6416881..6417043,
FT                   6417340..6417432,6422320..6422489,6423024..6423138,
FT                   6423756..6423878,6427468..6427564,6429934..6430058,
FT                   6431700..6431833,6434081..6434168,6434960..6435046,
FT                   6436045..6436236,6436424..6436651,6440777..6440872,
FT                   6441822..6441950,6443620..6443694,6444909..6444961,
FT                   6447769..6447883,6450580..6450645,6452638..6452826,
FT                   6458929..6459096,6464473..6465000)
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /product="aldehyde oxidase 3, transcript variant mCT118604"
FT                   /note="gene_id=mCG117463.1 transcript_id=mCT118604.1
FT                   created on 12-JUL-2002"
FT   CDS             join(6377493..6377546,6379105..6379162,6382832..6382928,
FT                   6383715..6383823,6385212..6385338,6389252..6389313,
FT                   6391861..6391941,6402449..6402529,6405584..6405728,
FT                   6406526..6406618,6410280..6410431,6411050..6411143,
FT                   6414151..6414260,6416414..6416598,6416881..6417043,
FT                   6417340..6417432,6422320..6422489,6423024..6423138,
FT                   6423756..6423878,6427468..6427564,6429934..6430058,
FT                   6431700..6431833,6434081..6434168,6434960..6435046,
FT                   6436045..6436236,6436424..6436651,6440777..6440872,
FT                   6441822..6441950,6443620..6443694,6444909..6444961,
FT                   6447769..6447883,6450580..6450645,6452638..6452826,
FT                   6458929..6459096,6464473..6464526)
FT                   /codon_start=1
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /product="aldehyde oxidase 3, isoform CRA_a"
FT                   /note="gene_id=mCG117463.1 transcript_id=mCT118604.1
FT                   protein_id=mCP74731.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X982"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014313"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016208"
FT                   /db_xref="MGI:MGI:1918974"
FT                   /db_xref="PDB:3ZYV"
FT                   /db_xref="UniProtKB/Swiss-Prot:G3X982"
FT                   /protein_id="EDL00068.1"
FT                   /translation="MSPSKESDELIFFVNGKKVTERNADPEVNLLFYLRKVIRLTGTKY
FT                   GCGGGDCGACTVMISRYDPISKRISHFSATACLVPICSLHGAAVTTVEGIGSTKTRIHP
FT                   VQERIAKGHGTQCGFCTPGMVMSIYTLLRNHPEPSTEQIMETLGGNLCRCTGYRPIVES
FT                   AKSFCPSSTCCQMNGEGKCCLDEEKNEPERKNSVCTKLYEKKEFQPLDPTQELIFPPEL
FT                   MRMAEESQNTVLTFRGERTTWIAPGTLNDLLELKMKHPSAPLVIGNTYLGLHMKFTDVS
FT                   YPIIISPARILELFVVTNTKQGLTLGAGLSLTQVKNVLSDVVSRLPKEKTQIYCALLKQ
FT                   LKTLAGQQIRNVASLGGHIISRLPTSDLNPILGIGNCILNVASTEGIQQIPLNDHFLAG
FT                   VPDAILKPEQVLISVFVPRSSKWEFVSAFRQAPRQQNAFATVNAGMKVVFKEDTNTITD
FT                   LGILYGGIGATVISADKSCRQLIGRCWDEEMLDDAGKMICEEVSLLMAAPGGMEEYRKT
FT                   LAISFLFMFYLDVLKQLKTRDPHKYPDISQKLLHILEDFPLTMPYGMQSFQDVDFQQPL
FT                   QDPIGRPIMHQSGIKHATGEAVFCDDMSVLPGELFLAVVTSSKSHAKIISLDASEALAS
FT                   LGVVDVVTARDVPGDNGREEESLYAQDEVICVGQIVCAVAADSYAHAQQAAKKVKIVYQ
FT                   DIEPMIVTVQDALQYESFIGPERKLEQGNVEEAFQCADQILEGEVHLGGQEHFYMETQS
FT                   VRVVPKGEDKEMDIYVSSQDAAFTQEMVARTLGIPKNRINCHVKRVGGAFGGKASKPGL
FT                   LASVAAVAAQKTGRPIRFILERRDDMLITGGRHPLLGKYKIGFMNNGKIKAADIQLYIN
FT                   GGCTPDDSELVIEYALLKLENAYKIPNLRVRGRVCKTNLPSNTAFRGFGFPQGAFVTET
FT                   CMSAVAAKCRLPPEKVRELNMYRTIDRTIHNQEFDPTNLLQCWEACVENSSYYNRKKAV
FT                   DEFNQQRFWKKRGIAIIPMKFSVGFPKTFYYQAAALVQIYTDGSVLVAHGGVELGQGIN
FT                   TKMIQVASRELKIPMSYIHLDEMSTVTVPNTVTTGASTGADVNGRAVQNACQILMKRLE
FT                   PIIKQNPSGTWEEWVKEAFVQSISLSATGYFRGYQADMDWEKGEGDIFPYFVFGAACSE
FT                   VEIDCLTGAHKNIRTDIVMDGSFSINPAVDIGQIEGAFVQGLGLYTLEELKYSPEGVLY
FT                   TRGPHQYKIASVTDIPEEFHVSLLTPTPNPKAIYSSKGLGEAGTFLGCSVFFAIAAAVA
FT                   AAREERGLSPIWAINSPATAEVIRMACEDQFTNLVPQTDSKCCKPWSIPVA"
FT   mRNA            join(<6386475..6386579,6389252..6389313,6391861..6391941,
FT                   6402449..6402529,6405584..6405728,6406526..6406618,
FT                   6410280..6410431,6411050..6411143,6414151..6414260,
FT                   6416414..6416598,6416881..6417043,6417340..6417432,
FT                   6422320..6422489,6423024..6423138,6423756..6423878,
FT                   6427468..6427564,6429934..6430058,6431700..6431833,
FT                   6434081..6434168,6434960..6435046,6436045..6436236,
FT                   6436424..6436651,6440777..6440872,6441822..6441950,
FT                   6443620..6443694,6444909..6444961,6447769..6447883,
FT                   6450580..6450645,6452638..6452826,6458929..6459096,
FT                   6464473..6464598)
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /product="aldehyde oxidase 3, transcript variant mCT189277"
FT                   /note="gene_id=mCG117463.1 transcript_id=mCT189277.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<6386561..6386579,6389252..6389313,6391861..6391941,
FT                   6402449..6402529,6405584..6405728,6406526..6406618,
FT                   6410280..6410431,6411050..6411143,6414151..6414260,
FT                   6416414..6416598,6416881..6417043,6417340..6417432,
FT                   6422320..6422489,6423024..6423138,6423756..6423878,
FT                   6427468..6427564,6429934..6430058,6431700..6431833,
FT                   6434081..6434168,6434960..6435046,6436045..6436236,
FT                   6436424..6436651,6440777..6440872,6441822..6441950,
FT                   6443620..6443694,6444909..6444961,6447769..6447883,
FT                   6450580..6450645,6452638..6452826,6458929..6459096,
FT                   6464473..6464526)
FT                   /codon_start=1
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /product="aldehyde oxidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG117463.1 transcript_id=mCT189277.0
FT                   protein_id=mCP110246.0 isoform=CRA_b"
FT                   /protein_id="EDL00069.1"
FT                   /translation="ADAELPGNLCRCTGYRPIVESAKSFCPSSTCCQMNGEGKCCLDEE
FT                   KNEPERKNSVCTKLYEKKEFQPLDPTQELIFPPELMRMAEESQNTVLTFRGERTTWIAP
FT                   GTLNDLLELKMKHPSAPLVIGNTYLGLHMKFTDVSYPIIISPARILELFVVTNTKQGLT
FT                   LGAGLSLTQVKNVLSDVVSRLPKEKTQIYCALLKQLKTLAGQQIRNVASLGGHIISRLP
FT                   TSDLNPILGIGNCILNVASTEGIQQIPLNDHFLAGVPDAILKPEQVLISVFVPRSSKWE
FT                   FVSAFRQAPRQQNAFATVNAGMKVVFKEDTNTITDLGILYGGIGATVISADKSCRQLIG
FT                   RCWDEEMLDDAGKMICEEVSLLMAAPGGMEEYRKTLAISFLFMFYLDVLKQLKTRDPHK
FT                   YPDISQKLLHILEDFPLTMPYGMQSFQDVDFQQPLQDPIGRPIMHQSGIKHATGEAVFC
FT                   DDMSVLPGELFLAVVTSSKSHAKIISLDASEALASLGVVDVVTARDVPGDNGREEESLY
FT                   AQDEVICVGQIVCAVAADSYAHAQQAAKKVKIVYQDIEPMIVTVQDALQYESFIGPERK
FT                   LEQGNVEEAFQCADQILEGEVHLGGQEHFYMETQSVRVVPKGEDKEMDIYVSSQDAAFT
FT                   QEMVARTLGIPKNRINCHVKRVGGAFGGKASKPGLLASVAAVAAQKTGRPIRFILERRD
FT                   DMLITGGRHPLLGKYKIGFMNNGKIKAADIQLYINGGCTPDDSELVIEYALLKLENAYK
FT                   IPNLRVRGRVCKTNLPSNTAFRGFGFPQGAFVTETCMSAVAAKCRLPPEKVRELNMYRT
FT                   IDRTIHNQEFDPTNLLQCWEACVENSSYYNRKKAVDEFNQQRFWKKRGIAIIPMKFSVG
FT                   FPKTFYYQAAALVQIYTDGSVLVAHGGVELGQGINTKMIQVASRELKIPMSYIHLDEMS
FT                   TVTVPNTVTTGASTGADVNGRAVQNACQILMKRLEPIIKQNPSGTWEEWVKEAFVQSIS
FT                   LSATGYFRGYQADMDWEKGEGDIFPYFVFGAACSEVEIDCLTGAHKNIRTDIVMDGSFS
FT                   INPAVDIGQIEGAFVQGLGLYTLEELKYSPEGVLYTRGPHQYKIASVTDIPEEFHVSLL
FT                   TPTPNPKAIYSSKGLGEAGTFLGCSVFFAIAAAVAAAREERGLSPIWAINSPATAEVIR
FT                   MACEDQFTNLVPQTDSKCCKPWSIPVA"
FT   assembly_gap    6406118..6406137
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6419000..6419019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6429251..6429277
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    6432566..6432585
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6474760..6532977
FT                   /gene="Aox4"
FT                   /locus_tag="mCG_117466"
FT                   /note="gene_id=mCG117466.1"
FT   mRNA            join(6474760..6474937,6477331..6477388,6481755..6481851,
FT                   6484299..6484407,6486140..6486266,6488478..6488539,
FT                   6492388..6492471,6493175..6493255,6495404..6495548,
FT                   6495780..6495872,6498137..6498288,6499407..6499500,
FT                   6500981..6501093,6503431..6503615,6504995..6505157,
FT                   6509374..6509466,6510115..6510284,6510553..6510667,
FT                   6511520..6511642,6513162..6513258,6514449..6514573,
FT                   6516379..6516512,6518558..6518735,6519879..6520106,
FT                   6521620..6521715,6523447..6523575,6526970..6527044,
FT                   6527726..6527778,6528217..6528331,6528725..6528790,
FT                   6529342..6529527,6531011..6531178,6532143..6532977)
FT                   /gene="Aox4"
FT                   /locus_tag="mCG_117466"
FT                   /product="aldehyde oxidase 4"
FT                   /note="gene_id=mCG117466.1 transcript_id=mCT118607.1
FT                   created on 12-JUL-2002"
FT   CDS             join(6474884..6474937,6477331..6477388,6481755..6481851,
FT                   6484299..6484407,6486140..6486266,6488478..6488539,
FT                   6492388..6492471,6493175..6493255,6495404..6495548,
FT                   6495780..6495872,6498137..6498288,6499407..6499500,
FT                   6500981..6501093,6503431..6503615,6504995..6505157,
FT                   6509374..6509466,6510115..6510284,6510553..6510667,
FT                   6511520..6511642,6513162..6513258,6514449..6514573,
FT                   6516379..6516512,6518558..6518735,6519879..6520106,
FT                   6521620..6521715,6523447..6523575,6526970..6527044,
FT                   6527726..6527778,6528217..6528331,6528725..6528790,
FT                   6529342..6529527,6531011..6531178,6532143..6532196)
FT                   /codon_start=1
FT                   /gene="Aox4"
FT                   /locus_tag="mCG_117466"
FT                   /product="aldehyde oxidase 4"
FT                   /note="gene_id=mCG117466.1 transcript_id=mCT118607.1
FT                   protein_id=mCP74816.1"
FT                   /protein_id="EDL00070.1"
FT                   /translation="MPSVSESDELIFFVNGKKVIEKNPDPEKNLLFYTRKVLNLTGTKY
FT                   SCGTGGCGACTVMVSRYNPKTRKIHHYPATACLVPICWLHGAAITTVEGVGSIKKRVHP
FT                   VQERLAKCHGTQCGFCSPGMVMSIYTLLRNHPEPTPDQITEALGGNLCRCTGYRPIVES
FT                   GKTFSQKSTVCQMKGSGKCCMDPDEKCLESREKKMCTKLYNEDEFQPFDPSQEPIFPPE
FT                   LIRMAEDPNKRRLTFQGKRTTWIIPVTLNDLLELKASYPEAPLVMGNTTVGPGIKFNDE
FT                   FYPVFISPLGVPELNLMDTTNNGVTIGAGYSLAQLKDTLDFLVSEQPKEKTKTFHALQK
FT                   HLRTLAGPQIRNMATLGGHTASRPNFSDLNPILAAGNATINVVSREGKDRQLPLNGPFL
FT                   EKLPEADLKPEEVILSIFIPYTAQWQFVSGLRLAQRQENAFAIVNAGMSVEFEEGTNTI
FT                   KDLKMFFGSVAPTVVSASQTCKQLIGRQWDDQMLSDACQLVLQEIRIPPDAEGGMVEYR
FT                   RTLIISLLFKFYLKVQRWLNEMDPQKFPDIPGKFVSALDDFPIETPQGIQMFQCVDPKQ
FT                   PQKDPVGHPIMHQSGIKHATGEAIFIDDMPPIDQELCLAVVTSTRAHAKITSLDVSEAL
FT                   ACPGVVDVITAEDVPGENDHNGEILYAQSEVICVGQIICTVAADTYIHAKEAAKRVKIA
FT                   YDDIEPTIITIEEALEHNSFLSPEKKIEQGNVDYAFKHVDQIVEGEIHVEGQEHFYMET
FT                   QTILAIPQTEDKEMVLHLGTQFPTHVQEFVSAALNVPRSRIACHMKRAGGAFGGKVTKP
FT                   ALLGAVCAVAANNVLKSENTYHIPNFRCRGRACKTNLPSNTAFRGFGFPQATVVVEAYI
FT                   AAVASKCNLLPEEVREINMYKKTSKTAYKQTFNPEPLRRCWKECLEKSSFFARKKAAEE
FT                   FNGNNYWKKRGLAVVPMKFSVAVPIAFYNQAAALVHIFLDGSVLLTHGGCELGQGLHTK
FT                   MIQVASRELNVPKSYVHFSETSTTTVPNSAFTAGSMGADINGKAVQNACQILMDRLRPI
FT                   IRKNPKGKWEEWIKMAFEESISLSATGYFKGYQTNMDWKKEEGDPYPYYVYGAACSEVE
FT                   VDCLTGAHKLLRTDIFVDAAFSINPALDIGQVEGAFIQGMGFYTTEELKYSPKGVLYSR
FT                   GPEDYKIPTITEIPEEFYVTLVHSRNPIAIYSSKGLGEAGMFLGSSVLFAIYDAVTTAR
FT                   KERGLSDIFPLNSPATPEVIRMACTDQFTEMIPRDDPSTFTPWSIHVS"
FT   assembly_gap    6500548..6500596
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    6517215..6518557
FT                   /estimated_length=1343
FT                   /gap_type="unknown"
FT   gene            6547080..6648449
FT                   /gene="Aox3l1"
FT                   /locus_tag="mCG_117469"
FT                   /note="gene_id=mCG117469.1"
FT   mRNA            join(6547080..6547171,6547896..6548004,6549979..6550105,
FT                   6552081..6552142,6556587..6556667,6558691..6558835,
FT                   6564143..6564294,6564995..6565088,6568768..6568877,
FT                   6569670..6569854,6570445..6570631,6574108..6574277,
FT                   6575230..6575344,6577524..6577646,6587955..6588051,
FT                   6599816..6599940,6601589..6601722,6603726..6603813,
FT                   6605852..6605938,6606697..6606888,6608822..6609049,
FT                   6613019..6613114,6615584..6615712,6619670..6619722,
FT                   6620588..6620702,6623743..6623931,6628351..6628518,
FT                   6645427..6645501,6647845..6648449)
FT                   /gene="Aox3l1"
FT                   /locus_tag="mCG_117469"
FT                   /product="aldehyde oxidase 3-like 1"
FT                   /note="gene_id=mCG117469.1 transcript_id=mCT118610.1
FT                   created on 23-SEP-2002"
FT   CDS             join(6547134..6547171,6547896..6548004,6549979..6550105,
FT                   6552081..6552142,6556587..6556667,6558691..6558835,
FT                   6564143..6564294,6564995..6565088,6568768..6568877,
FT                   6569670..6569854,6570445..6570631,6574108..6574277,
FT                   6575230..6575344,6577524..6577646,6587955..6588051,
FT                   6599816..6599940,6601589..6601722,6603726..6603813,
FT                   6605852..6605938,6606697..6606888,6608822..6609049,
FT                   6613019..6613114,6615584..6615712,6619670..6619722,
FT                   6620588..6620702,6623743..6623931,6628351..6628518,
FT                   6645427..6645480)
FT                   /codon_start=1
FT                   /gene="Aox3l1"
FT                   /locus_tag="mCG_117469"
FT                   /product="aldehyde oxidase 3-like 1"
FT                   /note="gene_id=mCG117469.1 transcript_id=mCT118610.1
FT                   protein_id=mCP74582.1"
FT                   /protein_id="EDL00071.1"
FT                   /translation="MVSQHDPVCKKTRHFSVMACLVPLCSLHGAAVTTVEGVGSIKTRL
FT                   HPVQERIAKSHGTQCGFCTPGMVMSIYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPIL
FT                   ESGRTFCMICTKLFVKDEFQPLDPTQELIFPPELLRMAENPEKQTLTFYGERITWIAPG
FT                   TLQELLVLKAKYPEAPLISGNTALGLTIGACCSLAQVKDILAESISELPQEKTQTYRAL
FT                   LKHLRSLAGQQIRNMASLGGHVISRHCYSDLNPILSVGNTTLNLLSEEGPRQIPLSGHF
FT                   LAGLASADLKPEEILGSVYIPHSQKREFVSAFRQAQCHQNALPDVNAGMRVLFREGTDV
FT                   IEELSIAYGGVGPTTVSAQRSCQQLLGRRWNALMLDEACRLLLDEVSLPGSALGGKVEF
FT                   RRTLIVSLFFKFYLEVLQELKADQKLPPESTRVDSHQPLQDPVGRPIMHLSGLKHATGE
FT                   AVFCDDIPRVDKELFMALVTSTRAHARIISIDSSEVLDLPGVVDVITAEDIPGNNGEED
FT                   DKLLAVDKVLCVGQVICAVVAETDVQAKRATEKIKITYEDLKPVIFTIEDAIKHNSFLC
FT                   PEKKLEQGNIEEAFENVDQVAEGTVHVGGQEHFYMETQRVLVIPKTEDKELDMYVSTQD
FT                   PAHVQKTVSSTLNIPISRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAVKTGHPIRLVL
FT                   DREDDMLITGGRHPLFAKYKVGFMNSGRIKALDIECYINGGCTLDDSELVTEFLVLKLE
FT                   NAYKIRNLRLRGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKN
FT                   MYKTVDKTIYKQAFNPDPLIRCWNECLDKSSFHIRRTRVDEFNKKSYWKKRGIAIVPMK
FT                   FSVGFAATSYHQAAALVHIYTDGSVLVAHGGNELGQGIHTKMLQVASRELKIPLSYLHI
FT                   CETSTTTVPNTIATAASVGADVNGRAVQIEAAFEKRISLSATGYFRGYKAFMDWEKGEG
FT                   DPFPYYVYGAACSEVEIDCLTGAHKIEGAFIQGMGLYTTEELLYSPEGVLYSRSPDKYK
FT                   IPTVTDVPEQFNVSLLPSSQTPLTLYSSKGLGESGMFLGSSVFFAIVDAVAAARRQRDI
FT                   AEDFTVKSPATPEWVRMACADRFTDMIPRDDPKTFKPWSIPIA"
FT   assembly_gap    6550929..6550948
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6566333..6566352
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6584250..6586084
FT                   /estimated_length=1835
FT                   /gap_type="unknown"
FT   assembly_gap    6586854..6587694
FT                   /estimated_length=841
FT                   /gap_type="unknown"
FT   assembly_gap    6588886..6588905
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6590022..6590041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6591080..6597884
FT                   /estimated_length=6805
FT                   /gap_type="unknown"
FT   assembly_gap    6605473..6605597
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    6618954..6619591
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    6631017..6631528
FT                   /estimated_length=512
FT                   /gap_type="unknown"
FT   assembly_gap    6633836..6633859
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    6634945..6635567
FT                   /estimated_length=623
FT                   /gap_type="unknown"
FT   assembly_gap    6647663..6647682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6649320..6649937
FT                   /estimated_length=618
FT                   /gap_type="unknown"
FT   gene            complement(6653771..>6661879)
FT                   /locus_tag="mCG_144886"
FT                   /note="gene_id=mCG144886.0"
FT   mRNA            complement(join(6653771..6655073,6657127..6657943,
FT                   6661552..>6661879))
FT                   /locus_tag="mCG_144886"
FT                   /product="mCG144886"
FT                   /note="gene_id=mCG144886.0 transcript_id=mCT184310.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(6654397..>6654837)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144886"
FT                   /product="mCG144886"
FT                   /note="gene_id=mCG144886.0 transcript_id=mCT184310.0
FT                   protein_id=mCP106116.0"
FT                   /protein_id="EDL00072.1"
FT                   /translation="PTERDAHEHTRSLQNSKKTGPEKKFFLSYNNQNTKCTKQRMLKAV
FT                   REKGQVIYKGRPIRILPDFSSETMKARRSWADVIQTLREHKCQPRLLYSAKVSITIDGK
FT                   NKIFHDKTKFTQYLSINPTLQRIKDGKHQHKEGKCTPEKARN"
FT   assembly_gap    6659831..6659982
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    6662120..6662393
FT                   /estimated_length=274
FT                   /gap_type="unknown"
FT   gene            6662929..6676090
FT                   /locus_tag="mCG_117467"
FT                   /note="gene_id=mCG117467.1"
FT   mRNA            join(6662929..6663003,6666412..6666588,6667738..6667832,
FT                   6668813..6668878,6669441..6669576,6669848..6669957,
FT                   6670075..6670245,6671621..6671767,6672349..6672487,
FT                   6672968..6673090,6673771..6676090)
FT                   /locus_tag="mCG_117467"
FT                   /product="mCG117467"
FT                   /note="gene_id=mCG117467.1 transcript_id=mCT118608.1
FT                   created on 12-JUL-2002"
FT   CDS             join(6662940..6663003,6666412..6666588,6667738..6667832,
FT                   6668813..6668878,6669441..6669576,6669848..6669957,
FT                   6670075..6670245,6671621..6671767,6672349..6672487,
FT                   6672968..6673090,6673771..6673802)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117467"
FT                   /product="mCG117467"
FT                   /note="gene_id=mCG117467.1 transcript_id=mCT118608.1
FT                   protein_id=mCP74852.1"
FT                   /protein_id="EDL00073.1"
FT                   /translation="MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGT
FT                   DLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDL
FT                   ETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTL
FT                   NASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPAN
FT                   KQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEE
FT                   MKKNNIPEPVVIGIVWSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELT
FT                   LLLKIQEYCYDNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKK
FT                   FVEWLKNAEEESESEAEEGD"
FT   assembly_gap    6663580..6663825
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   gene            complement(6680736..6692710)
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /note="gene_id=mCG117461.1"
FT   mRNA            complement(join(6680736..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6685760..6685926,6686014..6686130,
FT                   6688411..6688477,6688872..6688962,6689835..6690060,
FT                   6690525..6690685,6692606..6692710))
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, transcript variant mCT118602"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT118602.1
FT                   created on 13-AUG-2002"
FT   mRNA            complement(join(6680740..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6686014..6686130,6688411..6688477,
FT                   6689835..6690060,6690525..6690685,6692606..6692710))
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, transcript variant mCT171970"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT171970.0
FT                   created on 13-AUG-2002"
FT   mRNA            complement(join(6680740..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6685760..6685926,6686014..6686130,
FT                   6688411..6688477,6689835..6690060,6690525..6690685,
FT                   6692606..6692710))
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, transcript variant mCT170541"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT170541.0
FT                   created on 13-AUG-2002"
FT   CDS             complement(join(6680941..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6685760..6685926,6686014..6686130,
FT                   6688411..6688477,6688872..6688962,6689835..6690060,
FT                   6690525..6690685))
FT                   /codon_start=1
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT118602.1
FT                   protein_id=mCP74714.1 isoform=CRA_a"
FT                   /db_xref="GOA:P22518"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:107403"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22518"
FT                   /protein_id="EDL00074.1"
FT                   /translation="MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCR
FT                   YDHSKTTDSYYLESRSINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSS
FT                   GRSGRSSYKSKHRSRHHTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIV
FT                   DTLGEGAFGKVVECIDHKVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFR
FT                   CVQMLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSN
FT                   KLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVS
FT                   TRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPK
FT                   HMIQKTRKRRYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLE
FT                   YDPAKRITLKEALKHPFFYPLKKHT"
FT   CDS             complement(join(6680941..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6685760..6685913))
FT                   /codon_start=1
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, isoform CRA_b"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT170541.0
FT                   protein_id=mCP93459.0 isoform=CRA_b"
FT                   /protein_id="EDL00075.1"
FT                   /translation="MLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQ
FT                   ICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDIKVVDFGSAT
FT                   YDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLA
FT                   MMERILGPLPKHMIQKTRKRRYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHE
FT                   LLFDLIGKMLEYDPAKRITLKEALKHPFFYPLKKHT"
FT   CDS             complement(join(6680941..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683336))
FT                   /codon_start=1
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, isoform CRA_c"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT171970.0
FT                   protein_id=mCP94889.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UKA7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:107403"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UKA7"
FT                   /protein_id="EDL00076.1"
FT                   /translation="MKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILA
FT                   LGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYF
FT                   HHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEA
FT                   LKHPFFYPLKKHT"
FT   assembly_gap    6691063..6691082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6693216..6693328
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            complement(6699759..6714113)
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /note="gene_id=mCG117472.1"
FT   mRNA            complement(join(6699759..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713261,6713954..6714113))
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   transcript variant mCT118613"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT118613.1
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(6699760..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713261,6713768..>6714056))
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   transcript variant mCT189245"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT189245.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(6699762..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713261,6713433..6714051))
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   transcript variant mCT172701"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT172701.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(6699969..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..>6713252))
FT                   /codon_start=1
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT189245.0
FT                   protein_id=mCP110250.0 isoform=CRA_c"
FT                   /protein_id="EDL00080.1"
FT                   /translation="KIKQCFLEPSRRKMSVTLHTDVGDIKIEVFCERTPKTCENFLALC
FT                   ASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMAN
FT                   NGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIK
FT                   DITIHANPFAQ"
FT   CDS             complement(join(6699969..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713213))
FT                   /codon_start=1
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT118613.1
FT                   protein_id=mCP74865.1 isoform=CRA_a"
FT                   /protein_id="EDL00077.1"
FT                   /translation="MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRN
FT                   IKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFIT
FT                   YGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ"
FT   CDS             complement(join(6699969..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713213))
FT                   /codon_start=1
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT172701.0
FT                   protein_id=mCP95620.0 isoform=CRA_a"
FT                   /protein_id="EDL00079.1"
FT                   /translation="MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRN
FT                   IKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFIT
FT                   YGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ"
FT   mRNA            complement(join(6702552..6703214,6706986..6707053,
FT                   6709486..6709579,6711167..6711241,6713211..6713261,
FT                   6713768..6714090))
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   transcript variant mCT172700"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT172700.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(6703092..6703214,6706986..6707053,
FT                   6709486..6709579,6711167..6711241,6713211..6713213))
FT                   /codon_start=1
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT172700.0
FT                   protein_id=mCP95619.0 isoform=CRA_b"
FT                   /protein_id="EDL00078.1"
FT                   /translation="MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRN
FT                   IKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFIT
FT                   YGKQPHLDMKYTVFGK"
FT   assembly_gap    6704161..6704180
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            6713773..6750462
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /note="gene_id=mCG117462.1"
FT   mRNA            join(6713773..6714257,6716257..6716712,6719010..6719172,
FT                   6720712..6720838,6724206..6724344,6726387..6726470,
FT                   6749634..6750462)
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   transcript variant mCT170703"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT170703.0
FT                   created on 15-JUL-2002"
FT   mRNA            join(6713773..6714257,6716257..6716712,6719010..6719172,
FT                   6720712..6720838,6724206..6724344,6726387..6726470,
FT                   6729749..6731147)
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   transcript variant mCT118603"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT118603.1
FT                   created on 15-JUL-2002"
FT   mRNA            join(<6713907..6714068,6719026..6719172,6720712..6720838,
FT                   6724206..>6724282)
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   transcript variant mCT170702"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT170702.0
FT                   created on 15-JUL-2002"
FT   CDS             join(<6713935..6714068,6719026..6719172,6720712..6720838,
FT                   6724206..>6724282)
FT                   /codon_start=1
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT170702.0
FT                   protein_id=mCP93621.0 isoform=CRA_a"
FT                   /protein_id="EDL00081.1"
FT                   /translation="DSEDHAPHPSAPESSTHNLTKKQNPLSPSNFIQRPGVGSRTHRTK
FT                   PIHPSRAPDYPTEGAHRLEFSVNRSQDLDKVMSTLRGVGGVSVTSFPARCDGEEQTRIS
FT                   LNCTQKTLMQVLAFLSQDRQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLAIMIER"
FT   CDS             join(6716280..6716712,6719010..6719172,6720712..6720838,
FT                   6724206..6724344,6726387..6726470,6749634..6749677)
FT                   /codon_start=1
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT170703.0
FT                   protein_id=mCP93620.0 isoform=CRA_c"
FT                   /db_xref="GOA:D3Z0G0"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR017222"
FT                   /db_xref="MGI:MGI:1929485"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z0G0"
FT                   /protein_id="EDL00083.1"
FT                   /translation="MLSSAHLVPTSVQRAQSWICRSSRSFMDLKALLSSLNDFASLSFA
FT                   ESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMDEALQKKADFILSYHPPIFRPMKHITW
FT                   KTWKECLVIRALENRVAVYSPHTAYDAAPQGVNSWLAKGLGTCTTRPIHPSRAPDYPTE
FT                   GAHRLEFSVNRSQDLDKVMSTLRGVGGVSVTSFPARCDGEEQTRISLNCTQKTLMQVLA
FT                   FLSQDRQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLAIMIERIKTHLKLSHLRLAL
FT                   GVGRTLESQVKVVALCAGSGGSVLQGVEADLYLTGSVSLETGAGRSLF"
FT   CDS             join(6716280..6716712,6719010..6719172,6720712..6720838,
FT                   6724206..6724344,6726387..6726470,6729749..6729933)
FT                   /codon_start=1
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT118603.1
FT                   protein_id=mCP74722.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9EQ80"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR017222"
FT                   /db_xref="MGI:MGI:1929485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQ80"
FT                   /protein_id="EDL00082.1"
FT                   /translation="MLSSAHLVPTSVQRAQSWICRSSRSFMDLKALLSSLNDFASLSFA
FT                   ESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMDEALQKKADFILSYHPPIFRPMKHITW
FT                   KTWKECLVIRALENRVAVYSPHTAYDAAPQGVNSWLAKGLGTCTTRPIHPSRAPDYPTE
FT                   GAHRLEFSVNRSQDLDKVMSTLRGVGGVSVTSFPARCDGEEQTRISLNCTQKTLMQVLA
FT                   FLSQDRQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLAIMIERIKTHLKLSHLRLAL
FT                   GVGRTLESQVKVVALCAGSGGSVLQGVEADLYLTGEMSHHDVLDAASKGINVILCEHSN
FT                   TERGFLSELQEMLGVHFENKINIILSETDRDPLRVV"
FT   gene            complement(6731378..6773289)
FT                   /gene="Orc2l"
FT                   /locus_tag="mCG_117464"
FT                   /note="gene_id=mCG117464.1"
FT   mRNA            complement(join(6731378..6732898,6734603..6734721,
FT                   6736200..6736261,6738305..6738476,6739577..6739723,
FT                   6740937..6741033,6743457..6743589,6745082..6745191,
FT                   6748899..6748997,6749608..6749801,6752351..6752411,
FT                   6761403..6761434,6762207..6762296,6765704..6765793,
FT                   6768569..6768712,6769650..6769753,6770169..6770217,
FT                   6773111..6773289))
FT                   /gene="Orc2l"
FT                   /locus_tag="mCG_117464"
FT                   /product="origin recognition complex, subunit 2-like (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG117464.1 transcript_id=mCT118605.1
FT                   created on 15-JUL-2002"
FT   CDS             complement(join(6732812..6732898,6734603..6734721,
FT                   6736200..6736261,6738305..6738476,6739577..6739723,
FT                   6740937..6741033,6743457..6743589,6745082..6745191,
FT                   6748899..6748997,6749608..6749801,6752351..6752411,
FT                   6761403..6761434,6762207..6762296,6765704..6765793,
FT                   6768569..6768712,6769650..6769743))
FT                   /codon_start=1
FT                   /gene="Orc2l"
FT                   /locus_tag="mCG_117464"
FT                   /product="origin recognition complex, subunit 2-like (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG117464.1 transcript_id=mCT118605.1
FT                   protein_id=mCP74768.1"
FT                   /db_xref="GOA:Q543F8"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="MGI:MGI:1328306"
FT                   /db_xref="UniProtKB/TrEMBL:Q543F8"
FT                   /protein_id="EDL00084.1"
FT                   /translation="MSTLQLKETKVPSVQFVGDDDVLSHILDREGGTKLKKEKAQLLVN
FT                   PQKVIKKADCELEKSDLEVLEDQNYVKVLGRNIQESLGNGSAKDGRNKVYSFQQRKHPE
FT                   EMTKLALELAKTSGKKDPLDSNDPEITKNIAQKSKGHSTSEKAPLVNNNKTEFLSTQPH
FT                   NLRKRIIASRSHYDSESEYSASSSEDDEEATKDEEEDTNVARLSQKSQGQNRLLPAPVS
FT                   KETLPKKKKRDKASDLVEEYFEAHSSSKVLTSDRTLQRLRRARVDQKTLHNLLRKFVPS
FT                   FSAEIERLNQQHEKLFHKWMLQLHLGFNIVLYGLGSKRDLLEKFRTTMLQDSIHVVING
FT                   YFPGVSVKSILNSITEDVLSHVGTFQSVLDQRDWIINRFKEDSSLELFLLIHNLDSQML
FT                   RGDNSQQILGQLSSLHNVYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSPYTEETS
FT                   YENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLMKFQLDNQDSPSYIGLSFQDFYQ
FT                   QCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDSGILADFLEKEEEEA
FT                   "
FT   assembly_gap    6735402..6735490
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    6737292..6737535
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    6751100..6751293
FT                   /estimated_length=194
FT                   /gap_type="unknown"
FT   assembly_gap    6757634..6757738
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   gene            <6773492..6791569
FT                   /locus_tag="mCG_144897"
FT                   /note="gene_id=mCG144897.0"
FT   mRNA            join(<6773492..6773570,6778910..6780605,6784051..6784116,
FT                   6785402..6785508,6785964..6786104,6788774..6789087,
FT                   6791358..6791569)
FT                   /locus_tag="mCG_144897"
FT                   /product="mCG144897"
FT                   /note="gene_id=mCG144897.0 transcript_id=mCT184321.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6786101..6786104,6788774..6789087,6791358..6791501)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144897"
FT                   /product="mCG144897"
FT                   /note="gene_id=mCG144897.0 transcript_id=mCT184321.0
FT                   protein_id=mCP106126.0"
FT                   /protein_id="EDL00085.1"
FT                   /translation="TGHKRNTSETELEASPLLPSFYRPGRCYTGCWGELSPTDAIGFSM
FT                   LLSWPGWHTSCGYWCNSGMTDTEVTNNFLMVFVPVPWKKTHILTVNLVKSLWLERFAGL
FT                   CEIFTSSTVTHFTFQQSTASIHSIRQDNGSHAPVHKILNVHFGFFFLQL"
FT   gene            complement(6795593..6856254)
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /note="gene_id=mCG117468.1"
FT   mRNA            complement(join(6795593..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825564..6825686,6826290..6826370,6834166..6834263,
FT                   6856168..6856254))
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, transcript variant
FT                   mCT118609"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT118609.1
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(6795597..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825585..6825686,6826290..6826370,6834166..6834263,
FT                   6856168..>6856225))
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, transcript variant
FT                   mCT189283"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT189283.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(6797422..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825585..6825686,6826290..6826370,6834166..6834263,
FT                   6856063..>6856111))
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, transcript variant
FT                   mCT189284"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT189284.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6797997..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825585..6825686,6826290..>6826346))
FT                   /codon_start=1
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, isoform CRA_b"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT189283.0
FT                   protein_id=mCP110247.0 isoform=CRA_b"
FT                   /protein_id="EDL00087.1"
FT                   /translation="RKMLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYK
FT                   VIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRLTVSRDRQSNGCIE
FT                   ALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVV
FT                   YSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHE
FT                   KQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVA
FT                   NAMKNSLPFDAPDSSQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGLNGG
FT                   EESLNMNDADEGFSSGASLSSQPHGTKPPSSSQRGSLRKVATGRSAKDKETALAIKSNE
FT                   SPRDSVVGKQFVQQQADLSIDSVELTPMKKHLSLPAGQVVPKTNSLSLIRTASASSSKS
FT                   FDYVNGGQASTSIGVGTEGVTNLAATNANRYSTISLQEDRLGHAGEGKELLSPGAPLTK
FT                   QSRSPSFNMQLISQV"
FT   CDS             complement(join(6797997..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825585..6825686,6826290..>6826346))
FT                   /codon_start=1
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, isoform CRA_b"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT189284.0
FT                   protein_id=mCP110248.0 isoform=CRA_b"
FT                   /protein_id="EDL00088.1"
FT                   /translation="RKMLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYK
FT                   VIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRLTVSRDRQSNGCIE
FT                   ALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVV
FT                   YSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHE
FT                   KQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVA
FT                   NAMKNSLPFDAPDSSQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGLNGG
FT                   EESLNMNDADEGFSSGASLSSQPHGTKPPSSSQRGSLRKVATGRSAKDKETALAIKSNE
FT                   SPRDSVVGKQFVQQQADLSIDSVELTPMKKHLSLPAGQVVPKTNSLSLIRTASASSSKS
FT                   FDYVNGGQASTSIGVGTEGVTNLAATNANRYSTISLQEDRLGHAGEGKELLSPGAPLTK
FT                   QSRSPSFNMQLISQV"
FT   CDS             complement(join(6797997..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825564..6825686,6826290..6826340))
FT                   /codon_start=1
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, isoform CRA_a"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT118609.1
FT                   protein_id=mCP74862.1 isoform=CRA_a"
FT                   /protein_id="EDL00086.1"
FT                   /translation="MLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYKVI
FT                   QDSNNEVGKLIRKLLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRLTVSRDRQS
FT                   NGCIEALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHD
FT                   LIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGF
FT                   PRQHEKQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQ
FT                   PLLVANAMKNSLPFDAPDSSQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAE
FT                   GLNGGEESLNMNDADEGFSSGASLSSQPHGTKPPSSSQRGSLRKVATGRSAKDKETALA
FT                   IKSNESPRDSVVGKQFVQQQADLSIDSVELTPMKKHLSLPAGQVVPKTNSLSLIRTASA
FT                   SSSKSFDYVNGGQASTSIGVGTEGVTNLAATNANRYSTISLQEDRLGHAGEGKELLSPG
FT                   APLTKQSRSPSFNMQLISQV"
FT   assembly_gap    6845421..6845440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6846598..6846812
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    6854099..6854121
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            6856367..6865863
FT                   /locus_tag="mCG_117842"
FT                   /note="gene_id=mCG117842.1"
FT   mRNA            join(6856367..6856632,6861060..6861219,6865564..6865863)
FT                   /locus_tag="mCG_117842"
FT                   /product="mCG117842"
FT                   /note="gene_id=mCG117842.1 transcript_id=mCT118988.1
FT                   created on 15-JUL-2002"
FT   CDS             join(6861062..6861219,6865564..6865720)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117842"
FT                   /product="mCG117842"
FT                   /note="gene_id=mCG117842.1 transcript_id=mCT118988.1
FT                   protein_id=mCP74698.1"
FT                   /protein_id="EDL00089.1"
FT                   /translation="MAAGHGHEHGHEHGHGHGKMELPDYRQWKIEGTPLETVQKKLAAR
FT                   GLRDPWARNEAWRYMGGFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH
FT                   "
FT   assembly_gap    6864031..6864050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6869690..6869709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6900325..6900344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6908312..6908382
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   gene            6915993..6917654
FT                   /locus_tag="mCG_117845"
FT                   /note="gene_id=mCG117845.1"
FT   mRNA            6915993..6917654
FT                   /locus_tag="mCG_117845"
FT                   /product="mCG117845"
FT                   /note="gene_id=mCG117845.1 transcript_id=mCT118991.1
FT                   created on 15-JUL-2002"
FT   CDS             6916058..6916579
FT                   /codon_start=1
FT                   /locus_tag="mCG_117845"
FT                   /product="mCG117845"
FT                   /note="gene_id=mCG117845.1 transcript_id=mCT118991.1
FT                   protein_id=mCP74703.0"
FT                   /protein_id="EDL00090.1"
FT                   /translation="MGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFT
FT                   DADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKP
FT                   RGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLT
FT                   WHSCPEDEAQ"
FT   assembly_gap    6918497..6918516
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <6921886..6924891
FT                   /locus_tag="mCG_1035646"
FT                   /note="gene_id=mCG1035646.1"
FT   mRNA            join(<6921886..6922026,6924282..6924891)
FT                   /locus_tag="mCG_1035646"
FT                   /product="mCG1035646"
FT                   /note="gene_id=mCG1035646.1 transcript_id=mCT153350.1
FT                   created on 08-NOV-2002"
FT   CDS             join(6921886..6922026,6924282..6924290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035646"
FT                   /product="mCG1035646"
FT                   /note="gene_id=mCG1035646.1 transcript_id=mCT153350.1
FT                   protein_id=mCP74506.1"
FT                   /protein_id="EDL00091.1"
FT                   /translation="MPARAQRCCACCHVCFRFLGVSILGSLRHAAKSLRPEPLKRPLRG
FT                   RQRR"
FT   gene            complement(6927453..6965341)
FT                   /locus_tag="mCG_117851"
FT                   /note="gene_id=mCG117851.1"
FT   mRNA            complement(join(6927453..6927767,6928333..6928442,
FT                   6928560..6928649,6936161..6936265,6937064..6937163,
FT                   6938763..6938815,6945908..6945969,6947665..6947758,
FT                   6949243..6949376,6960292..6960337,6961084..6961161,
FT                   6961680..6961824,6965281..6965336))
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, transcript variant mCT118997"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT118997.1
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(6927458..6927767,6928333..6928442,
FT                   6928560..6928649,6930735..6930797,6936162..6936265,
FT                   6937064..6937163,6938763..6938815,6939705..6939802,
FT                   6945908..6945969,6947665..6947758,6949243..6949376,
FT                   6960292..6960337,6961084..6961161,6961680..6961824,
FT                   6965281..>6965336))
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, transcript variant mCT189250"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT189250.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6927761..6927767,6928333..6928442,
FT                   6928560..6928649,6930735..6930797,6936162..6936265,
FT                   6937064..6937163,6938763..6938815,6939705..6939802,
FT                   6945908..6945969,6947665..6947758,6949243..6949376,
FT                   6960292..6960337,6961084..6961161,6961680..6961824,
FT                   6965281..>6965314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, isoform CRA_c"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT189250.0
FT                   protein_id=mCP110257.0 isoform=CRA_c"
FT                   /protein_id="EDL00094.1"
FT                   /translation="LEGEFLLKGLSGAPGLARLPCTMDPNPFIYCTCCDCCKLGQPKLI
FT                   KTPYPLPKHPTGKFKPVLPPPISKEHNSLLSQPGKSTVSPRDKVQSGNTESSKAPSEVI
FT                   QVSPGYTLIRNREQISVTLGDEMFNRKKHLESDVLSKVKFSRTDIISDLQEQIAELMAI
FT                   IEQMNRDQQSALKLLSKDLDLRCSNMKQKFETESRELKETHREELERLENNYKEALKAE
FT                   KALAEEKLDKMSKEYKYLKSMFHVFQDSIYEEMEDKWLRRKAEWEKDEKMEREKILLQQ
FT                   KCRIIKKFELQSEEKKKKMNESISAVSDNFAREKEELLRQHDEDILQIQELRKSKEILE
FT                   AELRAQATVLETLNTNLFQCQKELERQKTIAANLEKLFQTKLAEAEEKHKYNIKTPTEE
FT                   NNCLRC"
FT   mRNA            complement(join(6936230..6936265,6937064..6937163,
FT                   6938763..6939802,6945908..6945969,6947665..6947758,
FT                   6949243..6949376,6960292..6960337,6961084..6961161,
FT                   6961680..6961824,6965096..6965341))
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, transcript variant mCT172710"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT172710.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(6938812..6938815,6945908..6945969,
FT                   6947665..6947758,6949243..6949376,6960292..6960337,
FT                   6961084..6961161,6961680..6961792))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, isoform CRA_a"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT118997.1
FT                   protein_id=mCP74489.1 isoform=CRA_a"
FT                   /protein_id="EDL00092.1"
FT                   /translation="MDPNPFIYCTCCDCCKLGQPKLIKTPYPLPKHPTGKFKPVLPPPI
FT                   SKEHNSLLSQPGKSTVSPRDKVQSGNTESSKAPSEVIQVSPGYTLIRNREQISVTLGDE
FT                   MFNRKKHLESDVLSKVKFSRTDIISDLQEQIAELMAIIEQMNRDQQSALKLLSKDLDLR
FT                   CSNMKQKFETESR"
FT   CDS             complement(join(6939592..6939802,6945908..6945969,
FT                   6947665..6947758,6949243..6949376,6960292..6960337,
FT                   6961084..6961161,6961680..6961792))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, isoform CRA_b"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT172710.0
FT                   protein_id=mCP95629.0 isoform=CRA_b"
FT                   /protein_id="EDL00093.1"
FT                   /translation="MDPNPFIYCTCCDCCKLGQPKLIKTPYPLPKHPTGKFKPVLPPPI
FT                   SKEHNSLLSQPGKSTVSPRDKVQSGNTESSKAPSEVIQVSPGYTLIRNREQISVTLGDE
FT                   MFNRKKHLESDVLSKVKFSRTDIISDLQEQIAELMAIIEQMNRDQQSALKLLSKDLDLR
FT                   CSNMKQKFETESRELKETHREELERLENNYKEALKAEKALAEEKLGTVGPWGDAGRKVD
FT                   SLPWHPYSHGLAQPDVQHFPSEA"
FT   assembly_gap    6945512..6945576
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    6966165..6966231
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   gene            6980846..7024600
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /note="gene_id=mCG117843.2"
FT   mRNA            join(6980846..6980922,6982910..6982998,6995749..6996175,
FT                   6998499..6998604,7000595..7000730,7001696..7002669)
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator,
FT                   transcript variant mCT170704"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT170704.0
FT                   created on 15-JUL-2002"
FT   mRNA            join(6980883..6980922,6995749..6996175,6998499..6998604,
FT                   7000595..7000730,7001696..7001769,7005101..7005155,
FT                   7009706..7009755,7010408..7010489,7021785..7022292,
FT                   7023230..7024590)
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator,
FT                   transcript variant mCT118989"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT118989.1
FT                   created on 15-JUL-2002"
FT   assembly_gap    6982279..6982506
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   mRNA            join(<6982656..6982998,6995749..6996175,6998499..6998604,
FT                   7000595..7000730,7001696..7001769,7005101..7005155,
FT                   7009706..7009755,7010408..7010489,7021785..7022292,
FT                   7023230..7024600)
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator,
FT                   transcript variant mCT189293"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT189293.0
FT                   created on 08-MAR-2004"
FT   assembly_gap    6993937..6994021
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   CDS             join(<6995802..6996175,6998499..6998604,7000595..7000730,
FT                   7001696..7001769,7005101..7005155,7009706..7009755,
FT                   7010408..7010489,7021785..7022292,7023230..7023368)
FT                   /codon_start=1
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT189293.0
FT                   protein_id=mCP110252.0 isoform=CRA_c"
FT                   /protein_id="EDL00097.1"
FT                   /translation="CWLLVVPRALLNGWRLDENLAAVVLNMAQSPVSAEVIHQVEECLD
FT                   EDEKEMMLFLCRDVTENLAAPNVRDLLDSLSERGQLSFATLAELLYRVRRFDLLKRILK
FT                   TDKATVEDHLRRNPHLVSDYRVLLMEIGESLDQNDVSSLVFLTRDYTGRGKIAKDKSFL
FT                   DLVIELEKLNLIASDQLNLLEKCLKNIHRIDLNTKIQKYTQSSQGARSNMNTLQASLPK
FT                   LSIKYNSRLQNGRSKEPRFVEYRDSQRTLVKTSIQESGAFLPPHIREETYRMQSKPLGI
FT                   CLIIDCIGNDTKYLQETFTSLGYHIQLFLFPKSHDITQIVRRYASMAQHQDYDSFACVL
FT                   VSLGGSQSMMGRDQVHSGFSLDHVKNMFTGDTCPSLRGKPKLFFIQNYESLGSQLEDSS
FT                   LEVDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADVSHLEKPSSSSSVYLQKLSQQL
FT                   KQGRRRPLVDLHVELMDKVYAWNSGVSSKEKYSLSLQHTLRKKLILAPT"
FT   CDS             join(6995880..6996175,6998499..6998604,7000595..7000730,
FT                   7001696..7001769,7005101..7005155,7009706..7009755,
FT                   7010408..7010489,7021785..7022292,7023230..7023368)
FT                   /codon_start=1
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT118989.1
FT                   protein_id=mCP74701.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q812G4"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001875"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="MGI:MGI:1336166"
FT                   /db_xref="UniProtKB/TrEMBL:Q812G4"
FT                   /protein_id="EDL00095.1"
FT                   /translation="MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDL
FT                   LDSLSERGQLSFATLAELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLME
FT                   IGESLDQNDVSSLVFLTRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKN
FT                   IHRIDLNTKIQKYTQSSQGARSNMNTLQASLPKLSIKYNSRLQNGRSKEPRFVEYRDSQ
FT                   RTLVKTSIQESGAFLPPHIREETYRMQSKPLGICLIIDCIGNDTKYLQETFTSLGYHIQ
FT                   LFLFPKSHDITQIVRRYASMAQHQDYDSFACVLVSLGGSQSMMGRDQVHSGFSLDHVKN
FT                   MFTGDTCPSLRGKPKLFFIQNYESLGSQLEDSSLEVDGPSIKNVDSKPLQPRHCTTHPE
FT                   ADIFWSLCTADVSHLEKPSSSSSVYLQKLSQQLKQGRRRPLVDLHVELMDKVYAWNSGV
FT                   SSKEKYSLSLQHTLRKKLILAPT"
FT   CDS             join(6995880..6996175,6998499..6998604,7000595..7000730,
FT                   7001696..7001805)
FT                   /codon_start=1
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT170704.0
FT                   protein_id=mCP93622.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5U4G3"
FT                   /db_xref="InterPro:IPR001875"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="MGI:MGI:1336166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5U4G3"
FT                   /protein_id="EDL00096.1"
FT                   /translation="MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDL
FT                   LDSLSERGQLSFATLAELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLME
FT                   IGESLDQNDVSSLVFLTRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKN
FT                   IHRIDLNTKIQKYTQSSQGARSNMNTLQASLPKLSIKYNSRVSLEPVYGVPA"
FT   gene            7026304..7028306
FT                   /locus_tag="mCG_146943"
FT                   /note="gene_id=mCG146943.0"
FT   mRNA            7026304..7028306
FT                   /locus_tag="mCG_146943"
FT                   /product="mCG146943"
FT                   /note="gene_id=mCG146943.0 transcript_id=mCT187206.0
FT                   created on 13-JAN-2004"
FT   CDS             7026587..7026709
FT                   /codon_start=1
FT                   /locus_tag="mCG_146943"
FT                   /product="mCG146943"
FT                   /note="gene_id=mCG146943.0 transcript_id=mCT187206.0
FT                   protein_id=mCP109542.0"
FT                   /protein_id="EDL00098.1"
FT                   /translation="MAQWVRAPDCSSKGPEFKSQQPHGGSQPSVTRSDSLFWSV"
FT   assembly_gap    7036818..7036837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7041243..7041268
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    7046344..7046363
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7064821..7116397
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /note="gene_id=mCG117855.1"
FT   mRNA            join(7064821..7065133,7091232..7091347,7093300..7093632,
FT                   7096592..7096697,7098258..7098396,7098481..7098534,
FT                   7100991..7101052,7103018..7103159,7113729..7114230,
FT                   7116007..7116397)
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /product="caspase 8, transcript variant mCT173675"
FT                   /note="gene_id=mCG117855.1 transcript_id=mCT173675.0
FT                   created on 23-SEP-2002"
FT   mRNA            join(7064821..7065133,7093300..7093632,7096592..7096697,
FT                   7098258..7098396,7098481..7098534,7100991..7101052,
FT                   7103018..7103159,7113729..7114230,7116007..7116397)
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /product="caspase 8, transcript variant mCT119001"
FT                   /note="gene_id=mCG117855.1 transcript_id=mCT119001.1
FT                   created on 23-SEP-2002"
FT   assembly_gap    7065665..7065841
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   gene            <7067270..7071110
FT                   /locus_tag="mCG_146949"
FT                   /note="gene_id=mCG146949.0"
FT   mRNA            <7067270..7071110
FT                   /locus_tag="mCG_146949"
FT                   /product="mCG146949"
FT                   /note="gene_id=mCG146949.0 transcript_id=mCT187212.0
FT                   created on 13-JAN-2004"
FT   CDS             7067270..7067506
FT                   /codon_start=1
FT                   /locus_tag="mCG_146949"
FT                   /product="mCG146949"
FT                   /note="gene_id=mCG146949.0 transcript_id=mCT187212.0
FT                   protein_id=mCP109548.0"
FT                   /protein_id="EDL00101.1"
FT                   /translation="MLLGASFSSLSCEVGALYSESLHSILGSRKHSFKVLFFFFSLTPE
FT                   NILTNSQQGAYVFVHRFAHTMKDPGFASLGSLL"
FT   assembly_gap    7076022..7076041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(7093328..7093632,7096592..7096697,7098258..7098396,
FT                   7098481..7098534,7100991..7101052,7103018..7103159,
FT                   7113729..7114230,7116007..7116139)
FT                   /codon_start=1
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /product="caspase 8, isoform CRA_a"
FT                   /note="gene_id=mCG117855.1 transcript_id=mCT173675.0
FT                   protein_id=mCP96594.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U607"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001875"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR033139"
FT                   /db_xref="MGI:MGI:1261423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U607"
FT                   /protein_id="EDL00099.1"
FT                   /translation="MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLF
FT                   LRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVM
FT                   LFKLSEEVSELELRSFKFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSI
FT                   CDQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESR
FT                   TSDKVYQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHF
FT                   EIVSYDDCTANEIHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTS
FT                   YFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEA
FT                   DFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDR
FT                   RNKGKQMPQPTFTLRKKLFFPP"
FT   CDS             join(7093328..7093632,7096592..7096697,7098258..7098396,
FT                   7098481..7098534,7100991..7101052,7103018..7103159,
FT                   7113729..7114230,7116007..7116139)
FT                   /codon_start=1
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /product="caspase 8, isoform CRA_a"
FT                   /note="gene_id=mCG117855.1 transcript_id=mCT119001.1
FT                   protein_id=mCP74626.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U607"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001875"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR033139"
FT                   /db_xref="MGI:MGI:1261423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U607"
FT                   /protein_id="EDL00100.1"
FT                   /translation="MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLF
FT                   LRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVM
FT                   LFKLSEEVSELELRSFKFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSI
FT                   CDQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESR
FT                   TSDKVYQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHF
FT                   EIVSYDDCTANEIHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTS
FT                   YFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEA
FT                   DFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDR
FT                   RNKGKQMPQPTFTLRKKLFFPP"
FT   assembly_gap    7128960..7128979
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7130603..7165265)
FT                   /locus_tag="mCG_117856"
FT                   /note="gene_id=mCG117856.1"
FT   mRNA            complement(join(7130603..7130813,7145090..7145151,
FT                   7145798..7145891,7147504..7147637,7160917..7160947,
FT                   7162060..7162204,7165210..7165265))
FT                   /locus_tag="mCG_117856"
FT                   /product="mCG117856"
FT                   /note="gene_id=mCG117856.1 transcript_id=mCT119002.1
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(7130699..7130813,7145090..7145151,
FT                   7145798..7145891,7147504..7147637,7160917..7160947,
FT                   7162060..7162172))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117856"
FT                   /product="mCG117856"
FT                   /note="gene_id=mCG117856.1 transcript_id=mCT119002.1
FT                   protein_id=mCP74635.1"
FT                   /protein_id="EDL00102.1"
FT                   /translation="MDPNPFIYCTCCDYCKLGPTKLIKTPYPLPKTPTGKFKPVLPLPV
FT                   SKEEVIQVSPGYTLIQNQEQISVTLGDEMFNRKKHLESDVLSKVKYSRTDIISDLQEQI
FT                   AELMAIIEQMNRDQQSALKLLSKEMDLCCSNMKQKFETKSRELKETHREELERLENNYK
FT                   EALKAEKALAEEKLGTVRP"
FT   assembly_gap    7146435..7146535
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    7155174..7155193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7156379..7156398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7158970..7158998
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    7160853..7160905
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    7164581..7164792
FT                   /estimated_length=212
FT                   /gap_type="unknown"
FT   gene            complement(7169853..>7239571)
FT                   /gene="Trak2"
FT                   /locus_tag="mCG_117853"
FT                   /note="gene_id=mCG117853.1"
FT   mRNA            complement(join(7169853..7173585,7176109..7176214,
FT                   7177926..7178192,7179353..7179651,7181039..7181239,
FT                   7181589..7181665,7185109..7185246,7188195..7188269,
FT                   7188644..7188774,7190497..7190575,7191103..7191312,
FT                   7192945..7193061,7196074..7196150,7212350..7212638,
FT                   7239338..>7239571))
FT                   /gene="Trak2"
FT                   /locus_tag="mCG_117853"
FT                   /product="trafficking protein, kinesin binding 2"
FT                   /note="gene_id=mCG117853.1 transcript_id=mCT118999.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(7172907..7173585,7176109..7176214,
FT                   7177926..7178192,7179353..7179651,7181039..7181239,
FT                   7181589..7181665,7185109..7185246,7188195..7188269,
FT                   7188644..7188774,7190497..7190575,7191103..7191312,
FT                   7192945..7193061,7196074..7196150,7212350..>7212506))
FT                   /codon_start=1
FT                   /gene="Trak2"
FT                   /locus_tag="mCG_117853"
FT                   /product="trafficking protein, kinesin binding 2"
FT                   /note="gene_id=mCG117853.1 transcript_id=mCT118999.1
FT                   protein_id=mCP74509.1"
FT                   /protein_id="EDL00103.1"
FT                   /translation="WISFPAIHTKAAPFNQSRKGFCMSQSQNAIFKSRTGEANLMSSNH
FT                   RDSESITVLGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHVLSEQN
FT                   EALEEQLGQAFDQVNQLQHELSKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQG
FT                   LLQLDMLHEKLRELEEENMALRSKACHIKTETFTYEEKEQQLVNDCVKELRETNAQMSR
FT                   MTEELSGKSDELLRYQEEISSLLSQIVDLQHKLKEHVIEKEELRLHLQASKDAQRQLTM
FT                   ELHELQDRNMECLGMLHESQEEIKELRSKSGPSAHLCFSQSYGVFTGESLAAEIEGTMR
FT                   KKLSLDEESVSKQKAQQKRVFDTVKVANDTRGRSVTFPVLLPIPGSNRSSVIMTAKPFE
FT                   SGVQPAEDKTLLSPGGSTEVPGNSQPTNPPGSPEDSDLATALHRLSLRRQNYLSEKQFF
FT                   AEEWERKIQILAEQEEEVSSCDAPTENLASVCTDQSETTDLGSASCLRGFMPEKLQIVK
FT                   PLEGSQTLHHWQQLAQPNLGTILDPRPGVITKGFTQVPKDVVYHISDLEEDEEEGITFQ
FT                   VQQPLQLEQKPALPTPVTGIFLPPMTSAGGPGTVATSNPGKCLSFTNSTFTFTTCRILH
FT                   PSDITQVTPSSGFPSLACGSSASSSSNTAVNSPAASYRLSIGESITNRRDSTITFSSTR
FT                   SLAKLLQERGISAKVYHSPASENPLLQPCPKALATPSTPPNSPAQSPCSSPLPFEPRVH
FT                   VSENFLASRPAETFLQEMYGLRPSRAPPDVGQLKMNLVDRLKRLGIARVVKTPDPQENG
FT                   KSREAEMGLQKPDPAVYLNSGGSLLCGLRRNQSLPVMMGSFGAPVCTTSPKMGILKED"
FT   assembly_gap    7199463..7199482
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7201228..7207016
FT                   /estimated_length=5789
FT                   /gap_type="unknown"
FT   gene            <7239699..7261791
FT                   /locus_tag="mCG_117847"
FT                   /note="gene_id=mCG117847.2"
FT   mRNA            join(<7239699..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257238,7258306..7258477,7258753..7258857,
FT                   7258995..7259239,7259658..7259700,7260369..7261791)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT189302"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189302.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<7239699..7239951,7243061..7243167,7246036..7246116,
FT                   7246509..7246675,7251391..7251490,7254608..7254729,
FT                   7255792..7255900,7257115..7257238,7258306..7258477,
FT                   7258753..7258857,7258995..7259239,7259658..7259700,
FT                   7260369..7261189)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT189301"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189301.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(7239721..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257238,7258306..7258477,7258753..7258857,
FT                   7258995..7259239,7259658..7259700,7260369..7260780,
FT                   7260926..7261195)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT118993"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT118993.1
FT                   created on 24-SEP-2002"
FT   mRNA            join(7239721..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257238,7258753..7258857,7258995..7259239,
FT                   7259658..7259700,7260369..7260780,7260926..7261195)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT173668"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT173668.0
FT                   created on 24-SEP-2002"
FT   mRNA            join(7239722..7239951,7243061..7243167,7246036..7246116,
FT                   7246509..7246680,7251391..7251490,7254608..7254729,
FT                   7255792..7255900,7257115..7257238,7258306..7258477,
FT                   7258753..7258857,7258995..7259239,7259658..7259700,
FT                   7260369..7260780,7260926..7261195)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT173667"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT173667.0
FT                   created on 24-SEP-2002"
FT   mRNA            join(<7239741..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257614)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT189300"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189300.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<7239905..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257238,7258753..7258857,7258995..7259239,
FT                   7259658..7259700,7260369..7261195)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT189299"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189299.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<7243147..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257238,
FT                   7258306..7258477,7258753..7258857,7258995..7259239,
FT                   7259658..7259700,7260369..7260512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_g"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189302.0
FT                   protein_id=mCP110256.0 isoform=CRA_g"
FT                   /protein_id="EDL00110.1"
FT                   /translation="SDSMSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPP
FT                   SARASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERL
FT                   KALQRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETL
FT                   IRNILFGAVQGLNYLHQNGCIHRSFKASHILISGDGLVTLSGLSHLHSLLKHGQRHRAV
FT                   FDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLL
FT                   QKLKGPPYSPLDVSIFPQSDSRMRNSQSGVDSGIGESVLVSTGTHTVNSDRLHTPSTKT
FT                   FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILPLLPPAYNRPSASLQ
FT                   PVSPWSELEFQFPDDKDPVWEF"
FT   CDS             join(<7243147..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257238,
FT                   7258753..7258774)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_d"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189299.0
FT                   protein_id=mCP110253.0 isoform=CRA_d"
FT                   /protein_id="EDL00107.1"
FT                   /translation="SDSMSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPP
FT                   SARASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERL
FT                   KALQRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETL
FT                   IRNILFGAVQGLNYLHQNGCIHRIYMDIM"
FT   CDS             join(<7243147..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257320)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_e"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189300.0
FT                   protein_id=mCP110254.0 isoform=CRA_e"
FT                   /protein_id="EDL00108.1"
FT                   /translation="SDSMSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPP
FT                   SARASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERL
FT                   KALQRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETL
FT                   IRNILFGAVQGLNYLHQNGCIHRYLLIYSLHKRKNFKEVIQRNFCKDKC"
FT   CDS             join(7243156..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257238,
FT                   7258306..7258477,7258753..7258857,7258995..7259239,
FT                   7259658..7259700,7260369..7260512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_a"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT118993.1
FT                   protein_id=mCP74458.1 isoform=CRA_a"
FT                   /protein_id="EDL00104.1"
FT                   /translation="MSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPPSAR
FT                   ASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERLKAL
FT                   QRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETLIRN
FT                   ILFGAVQGLNYLHQNGCIHRSFKASHILISGDGLVTLSGLSHLHSLLKHGQRHRAVFDF
FT                   PQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKL
FT                   KGPPYSPLDVSIFPQSDSRMRNSQSGVDSGIGESVLVSTGTHTVNSDRLHTPSTKTFSP
FT                   AFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILPLLPPAYNRPSASLQPVS
FT                   PWSELEFQFPDDKDPVWEF"
FT   CDS             join(7243156..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257238,
FT                   7258753..7258774)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_c"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT173668.0
FT                   protein_id=mCP96587.0 isoform=CRA_c"
FT                   /db_xref="GOA:A0A0R4J299"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:2144047"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J299"
FT                   /protein_id="EDL00106.1"
FT                   /translation="MSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPPSAR
FT                   ASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERLKAL
FT                   QRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETLIRN
FT                   ILFGAVQGLNYLHQNGCIHRIYMDIM"
FT   CDS             join(7246645..7246680,7251391..7251490,7254608..7254729,
FT                   7255792..7255900,7257115..7257238,7258306..7258477,
FT                   7258753..7258857,7258995..7259239,7259658..7259700,
FT                   7260369..7260512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_b"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT173667.0
FT                   protein_id=mCP96586.0 isoform=CRA_b"
FT                   /protein_id="EDL00105.1"
FT                   /translation="MPTHATLKPTGKVDESAISRPPPSARASEVICSTDVSHYELQVEI
FT                   GRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERLKALQRAVILSHFFQHPNITTYW
FT                   TVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETLIRNILFGAVQGLNYLHQNGCIH
FT                   RSFKASHILISGDGLVTLSGLSHLHSLLKHGQRHRAVFDFPQFSTSVQPWLSPELLRQD
FT                   LHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDVSIFPQSDSR
FT                   MRNSQSGVDSGIGESVLVSTGTHTVNSDRLHTPSTKTFSPAFFSLVQLCLQQDPEKRPS
FT                   ASSLLSHVFFKQMKEESQDSILPLLPPAYNRPSASLQPVSPWSELEFQFPDDKDPVWEF
FT                   "
FT   CDS             join(<7246667..7246675,7251391..7251490,7254608..7254729,
FT                   7255792..7255900,7257115..7257238,7258306..7258477,
FT                   7258753..7258857,7258995..7259239,7259658..7259700,
FT                   7260369..7260512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_f"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189301.0
FT                   protein_id=mCP110255.0 isoform=CRA_f"
FT                   /protein_id="EDL00109.1"
FT                   /translation="SQPVDESAISRPPPSARASEVICSTDVSHYELQVEIGRGFDNLTS
FT                   VHLARHTPTGTLVTVKITNLESCTEERLKALQRAVILSHFFQHPNITTYWTVFTVGSWL
FT                   WVISPFMAYGSASQLLRTYFPDGMSETLIRNILFGAVQGLNYLHQNGCIHRSFKASHIL
FT                   ISGDGLVTLSGLSHLHSLLKHGQRHRAVFDFPQFSTSVQPWLSPELLRQDLHGYNVKSD
FT                   IYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDVSIFPQSDSRMRNSQSGVD
FT                   SGIGESVLVSTGTHTVNSDRLHTPSTKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVF
FT                   FKQMKEESQDSILPLLPPAYNRPSASLQPVSPWSELEFQFPDDKDPVWEF"
FT   gene            complement(7263196..7273394)
FT                   /locus_tag="mCG_117846"
FT                   /note="gene_id=mCG117846.1"
FT   mRNA            complement(join(7263196..7263677,7269557..7273394))
FT                   /locus_tag="mCG_117846"
FT                   /product="mCG117846"
FT                   /note="gene_id=mCG117846.1 transcript_id=mCT118992.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(7263339..7263677,7269557..7272871))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117846"
FT                   /product="mCG117846"
FT                   /note="gene_id=mCG117846.1 transcript_id=mCT118992.1
FT                   protein_id=mCP74704.1"
FT                   /protein_id="EDL00111.1"
FT                   /translation="MSSNPKLSRDPSIISGMSSDPKLSRDPSIISAKSSDPNKLSHDPS
FT                   IISGMSSNPNKLSHDPSIISMKLSDMSKLSRESSINASKSSDTNQLSYDPNIISAKSLD
FT                   SNNSSASSSPTVNSDTTTNAAEPSGTKNMLDPVVSTIDSSDKQSKLEWLPNVQGASSVT
FT                   ENINTHRSSNSVNFTSDIDILKQSIVLKSILSKNLQDLSDELFSKSELYTNDEGYSPPP
FT                   SVHSRPSDSTDDRVLGKVQDLNSWRSSKDLLNSQVLLSPVVKNSPQDLLPEGEPGKSSD
FT                   IEDYVSEKLLEAAGRNFPMNRKSSFKKKHLVSEESSSEHVLSGSIYEYVIKQIFTAPIF
FT                   SQLGIGIKSSSEARMDSQNQLLTPWERSVTSHIINYEEKDSDVNLSQSKSIISQIIQSF
FT                   PVNTLLESGVIKVIELDKEHQNSLLDSQTTSSTEQYSDSRSQIKLLSRQNTSSINPLDS
FT                   SVSGAEYTEDCQSISTQESKYPVRDTKSDSPNDTEEMELDSNLESSSSSLDKVKDTDTA
FT                   KLKNILKNIFSIFFKYNQSERRQQPEKDSESLIKHSSSSGSEHLEKTQENFNKADKKVD
FT                   RKPILNPKLRMFLEKLSETEVKNLKSELSKHIQHYLVERLTESGHITKEDLPTIYHKLY
FT                   LMNEKVELKEQTPFQEKYSETVKEIMSFVNNFNHHFIDKHLETKLRGFLSEILQNYFLK
FT                   NLSVSNLFNETDAMALHASMSPVRSKSELGQDIADGNFGSSLKINMQYPVTKSLQHYLQ
FT                   DLSENELLSLKTDLSKYLQVLFIEKLYKSGLVSERQLKGISQEIISLHSPSIPLKHIKT
FT                   NLPFRNESYFMREDSEEQMKYLKNGQNAALHVLLKDKCGETELSRKKERESSFSQILKE
FT                   NLPAIWEQKNIYTREEETLNLIQMQSFLNKNNQANPLTRSPERPSDISLKKQKKDHGFM
FT                   QFTQVEGSVYKTEIQDPYSWDSRSKTIQSKPCLEKTLKMKLLDKRENNNFYKLTAQEKL
FT                   DTEFSSYLKLPNCKIPKEKEPISRLSFPTWKTNTFIHVKPEIGEQSKLDHYYQRLKGNN
FT                   NNNKKHLVTFAQFKNEMETLYRNPYEACNEKRAKISESQSFKYKEKEKSSRPFFFPEDC
FT                   LDRFDDLHAPTVKCPKKSKSGARLLGKSPEDSHNQAKHCARPYTAPEPNKRRESAAWKF
FT                   ASPRMVSAGLLHLYVTPAYGIRKVRSKRKLKEDIEKRPLISEIIQMLDNAE"
FT   assembly_gap    7267720..7267946
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    7273417..7273436
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7275556..7275844
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   gene            complement(7317366..7318145)
FT                   /locus_tag="mCG_141137"
FT                   /note="gene_id=mCG141137.0"
FT   mRNA            complement(7317366..7318145)
FT                   /locus_tag="mCG_141137"
FT                   /product="mCG141137"
FT                   /note="gene_id=mCG141137.0 transcript_id=mCT173263.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(7317783..7317992)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141137"
FT                   /product="mCG141137"
FT                   /note="gene_id=mCG141137.0 transcript_id=mCT173263.0
FT                   protein_id=mCP96182.0"
FT                   /protein_id="EDL00112.1"
FT                   /translation="MPHLPKTSEPEDRPHEERKSIVFSSDEELMPKHPSILKISSSQQE
FT                   VKLRHLPISPERIRRRNLGFSPAE"
FT   gene            complement(7327418..7361566)
FT                   /gene="Als2cr11"
FT                   /locus_tag="mCG_141138"
FT                   /note="gene_id=mCG141138.0"
FT   mRNA            complement(join(7327418..7327523,7329242..7329376,
FT                   7341843..7341988,7343517..7343568,7344731..7344817,
FT                   7361162..7361566))
FT                   /gene="Als2cr11"
FT                   /locus_tag="mCG_141138"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   chromosome region, candidate 11 (human)"
FT                   /note="gene_id=mCG141138.0 transcript_id=mCT173264.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(7329326..7329376,7341843..7341988,
FT                   7343517..7343568,7344731..7344817,7361162..7361524))
FT                   /codon_start=1
FT                   /gene="Als2cr11"
FT                   /locus_tag="mCG_141138"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   chromosome region, candidate 11 (human)"
FT                   /note="gene_id=mCG141138.0 transcript_id=mCT173264.0
FT                   protein_id=mCP96183.0"
FT                   /protein_id="EDL00113.1"
FT                   /translation="MELPPPGNRRVSINNPQETSGRVPTTSAGFPTQSSKISLKRSTYA
FT                   YRPSMMSNRSSGGQSLLPSSILQKTSLNPPGSLQSKPSNLSSVHYADEEGKPLTDKNKD
FT                   KDKGRGKGKGTGTRLLTMLRKTLQGSQSDEMAIANQTPNLIPFGDVVGCLAIHIKSCRQ
FT                   FSQRFLGQQRFNLFMRVSINNIVKCTKIRHLKAVNNEKNLVLRFGEMKYFSVQKCYYSA
FT                   TSRIPGILIP"
FT   assembly_gap    7357981..7358000
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7367257..7387012)
FT                   /locus_tag="mCG_117850"
FT                   /note="gene_id=mCG117850.1"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386933..7387012))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT118996"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT118996.1
FT                   created on 24-SEP-2002"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382541,7383455..7383525,
FT                   7384590..7384621,7386933..7386998))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT173672"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173672.0
FT                   created on 24-SEP-2002"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386612..7386727))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT173670"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173670.0
FT                   created on 24-SEP-2002"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386567..7386677))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT173671"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173671.0
FT                   created on 24-SEP-2002"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386318..7386419))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT173673"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173673.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386933..7386974))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_d"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT118996.1
FT                   protein_id=mCP74480.1 isoform=CRA_d"
FT                   /protein_id="EDL00117.1"
FT                   /translation="MRDDSGPPLEEDQARPPRALPPVPSFIDDIPLSHPKKKKSRTKSS
FT                   LATASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETSLTERPSS
FT                   PSLLRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDEQSTLEHH
FT                   SRFTAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALSVH
FT                   RAFRMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQSLLYLLLA
FT                   LSTVSAFDRTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRIHLYEPSV
FT                   NGSLWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSDVDEHPET
FT                   GTKASP"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382541,7383455..7383525,
FT                   7384590..7384621,7386933..7386974))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_b"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173672.0
FT                   protein_id=mCP96591.0 isoform=CRA_b"
FT                   /protein_id="EDL00115.1"
FT                   /translation="MRDDSGPPLEEDQARPPRALPPVPSHLVCSSFVENNSRMDQQDDL
FT                   VGEDDIPLSHPKKKKSRTKSSLATASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPR
FT                   RQKKIRPPPELETSLTERPSSPSLLRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYA
FT                   SELGVEDEDILTDEQSTLEHHSRFTAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTEN
FT                   IDVSMDVKPSWTTRDVALSVHRAFRMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSN
FT                   LLQQYKPLAYPFQSLLYLLLALSTVSAFDRTDFAKISVAIRNFLALEPTALASFLYFTA
FT                   LILSLSQQMTSDRIHLYEPSVNGSLWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYR
FT                   PGMDLSEELMFFSDVDEHPETGTKASP"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386612..7386629))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_e"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173670.0
FT                   protein_id=mCP96590.0 isoform=CRA_e"
FT                   /protein_id="EDL00118.1"
FT                   /translation="MTSRETRPPRALPPVPSFIDDIPLSHPKKKKSRTKSSLATASSEG
FT                   HAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETSLTERPSSPSLLRNEN
FT                   GIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDEQSTLEHHSRFTAPTG
FT                   VSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALSVHRAFRMVGL
FT                   FSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQSLLYLLLALSTVSAFD
FT                   RTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRIHLYEPSVNGSLWAAE
FT                   AEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSDVDEHPETGTKASP"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386567..7386629))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_a"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173671.0
FT                   protein_id=mCP96592.0 isoform=CRA_a"
FT                   /protein_id="EDL00114.1"
FT                   /translation="MTSRETVGEPPPLLGTPADAERPPRALPPVPSFIDDIPLSHPKKK
FT                   KSRTKSSLATASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETS
FT                   LTERPSSPSLLRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDE
FT                   QSTLEHHSRFTAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTR
FT                   DVALSVHRAFRMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQS
FT                   LLYLLLALSTVSAFDRTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRI
FT                   HLYEPSVNGSLWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSD
FT                   VDEHPETGTKASP"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386318..7386350))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_c"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173673.0
FT                   protein_id=mCP96589.0 isoform=CRA_c"
FT                   /protein_id="EDL00116.1"
FT                   /translation="MGKKQVVSEPQRPPRALPPVPSFIDDIPLSHPKKKKSRTKSSLAT
FT                   ASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETSLTERPSSPSL
FT                   LRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDEQSTLEHHSRF
FT                   TAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALSVHRAF
FT                   RMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQSLLYLLLALST
FT                   VSAFDRTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRIHLYEPSVNGS
FT                   LWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSDVDEHPETGTK
FT                   ASP"
FT   assembly_gap    7371005..7371024
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7387551..>7428176)
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /note="gene_id=mCG117852.2"
FT   mRNA            complement(join(7387551..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403505..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7411458,7412950..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7425195..>7425284))
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), transcript variant mCT189255"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189255.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(7387551..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403505..7403529,
FT                   7406432..7406470,7410364..7410428,7411262..7411458,
FT                   7412950..7413021,7413356..7413441,7415623..7415704,
FT                   7416130..7416261,7417080..7417160,7418268..7418345,
FT                   7423983..7424104,7425195..>7425279))
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), transcript variant mCT189253"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189253.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(7387558..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403505..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7413021,7413356..7413441,7415623..7415704,
FT                   7416130..7416261,7417080..7417160,7418268..7418345,
FT                   7423983..7424104,7424367..7424448,7425195..7425284,
FT                   7428141..>7428176))
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), transcript variant mCT189254"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189254.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(7387558..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403509..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7411458,7412950..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7425195..7425284,
FT                   7428141..7428175))
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), transcript variant mCT118998"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT118998.1
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(7387868..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403509..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7411458,7412950..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7425195..7425270))
FT                   /codon_start=1
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), isoform CRA_a"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT118998.1
FT                   protein_id=mCP74497.1 isoform=CRA_a"
FT                   /protein_id="EDL00119.1"
FT                   /translation="MRQSDRGAELTNEDRALPTPPDPENGLSGILRLLLQELSLFYSRD
FT                   VNGLCLLYDLLHSPWLQALLKVYDCLQRFKEKKLVPDTTHAQILACEVLELLPKASGSP
FT                   EIQELRQVLQAPHCKALLSAHDTVAQKDFEPLLPPLPDNIPDSEEAMRIVCLVKNQQPL
FT                   GATIKRHEITGDILVARVIHGGLVERSGLLYAGDKLVEVNGVSVEGLDPEQVIHILAMS
FT                   CGTIMFKVIPVSAPPVSSQKMVYVRAMIDYWPQEDPDIPCMDAGLPFLKGDILQIVDQN
FT                   DALWWQARKISDLTICAGLIPSNHLLKRKQREFWWSQPYQPHTCLKSTRALSMEEEDSM
FT                   KIDEKCVEADEETFESAKDEFVGDGQKFFIAGFRRSMRLCRRKSHFSQLHASLCCSCSC
FT                   YSAVGAPYEEVVRYQRQPADKHRLIVLVGPSGVGVNELRRQLIGCNPSCFQSAVPHTTR
FT                   FPKSYEMDGREYHYVSRETFESLMYGHKMLEYGEYKGHLYGTSVNAVHAVLDEGKICIM
FT                   DLEPQDIQSARTRDLKPYVIFIKPPNTSSMRHSRKNAKITTDYYVDMKFKDEDLQEMEE
FT                   LAQKMESQFGQFFDHVIVNDNLQDACGQLLSAIQKAQEELQWVPEAWVSPDTES"
FT   assembly_gap    7388919..7389210
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   CDS             complement(join(7398628..7398631,7403505..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7411458,7412950..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7425195..>7425282))
FT                   /codon_start=1
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), isoform CRA_d"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189255.0
FT                   protein_id=mCP110260.0 isoform=CRA_d"
FT                   /protein_id="EDL00122.1"
FT                   /translation="PAGRMRQSDRGAELTNEDRALPTPPDPENGLSGILRLLLQELSLF
FT                   YSRDVNGLCLLYDLLHSPWLQALLKVYDCLQRFKEKKLVPDTTHAQILACEVLELLPKA
FT                   SGSPEIQELRQVLQAPHCKALLSAHDTVAQKDFEPLLPPLPDNIPDSEEAMRIVCLVKN
FT                   QQPLGATIKRHEITGDILVARVIHGGLVERSGLLYAGDKLVEVNGVSVEGLDPEQVIHI
FT                   LAMSCGTIMFKVIPVSAPPVSSQKMVYVRAMIDYWPQEDPDIPCMDAGLPFLKGDILQI
FT                   VDQNDALWWQARKISDLTICAGLIPSNHLLKRKQREFWWSQPYQPHTCLKSTRALSMEE
FT                   EDSMKIDEKCVEADEETFESGN"
FT   CDS             complement(join(7398628..7398631,7403505..7403529,
FT                   7406432..7406470,7410364..7410428,7411262..7411458,
FT                   7412950..7413021,7413356..7413441,7415623..7415704,
FT                   7416130..7416261,7417080..7417160,7418268..7418345,
FT                   7423983..7424104,7425195..>7425279))
FT                   /codon_start=1
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), isoform CRA_b"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189253.0
FT                   protein_id=mCP110258.0 isoform=CRA_b"
FT                   /protein_id="EDL00120.1"
FT                   /translation="AGRMRQSDRGAELTNEDRALPTPPDPENGLSGILRLLLQELSLFY
FT                   SRDVNGLCLLYDLLHSPWLQALLKVYDCLQRFKEKKLVPDTTHAQILACEVLELLPKAS
FT                   GSPEIQELRQVLQAPHCKALLSAHDTVAQKDFEPLLPPLPDNIPDSEEAMRIVCLVKNQ
FT                   QPLGATIKRHEITGDILVARVIHGGLVERSGLLYAGDKLVEVNGVSVEGLDPEQVIHIL
FT                   AMSCGTIMFKVIPVSAPPVSSQKMVYVRAMIDYWPQEDPDIPCMDAGLPFLKGDILQIV
FT                   DQNDALWWQARKISDLTICAGLIPSNHLLKRKQREFWWSQPYQPHTCLKSTREDSMKID
FT                   EKCVEADEETFESGN"
FT   CDS             complement(join(7412773..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7424367..7424448,
FT                   7425195..>7425239))
FT                   /codon_start=1
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), isoform CRA_c"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189254.0
FT                   protein_id=mCP110259.0 isoform=CRA_c"
FT                   /protein_id="EDL00121.1"
FT                   /translation="PMRTELFPRHLILRMNEQNQLCLTWRRKVLETPAWFRDKFPPGLS
FT                   GILRLLLQELSLFYSRDVNGLCLLYDLLHSPWLQALLKVYDCLQRFKEKKLVPDTTHAQ
FT                   ILACEVLELLPKASGSPEIQELRQVLQAPHCKALLSAHDTVAQKDFEPLLPPLPDNIPD
FT                   SEEAMRIVCLVKNQQPLGATIKRHEITGDILVARVIHGGLVERSGLLYAGDKLVEVNGV
FT                   SVEGLDPEQVIHILAMSCGTIMFKVIPVSAPPVSSQKMVRTHSNSMVYNNPSYYSVLDK
FT                   GSVFRLFHSADDLKWRVGKGTQQREWGHHAIKMLHQE"
FT   gene            complement(7429534..7503920)
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /note="gene_id=mCG117848.1"
FT   mRNA            complement(join(7429534..7430824,7433810..7433906,
FT                   7434090..7434239,7434778..7434839,7435016..7435061,
FT                   7436464..7436640,7437064..7437186,7439783..7439940,
FT                   7441552..7441669,7445169..7445336,7445697..7445830,
FT                   7446743..7446820,7447186..7447297,7449801..7449965,
FT                   7450419..7450517,7451907..7451972,7452091..7452293,
FT                   7452706..7452772,7453150..7453220,7454015..7454143,
FT                   7454429..7454560,7458583..7458745,7460727..7460792,
FT                   7462885..7463065,7465714..7465885,7469631..7469813,
FT                   7473235..7473312,7474476..7474572,7475665..7475833,
FT                   7477847..7478204,7481798..7482717,7484623..7484777,
FT                   7487071..7487148,7503842..7503920))
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   homolog (human), transcript variant mCT118994"
FT                   /note="gene_id=mCG117848.1 transcript_id=mCT118994.1
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(7430666..7430824,7433810..7433906,
FT                   7434090..7434239,7434778..7434839,7435016..7435061,
FT                   7436464..7436640,7437064..7437186,7439783..7439940,
FT                   7441552..7441669,7445169..7445336,7445697..7445830,
FT                   7446743..7446820,7447186..7447297,7449801..7449965,
FT                   7450419..7450517,7451907..7451972,7452091..7452293,
FT                   7452706..7452772,7453150..7453220,7454015..7454143,
FT                   7454429..7454560,7458583..7458745,7460727..7460792,
FT                   7462885..7463065,7465714..7465885,7469631..7469813,
FT                   7473235..7473312,7474476..7474572,7475665..7475833,
FT                   7477847..7478204,7481798..7482717,7484623..7484777,
FT                   7487071..7487148,7503535..>7503782))
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   homolog (human), transcript variant mCT189305"
FT                   /note="gene_id=mCG117848.1 transcript_id=mCT189305.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(7430786..7430824,7433810..7433906,
FT                   7434090..7434239,7434778..7434839,7435016..7435061,
FT                   7436464..7436640,7437064..7437186,7439783..7439940,
FT                   7441552..7441669,7445169..7445336,7445697..7445830,
FT                   7446743..7446820,7447186..7447297,7449801..7449965,
FT                   7450419..7450517,7451907..7451972,7452091..7452293,
FT                   7452706..7452772,7453150..7453220,7454015..7454143,
FT                   7454429..7454560,7458583..7458745,7460727..7460792,
FT                   7462885..7463065,7465714..7465885,7469631..7469813,
FT                   7473235..7473312,7474476..7474572,7475665..7475833,
FT                   7477847..7478204,7481798..7482717,7484623..7484777,
FT                   7487071..>7487093))
FT                   /codon_start=1
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   homolog (human), isoform CRA_a"
FT                   /note="gene_id=mCG117848.1 transcript_id=mCT189305.0
FT                   protein_id=mCP110303.0 isoform=CRA_a"
FT                   /protein_id="EDL00123.1"
FT                   /translation="PMDSKKKSSTEAEGSKERGLVHVWQAGSFSLTPERLPGWGGKTVL
FT                   QAALGVRHGVLLTEDGEVYSFGTLPWKSESAEICPSSPLLESALVGHHVITVATGSFHS
FT                   GAVTESGVVYMWGENAAGQCAVANQQYVPEPSPVSISDSETSPSLAVRILQLACGEEHT
FT                   LALSLSREIWAWGTGCQLGLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLP
FT                   PQDLKPVPERCNQCSQLLITMTDKEDHVIISDSHCCPLGVTLSESQAEKHASPAPSPHP
FT                   EALDEQGEVFENTVVEAELNMGSSQTTSGSAISTQQNVVGTAEVSSARTAPSYPDTHAV
FT                   TAYLQKLSEHSMRENHEPGEKPPQVQPLVEEAVPDLHSPPTTSTSALNSLVVSCASAVG
FT                   VRVAATYEAGALSLKKVMNFYSTAPCETAAQSGSASTGPESLKDLREEQVKQESLQGKK
FT                   SSSLMDIREEELEGGSRRLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLP
FT                   SLRTEVWTWGKGKEGQLGHGDVLPRLQPLCVKCLDGKEVIHLEAGGSHSLALTAKSQVY
FT                   SWGSNTFGQLGHSEFPTTVPRLSKVSSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGR
FT                   QDRAEGDTLPENPSGTKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELA
FT                   STERRFYSKLSEIKSQILRPLLSLENLGTVTTVQLLQEVASRFSKLCYLIGQHGASLSS
FT                   YLQGMKEASSLVIMKHSSLFLDSYTEYCTSVSNFLVMGGFQLLAKPAIDFLNKNQELLQ
FT                   DLSEVNDENTQLMEILNMLFFLPIRRLHNYAKVLLKLATCFEVTSPEYQKLQDSSSCYE
FT                   SLALHLGKKRKEAEYTLSFWKTFPGKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNW
FT                   FILFNDALVHAQFSTHHVFPLATLWAEPLSEEAGSVNGLKITTPEEQFTLISSTPQEKT
FT                   KWLRAISQAVDQALRGTSDFPLYGGGSSVQRQEPPISRSAKYTFYKDTRLKDATYDGRW
FT                   LSGKPHGRGVLKWPDGKMYSGMFRNGLEDGYGEYRIPNKALNKEDHYVGHWKEGKMCGQ
FT                   GVYSYASGEVFEGCFQDNMRHGHGLLRSGKLTSSSPSMFIGQWVMDKKAGYGVFDDITR
FT                   GEKYMGMWQDDVCQGNGVVVTQFGLYYEGNFHLNKMMGNGVLLSEDDTIYEGEFSDDWT
FT                   LSGKGTLTMPHGDYIEGYFSGEWGSGIKITGTYFKPSLYESDKDKPKAFRKLGNLAVAA
FT                   DEKWRAVFEECWRQLGCESPGQGEVWKAWDNIAVALTTNRRQHKDSPEILSRSQTQTLE
FT                   SLEYIPQHIGAFSVEKYDDIKKYLIKACDTPLHPLGRLVETLVAVYRMTYVGVGANRRL
FT                   LQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTIPLSAPLPTGRRSFCTGKSDSRSESPE
FT                   PGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDREEDIYWECVLRLNKQPDIALLGFLGV
FT                   QKKFWPATLSILGESKKVLSTTKDACFASAVECLQQISTTFTPSDKLKVIQQTFEEISQ
FT                   SVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIEDLMDPFLQHGEQGIMFTT
FT                   LKACYFQIQREKLN"
FT   CDS             complement(join(7430786..7430824,7433810..7433906,
FT                   7434090..7434239,7434778..7434839,7435016..7435061,
FT                   7436464..7436640,7437064..7437186,7439783..7439940,
FT                   7441552..7441669,7445169..7445336,7445697..7445830,
FT                   7446743..7446820,7447186..7447297,7449801..7449965,
FT                   7450419..7450517,7451907..7451972,7452091..7452293,
FT                   7452706..7452772,7453150..7453220,7454015..7454143,
FT                   7454429..7454560,7458583..7458745,7460727..7460792,
FT                   7462885..7463065,7465714..7465885,7469631..7469813,
FT                   7473235..7473312,7474476..7474572,7475665..7475833,
FT                   7477847..7478204,7481798..7482717,7484623..7484777,
FT                   7487071..7487090))
FT                   /codon_start=1
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   homolog (human), isoform CRA_b"
FT                   /note="gene_id=mCG117848.1 transcript_id=mCT118994.1
FT                   protein_id=mCP74460.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q920R0"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1921268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q920R0"
FT                   /protein_id="EDL00124.1"
FT                   /translation="MDSKKKSSTEAEGSKERGLVHVWQAGSFSLTPERLPGWGGKTVLQ
FT                   AALGVRHGVLLTEDGEVYSFGTLPWKSESAEICPSSPLLESALVGHHVITVATGSFHSG
FT                   AVTESGVVYMWGENAAGQCAVANQQYVPEPSPVSISDSETSPSLAVRILQLACGEEHTL
FT                   ALSLSREIWAWGTGCQLGLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPP
FT                   QDLKPVPERCNQCSQLLITMTDKEDHVIISDSHCCPLGVTLSESQAEKHASPAPSPHPE
FT                   ALDEQGEVFENTVVEAELNMGSSQTTSGSAISTQQNVVGTAEVSSARTAPSYPDTHAVT
FT                   AYLQKLSEHSMRENHEPGEKPPQVQPLVEEAVPDLHSPPTTSTSALNSLVVSCASAVGV
FT                   RVAATYEAGALSLKKVMNFYSTAPCETAAQSGSASTGPESLKDLREEQVKQESLQGKKS
FT                   SSLMDIREEELEGGSRRLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPS
FT                   LRTEVWTWGKGKEGQLGHGDVLPRLQPLCVKCLDGKEVIHLEAGGSHSLALTAKSQVYS
FT                   WGSNTFGQLGHSEFPTTVPRLSKVSSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQ
FT                   DRAEGDTLPENPSGTKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELAS
FT                   TERRFYSKLSEIKSQILRPLLSLENLGTVTTVQLLQEVASRFSKLCYLIGQHGASLSSY
FT                   LQGMKEASSLVIMKHSSLFLDSYTEYCTSVSNFLVMGGFQLLAKPAIDFLNKNQELLQD
FT                   LSEVNDENTQLMEILNMLFFLPIRRLHNYAKVLLKLATCFEVTSPEYQKLQDSSSCYES
FT                   LALHLGKKRKEAEYTLSFWKTFPGKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWF
FT                   ILFNDALVHAQFSTHHVFPLATLWAEPLSEEAGSVNGLKITTPEEQFTLISSTPQEKTK
FT                   WLRAISQAVDQALRGTSDFPLYGGGSSVQRQEPPISRSAKYTFYKDTRLKDATYDGRWL
FT                   SGKPHGRGVLKWPDGKMYSGMFRNGLEDGYGEYRIPNKALNKEDHYVGHWKEGKMCGQG
FT                   VYSYASGEVFEGCFQDNMRHGHGLLRSGKLTSSSPSMFIGQWVMDKKAGYGVFDDITRG
FT                   EKYMGMWQDDVCQGNGVVVTQFGLYYEGNFHLNKMMGNGVLLSEDDTIYEGEFSDDWTL
FT                   SGKGTLTMPHGDYIEGYFSGEWGSGIKITGTYFKPSLYESDKDKPKAFRKLGNLAVAAD
FT                   EKWRAVFEECWRQLGCESPGQGEVWKAWDNIAVALTTNRRQHKDSPEILSRSQTQTLES
FT                   LEYIPQHIGAFSVEKYDDIKKYLIKACDTPLHPLGRLVETLVAVYRMTYVGVGANRRLL
FT                   QEAVKEIKSYLKRIFQLVRFLFPELPEEGSTIPLSAPLPTGRRSFCTGKSDSRSESPEP
FT                   GYVVTSSGLLLPVLLPRLYPPLFMLYALDNDREEDIYWECVLRLNKQPDIALLGFLGVQ
FT                   KKFWPATLSILGESKKVLSTTKDACFASAVECLQQISTTFTPSDKLKVIQQTFEEISQS
FT                   VLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIEDLMDPFLQHGEQGIMFTTL
FT                   KACYFQIQREKLN"
FT   assembly_gap    7451007..7451222
FT                   /estimated_length=216
FT                   /gap_type="unknown"
FT   assembly_gap    7466423..7466442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7479959..7480008
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    7510032..7510051
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7519277..7519388
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    7520974..7521100
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   gene            7525338..7620174
FT                   /locus_tag="mCG_117849"
FT                   /note="gene_id=mCG117849.1"
FT   mRNA            join(7525338..7525478,7526225..7526319,7533122..7533201,
FT                   7548087..7548181,7548927..7548989,7555280..7555403,
FT                   7557177..7557297,7568687..7568780,7578291..7578354,
FT                   7611944..7612062,7619897..7620174)
FT                   /locus_tag="mCG_117849"
FT                   /product="mCG117849, transcript variant mCT118995"
FT                   /note="gene_id=mCG117849.1 transcript_id=mCT118995.1
FT                   created on 24-SEP-2002"
FT   mRNA            join(7525338..7525478,7526225..7526319,7533122..7533201,
FT                   7548087..7548181,7548927..7548989,7555280..7555403,
FT                   7557177..7557297,7568687..7568780,7578291..7578354,
FT                   7598382..7598561,7611944..7612062,7619897..7620076)
FT                   /locus_tag="mCG_117849"
FT                   /product="mCG117849, transcript variant mCT173669"
FT                   /note="gene_id=mCG117849.1 transcript_id=mCT173669.0
FT                   created on 24-SEP-2002"
FT   CDS             join(7533159..7533201,7548087..7548181,7548927..7548989,
FT                   7555280..7555403,7557177..7557297,7568687..7568780,
FT                   7578291..7578354,7598382..7598561,7611944..7612053)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117849"
FT                   /product="mCG117849, isoform CRA_b"
FT                   /note="gene_id=mCG117849.1 transcript_id=mCT173669.0
FT                   protein_id=mCP96588.0 isoform=CRA_b"
FT                   /protein_id="EDL00126.1"
FT                   /translation="MNAEEGVPFTAIREASLLKGLKHANIVLLHDIVHTKETLTFVFEY
FT                   MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQRVLHRDLKPQNLLLSHLGELK
FT                   LADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQP
FT                   LFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPAASRETISSFHFSRLGGVPEA
FT                   EDLASQMLKGFPRDRVSAQEALVHDYFSVLPSQLYQLPDEESLFAVSGVKLKPEMCDLS
FT                   ASYRKRHHLVGVNKCW"
FT   CDS             join(7533159..7533201,7548087..7548181,7548927..7548989,
FT                   7555280..7555403,7557177..7557297,7568687..7568780,
FT                   7578291..7578354,7611944..7612053)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117849"
FT                   /product="mCG117849, isoform CRA_a"
FT                   /note="gene_id=mCG117849.1 transcript_id=mCT118995.1
FT                   protein_id=mCP74473.1 isoform=CRA_a"
FT                   /protein_id="EDL00125.1"
FT                   /translation="MNAEEGVPFTAIREASLLKGLKHANIVLLHDIVHTKETLTFVFEY
FT                   MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQRVLHRDLKPQNLLLSHLGELK
FT                   LADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQP
FT                   LFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEESLFAVSGVKLKPEMCDLSA
FT                   SYRKRHHLVGVNKCW"
FT   assembly_gap    7565627..7565646
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7569717..7569762
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    7586816..7586936
FT                   /estimated_length=121
FT                   /gap_type="unknown"
FT   assembly_gap    7603170..7603189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7609285..7609503
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    7615238..7615350
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    7658416..7658634
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    7668204..7668391
FT                   /estimated_length=188
FT                   /gap_type="unknown"
FT   assembly_gap    7673510..7673529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7675921..7676148
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    7686321..7686340
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7692667..7692902
FT                   /estimated_length=236
FT                   /gap_type="unknown"
FT   assembly_gap    7705607..7705626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7714128..7714258
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    7721556..7721808
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    7724997..7725016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7739723..7739742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7748699..7753544
FT                   /locus_tag="mCG_117844"
FT                   /note="gene_id=mCG117844.2"
FT   mRNA            7748699..7753544
FT                   /locus_tag="mCG_117844"
FT                   /product="mCG117844"
FT                   /note="gene_id=mCG117844.2 transcript_id=mCT118990.2
FT                   created on 24-NOV-2004"
FT   CDS             7749557..7751275
FT                   /codon_start=1
FT                   /locus_tag="mCG_117844"
FT                   /product="mCG117844"
FT                   /note="gene_id=mCG117844.2 transcript_id=mCT118990.2
FT                   protein_id=mCP74702.2"
FT                   /db_xref="GOA:Q61090"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026552"
FT                   /db_xref="MGI:MGI:108570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61090"
FT                   /protein_id="EDL00127.1"
FT                   /translation="MRGPGTAASHSPLGLCALVLALLGALPTDTRAQPYHGEKGISVPD
FT                   HGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCS
FT                   MYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQ
FT                   NTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRF
FT                   LGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFS
FT                   YPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMV
FT                   LYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQ
FT                   VDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTK
FT                   TEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGH
FT                   FSPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV"
FT   assembly_gap    7754999..7755018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<7755096..7759221)
FT                   /locus_tag="mCG_146947"
FT                   /note="gene_id=mCG146947.0"
FT   mRNA            complement(join(<7755096..7758322,7758862..7759221))
FT                   /locus_tag="mCG_146947"
FT                   /product="mCG146947"
FT                   /note="gene_id=mCG146947.0 transcript_id=mCT187210.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<7755096..7755492)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146947"
FT                   /product="mCG146947"
FT                   /note="gene_id=mCG146947.0 transcript_id=mCT187210.0
FT                   protein_id=mCP109547.0"
FT                   /protein_id="EDL00128.1"
FT                   /translation="MFSVFVPYLGIYKLLPMFFLNSIYAPLQTLSLYGVSAKMQFLKKT
FT                   HGVSKILRQWLTSQGMLVGTERNERFLLTRAGRDFFTCCVCVCSRVRDQASSITLSCEL
FT                   QGGEMFLGAALRIPLERPKCLSQLFTIR"
FT   assembly_gap    7774025..7774044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(7799578..>7815440)
FT                   /locus_tag="mCG_145853"
FT                   /note="gene_id=mCG145853.0"
FT   mRNA            complement(join(7799578..7799829,7809086..7809196,
FT                   7815338..>7815440))
FT                   /locus_tag="mCG_145853"
FT                   /product="mCG145853"
FT                   /note="gene_id=mCG145853.0 transcript_id=mCT185961.0
FT                   created on 03-JUL-2003"
FT   CDS             complement(join(7799812..7799829,7809086..7809196,
FT                   7815338..>7815421))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145853"
FT                   /product="mCG145853"
FT                   /note="gene_id=mCG145853.0 transcript_id=mCT185961.0
FT                   protein_id=mCP107686.0"
FT                   /protein_id="EDL00129.1"
FT                   /translation="SDLFGVRDPSEGGGSKTPAGWIITQQRKVLPSLRLLAQAAGWQPA
FT                   LPWRCPVITAFWLRSSFYQVVCFPA"
FT   gene            complement(7801398..7803819)
FT                   /locus_tag="mCG_146950"
FT                   /note="gene_id=mCG146950.0"
FT   mRNA            complement(join(7801398..7801635,7803634..7803819))
FT                   /locus_tag="mCG_146950"
FT                   /product="mCG146950"
FT                   /note="gene_id=mCG146950.0 transcript_id=mCT187213.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7801484..7801600)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146950"
FT                   /product="mCG146950"
FT                   /note="gene_id=mCG146950.0 transcript_id=mCT187213.0
FT                   protein_id=mCP109549.0"
FT                   /protein_id="EDL00130.1"
FT                   /translation="MVGRSQNSRDNKGTIRQTGLLQTQKTNSEEACKTECFK"
FT   assembly_gap    7806845..7806958
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   gene            7815480..7895548
FT                   /locus_tag="mCG_116548"
FT                   /note="gene_id=mCG116548.1"
FT   mRNA            join(7815480..7815736,7816562..7816689,7822717..7822885,
FT                   7824647..7824865,7829208..7829372,7833155..7833265,
FT                   7848958..7849037,7872762..7872834,7890112..7890202,
FT                   7892482..7892632,7893195..7893309,7895020..7895548)
FT                   /locus_tag="mCG_116548"
FT                   /product="mCG116548"
FT                   /note="gene_id=mCG116548.1 transcript_id=mCT173807.0
FT                   created on 01-APR-2003"
FT   CDS             join(7816591..7816689,7822717..7822885,7824647..7824865,
FT                   7829208..7829372,7833155..7833265,7848958..7849037,
FT                   7872762..7872834,7890112..7890202,7892482..7892632,
FT                   7893195..7893309,7895020..7895396)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116548"
FT                   /product="mCG116548"
FT                   /note="gene_id=mCG116548.1 transcript_id=mCT173807.0
FT                   protein_id=mCP96726.0"
FT                   /protein_id="EDL00131.1"
FT                   /translation="MDQGSVAQNHSNPDTHLMSVRRQLWQEDELQAEALRTLKLPPVSE
FT                   EPPGVLKPRRSRFKDSEPPKELFIIPMEIHFHAAQPPKEKASRRGARHPESEPEEATPL
FT                   WWPPMKHLYLERPRGITVHLPVDSSQDTPSPQGSSSLPPASYKARQRKVLSGEEGRQGD
FT                   GDILAQSVNQPLGLLPPMKGKKSSEIQRDMDRTRTSGFSSPTGCPNERAPPAGPEDSRD
FT                   LTLKHFLLSPDGENVCLTLPRLMGTEVLPLGQANAGAGASLHGNLYETSSRLAQAAESQ
FT                   ERGSELDSHEEPGGPLRGNAKDSQDPELRNKTLACLSTSLAEYNQPSEADTLKSMDGDY
FT                   NVHHLHRGPLKREPAFPKKLASETPRKKKKRRSKLLNQKTGVGINHGKDLVDKAKRKKR
FT                   TKTHQAKALKKEREERGLGQAEAAGGKPKHSKIKKKSELTPKKEKLGRKMKRTHKERNM
FT                   EMAAGLSKSDITNSKEAGGTSHQGLLRSHSAAGQLSLELDALESQVAIDGRLSSIQATD
FT                   VASDMECEEERSHEDPSKVWTGVLTRGSSVLT"
FT   assembly_gap    7821429..7821705
FT                   /estimated_length=277
FT                   /gap_type="unknown"
FT   assembly_gap    7853494..7853879
FT                   /estimated_length=386
FT                   /gap_type="unknown"
FT   assembly_gap    7863017..7863320
FT                   /estimated_length=304
FT                   /gap_type="unknown"
FT   assembly_gap    7866734..7866753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7873068..7873087
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7897234..7901438
FT                   /locus_tag="mCG_142695"
FT                   /note="gene_id=mCG142695.0"
FT   mRNA            join(7897234..7897441,7898172..7898344,7899019..7899238,
FT                   7901110..7901438)
FT                   /locus_tag="mCG_142695"
FT                   /product="mCG142695"
FT                   /note="gene_id=mCG142695.0 transcript_id=mCT181745.0
FT                   created on 01-APR-2003"
FT   CDS             join(7897305..7897441,7898172..7898344,7899019..7899238,
FT                   7901110..7901248)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142695"
FT                   /product="mCG142695"
FT                   /note="gene_id=mCG142695.0 transcript_id=mCT181745.0
FT                   protein_id=mCP104667.0"
FT                   /protein_id="EDL00132.1"
FT                   /translation="MRWLKVEQRRREQEELTWLHKEQLEKAEKMKEELELEQQRRTEEN
FT                   RLRKQRLEEERQQQEEAEKKRRLQLQAARERARQQQEELRRKLQEIQRKKQQEAAERAE
FT                   AEKQRQKELEMQLAEEQKRLMEMAEEERLEYQQQKLAAEEKARQEAEERRKQEEEAAKL
FT                   ALEEATKLAQEQIRQKAALDKHLHFHQELSKEASGLQWTQNISRPWVYSYFQSLQIPKP
FT                   "
FT   gene            complement(7904462..7935928)
FT                   /locus_tag="mCG_116538"
FT                   /note="gene_id=mCG116538.1"
FT   mRNA            complement(join(7904462..7905293,7907444..7907515,
FT                   7909543..7909620,7920478..7920552,7935785..7935928))
FT                   /locus_tag="mCG_116538"
FT                   /product="mCG116538"
FT                   /note="gene_id=mCG116538.1 transcript_id=mCT117661.1
FT                   created on 15-JUL-2002"
FT   CDS             complement(join(7905225..7905293,7907444..7907515,
FT                   7909543..7909620,7920478..7920552,7935785..7935796))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116538"
FT                   /product="mCG116538"
FT                   /note="gene_id=mCG116538.1 transcript_id=mCT117661.1
FT                   protein_id=mCP74529.1"
FT                   /protein_id="EDL00133.1"
FT                   /translation="MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLK
FT                   KLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV"
FT   gene            7909054..7916041
FT                   /locus_tag="mCG_146957"
FT                   /note="gene_id=mCG146957.0"
FT   mRNA            join(7909054..7909180,7913270..7916041)
FT                   /locus_tag="mCG_146957"
FT                   /product="mCG146957"
FT                   /note="gene_id=mCG146957.0 transcript_id=mCT187220.0
FT                   created on 13-JAN-2004"
FT   CDS             7914246..7914584
FT                   /codon_start=1
FT                   /locus_tag="mCG_146957"
FT                   /product="mCG146957"
FT                   /note="gene_id=mCG146957.0 transcript_id=mCT187220.0
FT                   protein_id=mCP109556.0"
FT                   /protein_id="EDL00134.1"
FT                   /translation="MLILWFLPQYWPFHPESIGCHFPSVSIPSMADKSSVNHDLAKCCD
FT                   HSLSPHTSIGASLGREGFRYRDYRQLSYFLSAPLLPHSDCEGIQSGTSSTVNTFPFMGR
FT                   LACEELCL"
FT   assembly_gap    7927751..7928186
FT                   /estimated_length=436
FT                   /gap_type="unknown"
FT   assembly_gap    7935398..7935686
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    7947680..7947699
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            7950059..7976581
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /note="gene_id=mCG116536.1"
FT   mRNA            join(7950059..7950303,7955563..7955639,7957414..7957466,
FT                   7961051..7961172,7963396..7963532,7965958..7966022,
FT                   7967886..7968020,7969136..7969281,7969697..7969823,
FT                   7970666..7970829,7971706..7971840,7972076..7972137,
FT                   7974076..7974209,7975568..7975725,7976344..7976581)
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /product="nucleolar protein 5, transcript variant
FT                   mCT117659"
FT                   /note="gene_id=mCG116536.1 transcript_id=mCT117659.1
FT                   created on 15-JUL-2002"
FT   CDS             join(7950259..7950303,7955563..7955639,7957414..7957466,
FT                   7961051..7961172,7963396..7963532,7965958..7966022,
FT                   7967886..7968020,7969136..7969281,7969697..7969823,
FT                   7970666..7970829,7971706..7971840,7972076..7972137,
FT                   7974076..7974209,7975568..7975725,7976344..7976394)
FT                   /codon_start=1
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /product="nucleolar protein 5, isoform CRA_b"
FT                   /note="gene_id=mCG116536.1 transcript_id=mCT117659.1
FT                   protein_id=mCP74519.1 isoform=CRA_b"
FT                   /protein_id="EDL00136.1"
FT                   /translation="MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLK
FT                   HFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNL
FT                   SCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIV
FT                   QAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASASL
FT                   SEFLSEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA
FT                   IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGL
FT                   IYHASLVGQSSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRILE
FT                   DRGIRKISGTGKALAKAEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEEVDKEDEITEKK
FT                   AKKAKIKIKAEVEEEMEEEEAEEEQVVEEEPTVKKKKKKDKKKHIKEEPLSEEEPCTST
FT                   AVPSPEKKKKKKKKKDAED"
FT   mRNA            join(7957611..7957805,7961051..7961172,7963396..7963532,
FT                   7965958..7966022,7967886..7968020,7969136..7969281,
FT                   7969697..7969823,7970666..7970829,7971706..7971840,
FT                   7972076..7972137,7974076..7974209,7975568..7975725,
FT                   7976344..7976581)
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /product="nucleolar protein 5, transcript variant
FT                   mCT170699"
FT                   /note="gene_id=mCG116536.1 transcript_id=mCT170699.0
FT                   created on 15-JUL-2002"
FT   CDS             join(7961065..7961172,7963396..7963532,7965958..7966022,
FT                   7967886..7968020,7969136..7969281,7969697..7969823,
FT                   7970666..7970829,7971706..7971840,7972076..7972137,
FT                   7974076..7974209,7975568..7975725,7976344..7976394)
FT                   /codon_start=1
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /product="nucleolar protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG116536.1 transcript_id=mCT170699.0
FT                   protein_id=mCP93617.0 isoform=CRA_a"
FT                   /protein_id="EDL00135.1"
FT                   /translation="MEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIH
FT                   SPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAIS
FT                   LLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASASLSEFL
FT                   SEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPN
FT                   VTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHA
FT                   SLVGQSSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRILEDRGI
FT                   RKISGTGKALAKAEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEEVDKEDEITEKKAKKA
FT                   KIKIKAEVEEEMEEEEAEEEQVVEEEPTVKKKKKKDKKKHIKEEPLSEEEPCTSTAVPS
FT                   PEKKKKKKKKKDAED"
FT   assembly_gap    7992589..7992730
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    8021129..8021444
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    8025924..8026059
FT                   /estimated_length=136
FT                   /gap_type="unknown"
FT   assembly_gap    8028260..8028282
FT                   /estimated_length=23
FT                   /gap_type="unknown"
FT   gene            8029460..8136199
FT                   /gene="Bmpr2"
FT                   /locus_tag="mCG_116535"
FT                   /note="gene_id=mCG116535.1"
FT   mRNA            join(8029460..8029910,8078934..8079104,8080587..8080757,
FT                   8106771..8106881,8108083..8108174,8110818..8111048,
FT                   8112398..8112512,8116517..8116677,8117633..8117780,
FT                   8124512..8124648,8129121..8129293,8132676..8133955,
FT                   8135575..8136199)
FT                   /gene="Bmpr2"
FT                   /locus_tag="mCG_116535"
FT                   /product="bone morphogenic protein receptor, type II
FT                   (serine/threonine kinase)"
FT                   /note="gene_id=mCG116535.1 transcript_id=mCT117658.1
FT                   created on 16-JUL-2002"
FT   CDS             join(8029835..8029910,8078934..8079104,8080587..8080757,
FT                   8106771..8106881,8108083..8108174,8110818..8111048,
FT                   8112398..8112512,8116517..8116677,8117633..8117780,
FT                   8124512..8124648,8129121..8129293,8132676..8133955,
FT                   8135575..8135825)
FT                   /codon_start=1
FT                   /gene="Bmpr2"
FT                   /locus_tag="mCG_116535"
FT                   /product="bone morphogenic protein receptor, type II
FT                   (serine/threonine kinase)"
FT                   /note="gene_id=mCG116535.1 transcript_id=mCT117658.1
FT                   protein_id=mCP74792.1"
FT                   /protein_id="EDL00137.1"
FT                   /translation="MTSSLHRPFRVPWLLWAVLLVSTTAASQNQERLCAFKDPYQQDLG
FT                   IGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTT
FT                   PPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAV
FT                   LIVALCFGYRMLTGDRKQGLHSMNMMEAAAAEPSLDLDNLKLLELIGRGRYGAVYKGSL
FT                   DERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEY
FT                   YPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVL
FT                   VKNDGACVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCES
FT                   ALKQVDMYALGLIYWEVFMRCTDLFPGESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQ
FT                   RPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPT
FT                   VNPMSTAMQNERNLSHNRRVPKIGPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTP
FT                   LTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYP
FT                   DETHLHATNVAQSIGPTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFS
FT                   GPDPLSSTSSSLLYPLIKLAVEVTGQQDFTQAANGQACLIPDVPPAQIYPLPKQQNLPK
FT                   RPTSLPLNTKNSTKEPRLKFGNKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGR
FT                   SHNVNSHAATTQYANGAVPAGQAANIVAHRSQEMLQNQFIGEDTRLNINSSPDEHEPLL
FT                   RREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPCSEQDILTQGVTSTAADPGPS
FT                   KPRRAQRPNSLDLSATNILDGSSIQIGESTQDGKSGSGEKIKRRVKTPYSLKRWRPSTW
FT                   VISTEPLDCEVNNNGSDRAVHSKSSTAVYLAEGGTATTTVSKDIGMNCL"
FT   assembly_gap    8035021..8035181
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    8051471..8051490
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8058740..8058759
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8071066..8071202
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    8150543..8150671
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    8154435..8154454
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8163042..8163660
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    8177886..8179260
FT                   /estimated_length=1375
FT                   /gap_type="unknown"
FT   gene            <8179516..8251192
FT                   /gene="Als2cr13"
FT                   /locus_tag="mCG_116544"
FT                   /note="gene_id=mCG116544.1"
FT   mRNA            join(<8179516..8179585,8214886..8215037,8218768..8218857,
FT                   8224155..8224268,8234801..8234944,8236333..8236558,
FT                   8240730..8240850,8247256..8251192)
FT                   /gene="Als2cr13"
FT                   /locus_tag="mCG_116544"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   chromosome region, candidate 13 (human)"
FT                   /note="gene_id=mCG116544.1 transcript_id=mCT117667.1
FT                   created on 06-SEP-2002"
FT   CDS             join(<8214888..8215037,8218768..8218857,8224155..8224268,
FT                   8234801..8234944,8236333..8236558,8240730..8240850,
FT                   8247256..8247574)
FT                   /codon_start=1
FT                   /gene="Als2cr13"
FT                   /locus_tag="mCG_116544"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   chromosome region, candidate 13 (human)"
FT                   /note="gene_id=mCG116544.1 transcript_id=mCT117667.1
FT                   protein_id=mCP74654.1"
FT                   /protein_id="EDL00138.1"
FT                   /translation="DKTHPPSSSSSSIIRRTSSLDTLAAPYLAGHWPRDIRGQAAPCMR
FT                   DKATQTESAWAEEYEKKKGSHKRSSSWGSTEQLKEIAKLRQQLQRSKHSSRHHRDKERQ
FT                   SPFHGNHAAINQSQAPAPKSTLVPAGPITKSSGSRFRNSVEGLNQEIEIIIKETGEKEE
FT                   QLIPQDIPDGHRAPPPLAQRSSSTRSIDTQTPGGADKGSNNSSRSQSVSPTSFLTISNE
FT                   GSEESPCSADDLLADPRDKENGNNSPLPKYATSPKPNNSYMFKREPPEGCERVKVFEEC
FT                   SPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGM
FT                   TTTLLQPISMASLSTNTEQERVSRGTSTVLPSASLHAPPEPIEEAEG"
FT   assembly_gap    8225313..8225332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8252427..8252446
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8256187..8309258)
FT                   /gene="Ica1l"
FT                   /locus_tag="mCG_116545"
FT                   /note="gene_id=mCG116545.1"
FT   mRNA            complement(join(8256187..8257038,8263252..8263512,
FT                   8269457..8269506,8272182..8272267,8273756..8273854,
FT                   8276057..8276182,8279768..8279966,8281660..8281783,
FT                   8288530..8288602,8294020..8294198,8309206..8309258))
FT                   /gene="Ica1l"
FT                   /locus_tag="mCG_116545"
FT                   /product="islet cell autoantigen 1-like"
FT                   /note="gene_id=mCG116545.1 transcript_id=mCT117668.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(8256923..8257038,8263252..8263512,
FT                   8269457..8269506,8272182..8272267,8273756..8273854,
FT                   8276057..8276182,8279768..8279966,8281660..8281706))
FT                   /codon_start=1
FT                   /gene="Ica1l"
FT                   /locus_tag="mCG_116545"
FT                   /product="islet cell autoantigen 1-like"
FT                   /note="gene_id=mCG116545.1 transcript_id=mCT117668.1
FT                   protein_id=mCP74660.1"
FT                   /protein_id="EDL00139.1"
FT                   /translation="MMDAAGKALCSSAKQRLALCTPLSRLKQEVATFSQRAISDTLVTI
FT                   NRMERARTEYRGALLWMKDASQELDPDTFKQMEKFRKVQNQVRNSKDSFDKLKKDVCQK
FT                   VDLLGASRCNMLSHSLTTYQRTLLGFWEKTAQMMTQIQEACAGFHPYDFLALKRLQDTP
FT                   GNLTADCTEGQTEGSCLTTDLNKVALSEEEEEERFEREPAVARALPRDSLEGDDFEKEF
FT                   SFLNSLLSPTSSSASEFTQECQPACGSPCTGLTSQEPSVGPGSLTSSSQFLPSQLFDLG
FT                   LHADGAFNTPNNGNQDMSAWFNLFADLGPLSNPDAIGHSDDELLNA"
FT   assembly_gap    8270029..8270278
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    8308990..8309176
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   gene            8318227..8319705
FT                   /pseudo
FT                   /locus_tag="mCG_1035585"
FT                   /note="gene_id=mCG1035585.1"
FT   mRNA            join(8318227..8319244,8319652..8319705)
FT                   /pseudo
FT                   /locus_tag="mCG_1035585"
FT                   /note="gene_id=mCG1035585.1 transcript_id=mCT153289.0
FT                   created on 19-MAR-2003"
FT   gene            complement(8343006..8364638)
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /note="gene_id=mCG116539.1"
FT   mRNA            complement(join(8343006..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363865,8364281..8364638))
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, transcript variant
FT                   mCT117662"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT117662.1
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(8343006..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363865,8364183..8364248))
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, transcript variant
FT                   mCT170700"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT170700.0
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(8343006..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8364045))
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, transcript variant
FT                   mCT170701"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT170701.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(8344301..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363685))
FT                   /codon_start=1
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, isoform CRA_a"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT170700.0
FT                   protein_id=mCP93619.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4V9X1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR028599"
FT                   /db_xref="MGI:MGI:1927241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V9X1"
FT                   /protein_id="EDL00140.1"
FT                   /translation="MAQLQARFYSENKKYAVDDVPFSIPAAAEVADLSNIINKLLETKN
FT                   ELHKHVEFDFLIKGQFLRVPLVKHMELENISSEEVVELEYVEKYTAPQPEQCMFHDDWI
FT                   SSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLTASM
FT                   DQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVPTD
FT                   EEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAEEICSASWDHTIR
FT                   VWDVESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTS
FT                   HTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGL
FT                   LLSGGADNKLYSYSYSPTTSHVGA"
FT   CDS             complement(join(8344301..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363685))
FT                   /codon_start=1
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, isoform CRA_a"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT170701.0
FT                   protein_id=mCP93618.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4V9X1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR028599"
FT                   /db_xref="MGI:MGI:1927241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V9X1"
FT                   /protein_id="EDL00141.1"
FT                   /translation="MAQLQARFYSENKKYAVDDVPFSIPAAAEVADLSNIINKLLETKN
FT                   ELHKHVEFDFLIKGQFLRVPLVKHMELENISSEEVVELEYVEKYTAPQPEQCMFHDDWI
FT                   SSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLTASM
FT                   DQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVPTD
FT                   EEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAEEICSASWDHTIR
FT                   VWDVESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTS
FT                   HTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGL
FT                   LLSGGADNKLYSYSYSPTTSHVGA"
FT   CDS             complement(join(8344301..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363685))
FT                   /codon_start=1
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, isoform CRA_a"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT117662.1
FT                   protein_id=mCP74537.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q4V9X1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR028599"
FT                   /db_xref="MGI:MGI:1927241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V9X1"
FT                   /protein_id="EDL00142.1"
FT                   /translation="MAQLQARFYSENKKYAVDDVPFSIPAAAEVADLSNIINKLLETKN
FT                   ELHKHVEFDFLIKGQFLRVPLVKHMELENISSEEVVELEYVEKYTAPQPEQCMFHDDWI
FT                   SSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLTASM
FT                   DQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVPTD
FT                   EEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAEEICSASWDHTIR
FT                   VWDVESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTS
FT                   HTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGL
FT                   LLSGGADNKLYSYSYSPTTSHVGA"
FT   gene            <8364384..8417193
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /note="gene_id=mCG145854.0"
FT   mRNA            join(<8364384..8364445,8368765..8368922,8371449..8371572,
FT                   8374221..8374338,8375465..8375587,8390993..8391053,
FT                   8391221..8391287,8392062..8392176,8394131..8394215,
FT                   8397986..8398175,8402406..8402526,8405342..8405485,
FT                   8407494..8407727,8410153..8410315,8412268..8412331,
FT                   8413527..8413639,8413992..8414361,8416740..8417193)
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /product="calcium response factor, transcript variant
FT                   mCT185962"
FT                   /note="gene_id=mCG145854.0 transcript_id=mCT185962.0
FT                   created on 03-JUL-2003"
FT   mRNA            join(<8364416..8364445,8371449..8371565,8374221..8374338,
FT                   8375360..8375587,8390993..8391053,8392062..8392176,
FT                   8394131..8394215,8397986..8398175,8402406..8402526,
FT                   8405342..8405485,8407494..8407727,8410153..8410315,
FT                   8412268..8412331,8413527..8413639,8413992..8414361,
FT                   8416740..8417193)
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /product="calcium response factor, transcript variant
FT                   mCT189263"
FT                   /note="gene_id=mCG145854.0 transcript_id=mCT189263.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<8374228..8374338,8375360..8375587,8390993..8391053,
FT                   8392062..8392176,8394131..8394215,8397986..8398175,
FT                   8402406..8402526,8405342..8405485,8407494..8407727,
FT                   8410153..8410315,8412268..8412331,8413527..8413639,
FT                   8413992..8414361,8416740..8416846)
FT                   /codon_start=1
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /product="calcium response factor, isoform CRA_b"
FT                   /note="gene_id=mCG145854.0 transcript_id=mCT189263.0
FT                   protein_id=mCP110293.0 isoform=CRA_b"
FT                   /protein_id="EDL00144.1"
FT                   /translation="LIRENGTECEASMEQRHSLAGNCDDGEKSEREAQGFEHRTCMDSG
FT                   DPSFGQNDPPTILPITAPKTYDSLTSQDMPETLTDTQALHEEQFHLLDQNGQPIQYDLQ
FT                   SLGNSTAQMTGMEQVAIPQEPFADEHSPQDISEEKPTGVRADVLEDSTSNYGLRSPASL
FT                   VLPKKAGARLVEEPLLAPLQPLSCNTPMWACRLRSCEKIGDSYRGYCVSETELESVLTF
FT                   HKQQTQTVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSRAVVMECQYGPRRKGF
FT                   QLKKISEQESRSCHLYKATCPARIYIKKVQKFPEYRVPTDPQIDRKIIRLEQEKAFTML
FT                   KKNLMDAGGVLRWYVQLPTQQAHQYHESETPGVPLSPSPFPMSPLEEEEAIVRDENCAL
FT                   PSRLHPQVAHKIQELVSQGVGQVYAVRKQLRKFVERELFKPDEIPERHNLSYFPTVNDI
FT                   KNHIHEVQKSLRTGDVVYNSEIIPATLQWTTDSGNILRETVTVTFAEGNLLGEPIPSKM
FT                   GTSQTQTAVSPEPLSSFPPKIFTHFQALKLQPRLSSPDGSQALVSVDSHASSSPPGLVD
FT                   TVGNAEVDNHSVLLGQSQNPGTDTCLTQDNSTSSSTGHLPESVPNPVAEDQLLEGEDVE
FT                   DAGNPEGSVNRTLLGDVQTVPIQIIDSRPVLVEESLSKNQVKQETNEPTLSTEAKTFLD
FT                   CKKISAT"
FT   gene            8383374..8383867
FT                   /pseudo
FT                   /locus_tag="mCG_116537"
FT                   /note="gene_id=mCG116537.1"
FT   mRNA            8383374..8383867
FT                   /pseudo
FT                   /locus_tag="mCG_116537"
FT                   /note="gene_id=mCG116537.1 transcript_id=mCT117660.0
FT                   created on 16-JUL-2002"
FT   CDS             join(<8391254..8391287,8392062..8392176,8394131..8394215,
FT                   8397986..8398175,8402406..8402526,8405342..8405485,
FT                   8407494..8407727,8410153..8410315,8412268..8412331,
FT                   8413527..8413639,8413992..8414361,8416740..8416846)
FT                   /codon_start=1
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /product="calcium response factor, isoform CRA_a"
FT                   /note="gene_id=mCG145854.0 transcript_id=mCT185962.0
FT                   protein_id=mCP107687.0 isoform=CRA_a"
FT                   /protein_id="EDL00143.1"
FT                   /translation="SWLTLASSQMTNISEEKPTGVRADVLEDSTSNYGLRSPASLVLPK
FT                   KAGARLVEEPLLAPLQPLSCNTPMWACRLRSCEKIGDSYRGYCVSETELESVLTFHKQQ
FT                   TQTVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSRAVVMECQYGPRRKGFQLKK
FT                   ISEQESRSCHLYKATCPARIYIKKVQKFPEYRVPTDPQIDRKIIRLEQEKAFTMLKKNL
FT                   MDAGGVLRWYVQLPTQQAHQYHESETPGVPLSPSPFPMSPLEEEEAIVRDENCALPSRL
FT                   HPQVAHKIQELVSQGVGQVYAVRKQLRKFVERELFKPDEIPERHNLSYFPTVNDIKNHI
FT                   HEVQKSLRTGDVVYNSEIIPATLQWTTDSGNILRETVTVTFAEGNLLGEPIPSKMGTSQ
FT                   TQTAVSPEPLSSFPPKIFTHFQALKLQPRLSSPDGSQALVSVDSHASSSPPGLVDTVGN
FT                   AEVDNHSVLLGQSQNPGTDTCLTQDNSTSSSTGHLPESVPNPVAEDQLLEGEDVEDAGN
FT                   PEGSVNRTLLGDVQTVPIQIIDSRPVLVEESLSKNQVKQETNEPTLSTEAKTFLDCKKI
FT                   SAT"
FT   assembly_gap    8406257..8406276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8438838..8438857
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8447725..8597842
FT                   /locus_tag="mCG_116543"
FT                   /note="gene_id=mCG116543.1"
FT   mRNA            join(8447725..8447984,8460735..8460826,8461246..8461407,
FT                   8466336..8466417,8467095..8467222,8472565..8472647,
FT                   8483427..8483512,8488298..8488604,8490856..8490962,
FT                   8496833..8496916,8501028..8501126,8501212..8501792,
FT                   8502602..8502734,8503328..8503447,8504803..8505107,
FT                   8508771..8508856,8511026..8511115,8513848..8514016,
FT                   8514595..8514728,8517267..8517426,8517536..8517638,
FT                   8519584..8519740,8521126..8521284,8523662..8523821,
FT                   8524883..8524971,8526466..8527026,8527643..8527818,
FT                   8530512..8530665,8533992..8534297,8534616..8534765,
FT                   8536505..8536662,8538366..8538490,8543358..8543484,
FT                   8544146..8544294,8544900..8545033,8545932..8546033,
FT                   8547480..8547575,8548058..8548182,8550216..8550356,
FT                   8553544..8553674,8556148..8556257,8558067..8558184,
FT                   8559100..8559197,8562112..8562228,8571508..8571597,
FT                   8576437..8576546,8577160..8577332,8578384..8578478,
FT                   8585550..8585666,8585904..8586065,8594111..8594259,
FT                   8595378..8595513,8596942..8597842)
FT                   /locus_tag="mCG_116543"
FT                   /product="mCG116543"
FT                   /note="gene_id=mCG116543.1 transcript_id=mCT117666.1
FT                   created on 01-APR-2003"
FT   CDS             join(8503443..8503447,8504803..8505107,8508771..8508856,
FT                   8511026..8511115,8513848..8514016,8514595..8514728,
FT                   8517267..8517426,8517536..8517638,8519584..8519740,
FT                   8521126..8521284,8523662..8523821,8524883..8524971,
FT                   8526466..8527026,8527643..8527818,8530512..8530665,
FT                   8533992..8534297,8534616..8534765,8536505..8536662,
FT                   8538366..8538490,8543358..8543484,8544146..8544294,
FT                   8544900..8545033,8545932..8546033,8547480..8547575,
FT                   8548058..8548182,8550216..8550356,8553544..8553674,
FT                   8556148..8556257,8558067..8558184,8559100..8559197,
FT                   8562112..8562228,8571508..8571597,8576437..8576546,
FT                   8577160..8577332,8578384..8578478,8585550..8585666,
FT                   8585904..8586065,8594111..8594259,8595378..8595513,
FT                   8596942..8597043)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116543"
FT                   /product="mCG116543"
FT                   /note="gene_id=mCG116543.1 transcript_id=mCT117666.1
FT                   protein_id=mCP74609.1"
FT                   /protein_id="EDL00145.1"
FT                   /translation="MSHLLPVVLVQLGKEPLTPPPSQIPDPPFSTPITPHRTSFGGILS
FT                   SASWGGTIEKSKLFTKLISAGTQDSEWGCPTSLEGQLGSVIIFHEALQPPQVKALYLAG
FT                   PNCLSPWKCQDCDMADLPSNILLHYTGKACKNSICLDLSANCLHGRLTGNKVVNWDIKD
FT                   IINCIGGLNVLFPLLEQISHFSEGQTSEAMSENTVPELVTPSEQECMGLASTRASESRL
FT                   EKNLIATFILIVKHFIQRHPINQDNLIQSHGVATLGALLQKVPGSQMDVNVLMAIQLLI
FT                   EQVSLEKNTLLLQQMYQCLLFDFRIWNRGDFPFQIGHIQYLSTIIKDSRRVFRKKYGVQ
FT                   FLLDTLRIYYGHGSTCNELSPDDIRTIRTSLYGLIKYFLCKGGTHEEIQSIIGYIAATN
FT                   EEEQLFGILDILFSLLRTSPTRGQLFLLLFEPGNADILYALLLNQKYSDKLREIIFKVM
FT                   EQMLKCTNVYERSKQRIRLREVGYSGIGLLLNEAPVNTSLIKNLVNQIINTDPVINFKD
FT                   LLSVVYICHRTHVNVRVVLCRKILQILQSQPDAAYQISQQVGWQDTFVRLFLKANFENV
FT                   NSLNKHGKTVSMKENKNMSTEDVKRNFEKLDDEKMMLADVSSDHWSLEDSQSLNSNTPL
FT                   FQEDSSEGELSFKSENQEEFWHSNTSHLSLDLSGIDACELSDSGSQVPDSSPSTPSPVE
FT                   STKSFSLQSDKERSITNEMGFSDDFSFLESQERCEEELFQLLTNILNYVMCKGLEKSDE
FT                   DTWIERGQVFSALTKPGISSELLRPSDEVKLTLLQKMLEWAITENRDAKSSPVTAENAF
FT                   RLMLIVQDFLQSEGLVNSNMWTEKVCAMASAKLNALLQTKVIENQDEACYILGKLEHIL
FT                   SRSIKEQTEIYSFLIPLLRTLVSKIYELLFMNLHLPSLPFTNGSASFFEDFQEYCNSEE
FT                   WQVYIEKYIVPYMKQYEAHTFYDGHENMALYWKNCYEALMVNMHKRDREGGESKLKFQE
FT                   YFVEPFNRKARQENLRYNNMIKQLNSQQLAAVRRWKAIRLYLTCERGPWAEKKQNRIHW
FT                   KLANVENYSRMRLKLVPNYNFKTHEEASALRDNLGVQHLQPSSDSLLLEVVKQVKLSDM
FT                   EEDKLELLEEDMAARVNIDEKEEQNQKEKLVLTEDCELITVIDIIPGRLEVTTQHIYFH
FT                   DNSVEKEDGLGFDFKWPHSQIREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVRNKIY
FT                   SRLLSLHSPTGYGTRSPQELFKASGLTQKWVNREITNFDYLIQINTMAGRTYNDLAQYP
FT                   VFPWILQDYTSEELDLNNPTVFRDLSKPIGVVNEKNAKAMREKYENFEDPMGTIDKFHY
FT                   GTHYSNSAGVMHYLIRVEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNTYDVKEL
FT                   IPEFFYFPEFLENQNEFNLGHLQVSKELVNDVILPRWAKSAEDFIYKHRKALESEYVSA
FT                   HLHEWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQT
FT                   PCQLLKEPHPPRLSAEEAIQKQTKTEISTLNLFQHLTELKSFFIEGISDGIPLLKAIIP
FT                   KNQSRSFMSQGSPELLITVSMNYVIGTHGWLPYDRNISNYFTFIKDQTVTNPKAQRTIS
FT                   GPFAPGLEITSKLFVVSHDAKLLFSAGHWDNSIQVMSLTKGKIVSHNIRHIDIVTCLAT
FT                   DYCGIHLISGSRDTTCMIWQITQQGGTPVGLAPKPFQILYGHTDEILSVGISTELDMAV
FT                   SGSRDGTVIIHTVQKGQYMRTLRLPCESSLFLTIPSLAISWEGHIVVYSSLEEKSVLKD
FT                   KNLLHLFSINGKYLGSQVLSEQISDMCIIGEHIITGSLQGLLSIRELHSLKLSVTPLAM
FT                   RLPIHCVSITKEYSHILVGLEDGKLIVVGVGKPAEMRSGQLSRKLWGSSKRLSQISAGE
FT                   TEYNTQDCK"
FT   assembly_gap    8591537..8591591
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    8607658..8607677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8609393..8654205
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /note="gene_id=mCG116542.1"
FT   mRNA            join(<8609393..8609530,8618194..8618243,8618982..8619148,
FT                   8620586..8620728,8629308..8629475,8632767..8632845,
FT                   8637339..8637454,8638708..8638762,8642185..8642305,
FT                   8645520..8645631,8648550..8648614,8653051..8653140,
FT                   8653258..8654205)
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, transcript variant mCT117665"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT117665.1
FT                   created on 06-SEP-2002"
FT   CDS             join(<8609393..8609530,8618194..8618243,8618982..8619148,
FT                   8620586..8620728,8629308..8629475,8632767..8632845,
FT                   8637339..8637454,8638708..8638762,8642185..8642305,
FT                   8645520..8645631,8648550..8648614,8653051..8653140,
FT                   8653258..8653435)
FT                   /codon_start=1
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, isoform CRA_c"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT117665.1
FT                   protein_id=mCP74597.1 isoform=CRA_c"
FT                   /protein_id="EDL00148.1"
FT                   /translation="LPSCGRHHGAHGRGPRGRARGSMLDFAIFAVTFLLALVGAVLYLY
FT                   PASRQASGIPGLTPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLG
FT                   TTDVLKQHFNPNKTSDPFETMLKSLLGYQSGGGSAGEDHVRRKLYGDAVTASLHSNFPL
FT                   LLQLSEELLDKWLSYPETQHIPLSQHMLGFALKFVTRMVLGSTFEDEQEVIRFQKIHGT
FT                   VWSEIGKGFLDGSLDKNTTRKKQYQEALMQLESTLKKIIKERKGGNFRQHTFIDSLTQG
FT                   KLNEQQILEDCVVFSLASCIITARLCTWTIHFLTTTGEVQKKLCKEIDQVLGEGPITSE
FT                   KIEQLSYCQQVLFETVRTAKLTPVSARLQDIEGKVGPFVIPKETLVLYALGVVLQDPST
FT                   WPLPHRFDPDRFADEPVMKVFSSLGFSGTWECPELSNQLTLFRSRFAYMVTAVLVSVLL
FT                   KRLRLLAVDRQVFEMKYELVTSAREEAWITVSKRH"
FT   mRNA            join(<8609441..8609530,8618194..8618243,8618982..8619148,
FT                   8620586..8620728,8629308..8629475,8632767..8632845,
FT                   8637339..8637454,8638708..8638762,8642185..8642305,
FT                   8645520..8645631,8648550..8648614,8653051..8653140,
FT                   8653285..8653533)
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, transcript variant mCT189315"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT189315.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<8609441..8609530,8618194..8618243,8618982..8619148,
FT                   8620586..8620728,8629308..8629475,8632767..8632845,
FT                   8637339..8637454,8638708..8638762,8642185..8642305,
FT                   8645520..8645631,8648550..8648614,8653051..8653140,
FT                   8653285..8653435)
FT                   /codon_start=1
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT189315.0
FT                   protein_id=mCP110299.0 isoform=CRA_a"
FT                   /protein_id="EDL00146.1"
FT                   /translation="GRARGSMLDFAIFAVTFLLALVGAVLYLYPASRQASGIPGLTPTE
FT                   EKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTTDVLKQHFNPNKTSD
FT                   PFETMLKSLLGYQSGGGSAGEDHVRRKLYGDAVTASLHSNFPLLLQLSEELLDKWLSYP
FT                   ETQHIPLSQHMLGFALKFVTRMVLGSTFEDEQEVIRFQKIHGTVWSEIGKGFLDGSLDK
FT                   NTTRKKQYQEALMQLESTLKKIIKERKGGNFRQHTFIDSLTQGKLNEQQILEDCVVFSL
FT                   ASCIITARLCTWTIHFLTTTGEVQKKLCKEIDQVLGEGPITSEKIEQLSYCQQVLFETV
FT                   RTAKLTPVSARLQDIEGKVGPFVIPKETLVLYALGVVLQDPSTWPLPHRFDPDRFADEP
FT                   VMKVFSSLGFSGTWECPELRFAYMVTAVLVSVLLKRLRLLAVDRQVFEMKYELVTSARE
FT                   EAWITVSKRH"
FT   mRNA            join(<8609461..8609530,8618194..8618243,8620586..8620728,
FT                   8629308..8629475,8632767..8632845,8637339..8637454,
FT                   8638708..8638762,8642185..8642305,8645520..8645631,
FT                   8648550..8648614,8653051..8653140,8653285..8654205)
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, transcript variant mCT189316"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT189316.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<8609487..8609530,8618194..8618243,8620586..8620728,
FT                   8629308..8629475,8632767..8632845,8637339..8637454,
FT                   8638708..8638762,8642185..8642305,8645520..8645631,
FT                   8648550..8648614,8653051..8653140,8653285..8653435)
FT                   /codon_start=1
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, isoform CRA_b"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT189316.0
FT                   protein_id=mCP110300.0 isoform=CRA_b"
FT                   /protein_id="EDL00147.1"
FT                   /translation="RSCWRWWERCCTSTRLPGKLQEFQGLLQLKKTDPFETMLKSLLGY
FT                   QSGGGSAGEDHVRRKLYGDAVTASLHSNFPLLLQLSEELLDKWLSYPETQHIPLSQHML
FT                   GFALKFVTRMVLGSTFEDEQEVIRFQKIHGTVWSEIGKGFLDGSLDKNTTRKKQYQEAL
FT                   MQLESTLKKIIKERKGGNFRQHTFIDSLTQGKLNEQQILEDCVVFSLASCIITARLCTW
FT                   TIHFLTTTGEVQKKLCKEIDQVLGEGPITSEKIEQLSYCQQVLFETVRTAKLTPVSARL
FT                   QDIEGKVGPFVIPKETLVLYALGVVLQDPSTWPLPHRFDPDRFADEPVMKVFSSLGFSG
FT                   TWECPELRFAYMVTAVLVSVLLKRLRLLAVDRQVFEMKYELVTSAREEAWITVSKRH"
FT   assembly_gap    8622953..8622972
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8624755..8624833
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    8627737..8627806
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    8660449..8660633
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   gene            <8675835..8747381
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /note="gene_id=mCG116541.2"
FT   mRNA            join(<8675835..8675971,8700440..8700607,8703253..8703429,
FT                   8705139..8705156,8710182..8710279,8713496..8713642,
FT                   8714314..8714438,8716307..8716489,8719840..8719998,
FT                   8736890..8737063,8742964..8747381)
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, transcript variant mCT173664"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT173664.1
FT                   created on 07-DEC-2004"
FT   mRNA            join(<8675835..8675971,8700440..8700607,8703253..8703429,
FT                   8710182..8710279,8713496..8713642,8714314..8714438,
FT                   8719840..8719998,8730765..8730851,8736890..8737063,
FT                   8742964..8747381)
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, transcript variant mCT117664"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT117664.2
FT                   created on 07-DEC-2004"
FT   mRNA            join(<8675835..8675971,8700440..8700607,8703253..8703429,
FT                   8710182..8710279,8713496..8713642,8714314..8714438,
FT                   8719840..8719998,8736890..8737063,8742964..8747381)
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, transcript variant mCT173663"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT173663.1
FT                   created on 07-DEC-2004"
FT   assembly_gap    8675972..8676393
FT                   /estimated_length=422
FT                   /gap_type="unknown"
FT   CDS             join(<8700440..8700607,8703253..8703429,8705139..8705156,
FT                   8710182..8710279,8713496..8713642,8714314..8714438,
FT                   8716307..8716489,8719840..8719998,8736890..8737063,
FT                   8742964..8743139)
FT                   /codon_start=1
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, isoform CRA_c"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT173664.1
FT                   protein_id=mCP96583.1 isoform=CRA_c"
FT                   /protein_id="EDL00151.1"
FT                   /translation="SPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLR
FT                   RMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDY
FT                   TILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLE
FT                   PVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSREN
FT                   SGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASVPTPLVPATVPSSTAPDAAA
FT                   GGAQSLADGFTSPTPPVISSNPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITS
FT                   QTSLQNQMNGGPFYNQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSD
FT                   PYAEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVT
FT                   GLFPGNYVESIMHYSE"
FT   CDS             join(<8700440..8700607,8703253..8703429,8710182..8710279,
FT                   8713496..8713642,8714314..8714438,8719840..8719998,
FT                   8730765..8730851,8736890..8737063,8742964..8743139)
FT                   /codon_start=1
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, isoform CRA_a"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT117664.2
FT                   protein_id=mCP74593.2 isoform=CRA_a"
FT                   /protein_id="EDL00149.1"
FT                   /translation="SPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLR
FT                   RMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDY
FT                   TILDDIGHGVKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPV
FT                   VPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSV
FT                   GVPIAVPTPSPPSVFPGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQM
FT                   NGGPFYNQNPVSLAPPPPSILQVTPQLPLMGFVARVQENISDTPPPPPPVEEPVFDESP
FT                   PPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGA
FT                   IIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE"
FT   CDS             join(<8700440..8700607,8703253..8703429,8710182..8710279,
FT                   8713496..8713642,8714314..8714438,8719840..8719998,
FT                   8736890..8737063,8742964..8743139)
FT                   /codon_start=1
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, isoform CRA_b"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT173663.1
FT                   protein_id=mCP96582.1 isoform=CRA_b"
FT                   /protein_id="EDL00150.1"
FT                   /translation="SPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLR
FT                   RMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDY
FT                   TILDDIGHGVKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPV
FT                   VPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSV
FT                   GVPIAVPTPSPPSVFPGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQM
FT                   NGGPFYNQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPP
FT                   WAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYV
FT                   ESIMHYSE"
FT   assembly_gap    8711999..8712018
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8749409..8832840)
FT                   /locus_tag="mCG_116540"
FT                   /note="gene_id=mCG116540.1"
FT   mRNA            complement(join(8749409..8756038,8757574..8757817,
FT                   8759436..8759754,8761489..8761609,8762299..8762397,
FT                   8764498..8764608,8765554..8765697,8766629..8766694,
FT                   8767830..8767951,8768899..8769058,8769592..8769669,
FT                   8791670..8792178,8793462..8793567,8799365..8799484,
FT                   8832641..8832840))
FT                   /locus_tag="mCG_116540"
FT                   /product="mCG116540, transcript variant mCT117663"
FT                   /note="gene_id=mCG116540.1 transcript_id=mCT117663.1
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(8749411..8749564,8759612..8759754,
FT                   8761489..8761609,8762299..8762397,8764498..8764608,
FT                   8765554..8765697,8766629..8766694,8767830..8767951,
FT                   8768899..8769058,8769592..8769669,8776491..8776565,
FT                   8785058..8785138,8791670..8792178,8793462..8793567,
FT                   8799365..8799484,8832641..8832840))
FT                   /locus_tag="mCG_116540"
FT                   /product="mCG116540, transcript variant mCT172698"
FT                   /note="gene_id=mCG116540.1 transcript_id=mCT172698.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(8749460..8749564,8759612..8759754,
FT                   8761489..8761609,8762299..8762397,8764498..8764608,
FT                   8765554..8765697,8766629..8766694,8767830..8767951,
FT                   8768899..8769058,8769592..8769669,8776491..8776565,
FT                   8785058..8785138,8791670..8792178,8793462..8793567,
FT                   8799365..8799484))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116540"
FT                   /product="mCG116540, isoform CRA_b"
FT                   /note="gene_id=mCG116540.1 transcript_id=mCT172698.0
FT                   protein_id=mCP95617.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E867"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="MGI:MGI:1924550"
FT                   /db_xref="UniProtKB/TrEMBL:G5E867"
FT                   /protein_id="EDL00153.1"
FT                   /translation="MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDRLTQSLDSD
FT                   KPKEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIG
FT                   SGNSKRQVTEPKVPQKLPAGRHTSKHGTLRGPSSSSNRTTKPSHANYSLDDITAQLEQA
FT                   SLSMDEAAQQSLVEDPKPLVTNQHRRTASAGTVSDAEARSISNSSRSSITSAASSMDSL
FT                   DIDKVTRPQELDLTTHQGQPITEHAISLSCPSKQAKHHSDFTEEQAELTPHSYLDRETS
FT                   LLLRNIAGKPSHLLTKEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMV
FT                   DERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQN
FT                   KLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWL
FT                   KDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPT
FT                   DCCLALKHPQIQKKSQYIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNYQEALKRTESA
FT                   YDWTSLSSSSIKSGSSSSSIPESQSNHSNQSDSGVSDTLPTGHIRSQSTVSSIFSEAWK
FT                   RGTQLEESSKRTRVQFPAPSSGNSKPPITPAPKDPMSSSGLQGT"
FT   CDS             complement(join(8754524..8756038,8757574..8757817,
FT                   8759436..8759754,8761489..8761609,8762299..8762397,
FT                   8764498..8764608,8765554..8765697,8766629..8766694,
FT                   8767830..8767951,8768899..8769058,8769592..8769669,
FT                   8791670..8792178,8793462..8793567,8799365..8799484))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116540"
FT                   /product="mCG116540, isoform CRA_a"
FT                   /note="gene_id=mCG116540.1 transcript_id=mCT117663.1
FT                   protein_id=mCP74575.1 isoform=CRA_a"
FT                   /protein_id="EDL00152.1"
FT                   /translation="MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDRLTQSLDSD
FT                   KPKEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIG
FT                   SGNSKRQVTEPKVPQKLPAGRHTSKHGTLRGPSSSSNRTTKPSHANYSLDDITAQLEQA
FT                   SLSMDEAAQQSLVEDPKPLVTNQHRRTASAGTVSDAEARSISNSSRSSITSAASSMDSL
FT                   DIDKVTRPQELDLTTHQGQPITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDD
FT                   SSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLN
FT                   WTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPE
FT                   IEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYR
FT                   NKYKAPTDCCLALKHPQIQKKSQYIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNYQEA
FT                   LKRTESAYDWTSLSSSSIKSGSSSSSIPESQSNHSNQSDSGVSDTLPTGHIRSQSTVSS
FT                   IFSEAWKRGTQLEESSKVTHKHYFTYKSVSSSVQKPVPFIPLLQSHLVPFHWSFLGETI
FT                   LALSTVTCASLRSSFFITLVHHAQDYWLDFPPLSETNKQTNKMKTQMLCDQEAVCHCSF
FT                   RKRLNPAMHNVSVFESLSLCVFLLLPQSQVPHEKANSAKTAPPTPPPAPPITATVPPQA
FT                   PPKPLVTIPPSASTKTVSPVVAQAVPPTPAPPVPPAKKQPVFPVSHIPPTPPVQPTPHP
FT                   PPTLPKQQSFGVKPPPSPLSPVPSVVKQIASQFPPPPTPPPVDSQPLKSLPASGTPQSP
FT                   PAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPPAPAPAPPPPPPPPPPPPPVPP
FT                   TASPTPDKGGSPGKKTSKMSSPGGKKPPPTPQRNSSIKSGSCAEHPEPKRPSVDSLVSK
FT                   FAPPAESGSPSKETPPPPAAPPKPGKLHLSGVNLPGIHQQGIVSAKASVLSGRGKDVVV
FT                   EFPSPPSDSDFPPPPPEIELPLPPIEIPAVFSGNTSPKVAVVNPQPQLWSKTSVKKAPP
FT                   PTRPKRNDSTRLTQADISEQPAMTTVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITR
FT                   HGSLSSSRMSRAEPTATMDDMALPPPPPELLSDQQKAGFGGSHISGYATLRRGPPPAPP
FT                   KRDQNTKLSRDW"
FT   assembly_gap    8756050..8756286
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   gene            complement(8788733..8789099)
FT                   /locus_tag="mCG_116534"
FT                   /note="gene_id=mCG116534.1"
FT   mRNA            complement(8788733..8789099)
FT                   /locus_tag="mCG_116534"
FT                   /product="mCG116534"
FT                   /note="gene_id=mCG116534.1 transcript_id=mCT117657.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(8788890..8789096)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116534"
FT                   /product="mCG116534"
FT                   /note="gene_id=mCG116534.1 transcript_id=mCT117657.0
FT                   protein_id=mCP74791.1"
FT                   /db_xref="GOA:Q5SWJ8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SWJ8"
FT                   /protein_id="EDL00154.1"
FT                   /translation="MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFA
FT                   IMGFIGFFVKLIHIPINNIIVGG"
FT   assembly_gap    8832924..8832987
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    8855845..8855929
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   gene            complement(8858090..8858791)
FT                   /pseudo
FT                   /locus_tag="mCG_113579"
FT                   /note="gene_id=mCG113579.1"
FT   mRNA            complement(8858090..8858791)
FT                   /pseudo
FT                   /locus_tag="mCG_113579"
FT                   /note="gene_id=mCG113579.1 transcript_id=mCT114664.0
FT                   created on 16-JUL-2002"
FT   assembly_gap    8867363..8867382
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8896732..8900262
FT                   /estimated_length=3531
FT                   /gap_type="unknown"
FT   assembly_gap    8940191..8940210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8947995..8948028
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    8956723..8956742
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <8969914..8971674
FT                   /locus_tag="mCG_1035528"
FT                   /note="gene_id=mCG1035528.1"
FT   mRNA            <8969914..8971674
FT                   /locus_tag="mCG_1035528"
FT                   /product="mCG1035528"
FT                   /note="gene_id=mCG1035528.1 transcript_id=mCT153232.1
FT                   created on 09-SEP-2002"
FT   CDS             8969914..8971134
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035528"
FT                   /product="mCG1035528"
FT                   /note="gene_id=mCG1035528.1 transcript_id=mCT153232.1
FT                   protein_id=mCP74465.0"
FT                   /protein_id="EDL00155.1"
FT                   /translation="MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLR
FT                   GIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQAL
FT                   VLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVF
FT                   DMLNRRYLSPKYIKIFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLE
FT                   VTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINT
FT                   RRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQ
FT                   VSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMP
FT                   LNVADLI"
FT   assembly_gap    8973991..8974116
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   assembly_gap    8995341..8995396
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    9003926..9004122
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   gene            9012059..9036587
FT                   /gene="Cd28"
FT                   /locus_tag="mCG_113576"
FT                   /note="gene_id=mCG113576.1"
FT   mRNA            join(9012059..9012186,9028636..9028992,9030934..9031049,
FT                   9035314..9036587)
FT                   /gene="Cd28"
FT                   /locus_tag="mCG_113576"
FT                   /product="CD28 antigen"
FT                   /note="gene_id=mCG113576.1 transcript_id=mCT114661.1
FT                   created on 16-JUL-2002"
FT   CDS             join(9012132..9012186,9028636..9028992,9030934..9031049,
FT                   9035314..9035442)
FT                   /codon_start=1
FT                   /gene="Cd28"
FT                   /locus_tag="mCG_113576"
FT                   /product="CD28 antigen"
FT                   /note="gene_id=mCG113576.1 transcript_id=mCT114661.1
FT                   protein_id=mCP74563.1"
FT                   /db_xref="GOA:P31041"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008093"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:88327"
FT                   /db_xref="PDB:2NAE"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31041"
FT                   /protein_id="EDL00156.1"
FT                   /translation="MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVSLSCRYSY
FT                   NLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLH
FT                   VNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFC
FT                   YGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP"
FT   gene            complement(9042322..9047422)
FT                   /locus_tag="mCG_146948"
FT                   /note="gene_id=mCG146948.0"
FT   mRNA            complement(join(9042322..9042881,9047278..9047422))
FT                   /locus_tag="mCG_146948"
FT                   /product="mCG146948"
FT                   /note="gene_id=mCG146948.0 transcript_id=mCT187211.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(9042641..9042781)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146948"
FT                   /product="mCG146948"
FT                   /note="gene_id=mCG146948.0 transcript_id=mCT187211.0
FT                   protein_id=mCP109543.0"
FT                   /protein_id="EDL00157.1"
FT                   /translation="MQNHNYRKTELFAALLSQLTFPPSSQLALWRQRRLSVIEMPLHNE
FT                   V"
FT   assembly_gap    9042945..9043002
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            <9044572..9069327
FT                   /locus_tag="mCG_113580"
FT                   /note="gene_id=mCG113580.1"
FT   mRNA            join(<9044572..9044644,9063483..9063566,9066779..9066839,
FT                   9069161..9069327)
FT                   /locus_tag="mCG_113580"
FT                   /product="mCG113580"
FT                   /note="gene_id=mCG113580.1 transcript_id=mCT114665.1
FT                   created on 18-APR-2003"
FT   CDS             join(<9044572..9044644,9063483..9063566,9066779..9066831)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113580"
FT                   /product="mCG113580"
FT                   /note="gene_id=mCG113580.1 transcript_id=mCT114665.1
FT                   protein_id=mCP74594.1"
FT                   /protein_id="EDL00158.1"
FT                   /translation="TLTRPLSSLIAAPPCLSTAAGYTQVSVRWLVDLEVPPGRRLRRAI
FT                   HPCCMTSSPRERRKVLVLLGSFWG"
FT   assembly_gap    9053938..9054697
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   assembly_gap    9100260..9100401
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    9111340..9111359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9137491..9137547
FT                   /estimated_length=57
FT                   /gap_type="unknown"
FT   assembly_gap    9160644..9160769
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            9166252..9166857
FT                   /locus_tag="mCG_113581"
FT                   /note="gene_id=mCG113581.1"
FT   mRNA            9166252..9166857
FT                   /locus_tag="mCG_113581"
FT                   /product="mCG113581"
FT                   /note="gene_id=mCG113581.1 transcript_id=mCT114666.1
FT                   created on 22-OCT-2002"
FT   CDS             9166291..9166620
FT                   /codon_start=1
FT                   /locus_tag="mCG_113581"
FT                   /product="mCG113581"
FT                   /note="gene_id=mCG113581.1 transcript_id=mCT114666.1
FT                   protein_id=mCP74760.1"
FT                   /protein_id="EDL00159.1"
FT                   /translation="MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFW
FT                   YFVSQLKKMKKSPGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAG
FT                   AVTQC"
FT   gene            <9174416..9181218
FT                   /gene="Ctla4"
FT                   /locus_tag="mCG_113577"
FT                   /note="gene_id=mCG113577.1"
FT   mRNA            join(<9174416..9174671,9177815..9178162,9178611..9178720,
FT                   9180001..9181218)
FT                   /gene="Ctla4"
FT                   /locus_tag="mCG_113577"
FT                   /product="cytotoxic T-lymphocyte-associated protein 4"
FT                   /note="gene_id=mCG113577.1 transcript_id=mCT114662.1
FT                   created on 16-JUL-2002"
FT   CDS             join(<9174536..9174671,9177815..9178162,9178611..9178720,
FT                   9180001..9180105)
FT                   /codon_start=1
FT                   /gene="Ctla4"
FT                   /locus_tag="mCG_113577"
FT                   /product="cytotoxic T-lymphocyte-associated protein 4"
FT                   /note="gene_id=mCG113577.1 transcript_id=mCT114662.1
FT                   protein_id=mCP74568.0"
FT                   /protein_id="EDL00160.1"
FT                   /translation="GPQHICPPAMACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSE
FT                   AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTV
FT                   GFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDP
FT                   EPCPDSDFLLWILVAVSLGLFFYSFLVTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEK
FT                   QFQPYFIPIN"
FT   assembly_gap    9194357..9194437
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    9219052..9219071
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            9243417..9264670
FT                   /gene="Icos"
FT                   /locus_tag="mCG_113578"
FT                   /note="gene_id=mCG113578.1"
FT   mRNA            join(9243417..9243516,9259219..9259557,9260127..9260233,
FT                   9261040..9261124,9263222..9264670)
FT                   /gene="Icos"
FT                   /locus_tag="mCG_113578"
FT                   /product="inducible T-cell co-stimulator"
FT                   /note="gene_id=mCG113578.1 transcript_id=mCT114663.1
FT                   created on 16-JUL-2002"
FT   CDS             join(9243459..9243516,9259219..9259557,9260127..9260233,
FT                   9261040..9261124,9263222..9263235)
FT                   /codon_start=1
FT                   /gene="Icos"
FT                   /locus_tag="mCG_113578"
FT                   /product="inducible T-cell co-stimulator"
FT                   /note="gene_id=mCG113578.1 transcript_id=mCT114663.1
FT                   protein_id=mCP74569.1"
FT                   /db_xref="GOA:Q5SUZ7"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="MGI:MGI:1858745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUZ7"
FT                   /protein_id="EDL00161.1"
FT                   /translation="MKPYFCRVFVFCFLIRLLTGEINGSADHRMFSFHNGGVQISCKYP
FT                   ETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQG
FT                   SYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWLPVGCAAFVVVLLFGCILII
FT                   WFSKKKYGSSVHDPNSEYMFMAAVNTNKKSRLAGVTS"
FT   assembly_gap    9251164..9251233
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    9253285..9253375
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    9310722..9310741
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9312461..9312480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9326927..9326946
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9335421..9335969
FT                   /estimated_length=549
FT                   /gap_type="unknown"
FT   gene            9341813..9342364
FT                   /pseudo
FT                   /locus_tag="mCG_1035529"
FT                   /note="gene_id=mCG1035529.1"
FT   mRNA            9341813..9342364
FT                   /pseudo
FT                   /locus_tag="mCG_1035529"
FT                   /note="gene_id=mCG1035529.1 transcript_id=mCT153233.0
FT                   created on 19-MAR-2003"
FT   assembly_gap    9358511..9358530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9406633..9406652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9414153..9414172
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9426735..9426754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9477718..9480563
FT                   /estimated_length=2846
FT                   /gap_type="unknown"
FT   assembly_gap    9499135..9499154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9547339..9547358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9560274..9560367
FT                   /estimated_length=94
FT                   /gap_type="unknown"
FT   assembly_gap    9569053..9569294
FT                   /estimated_length=242
FT                   /gap_type="unknown"
FT   assembly_gap    9570625..9570644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9616662..9616681
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9627857..9628951
FT                   /estimated_length=1095
FT                   /gap_type="unknown"
FT   assembly_gap    9632268..9632287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <9644731..9662064
FT                   /locus_tag="mCG_144499"
FT                   /note="gene_id=mCG144499.0"
FT   mRNA            join(<9644731..9644856,9645310..9645468,9646296..9646529,
FT                   9660268..9660367,9661791..9662064)
FT                   /locus_tag="mCG_144499"
FT                   /product="mCG144499"
FT                   /note="gene_id=mCG144499.0 transcript_id=mCT183923.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<9646363..9646529,9660268..9660358)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144499"
FT                   /product="mCG144499"
FT                   /note="gene_id=mCG144499.0 transcript_id=mCT183923.0
FT                   protein_id=mCP106106.0"
FT                   /protein_id="EDL00162.1"
FT                   /translation="SAVNWQRSVLMNIKGSAWLIPPLMLIPQSSHWGLLAWSIVAPFVL
FT                   PGFSTRPETSRVIVLAGFVCSLDTAGVITEKGASVEEMPP"
FT   assembly_gap    9665443..9665772
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    9683406..9683425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9723776..9723975
FT                   /estimated_length=200
FT                   /gap_type="unknown"
FT   assembly_gap    9758268..9764507
FT                   /estimated_length=6240
FT                   /gap_type="unknown"
FT   assembly_gap    9777498..9785863
FT                   /estimated_length=8366
FT                   /gap_type="unknown"
FT   assembly_gap    9791990..9792457
FT                   /estimated_length=468
FT                   /gap_type="unknown"
FT   assembly_gap    9809201..9809672
FT                   /estimated_length=472
FT                   /gap_type="unknown"
FT   assembly_gap    9834830..9835036
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    9837989..9838402
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    9847043..9850630
FT                   /estimated_length=3588
FT                   /gap_type="unknown"
FT   assembly_gap    9874544..9874563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9878471..9878948
FT                   /estimated_length=478
FT                   /gap_type="unknown"
FT   gene            complement(9882090..9886319)
FT                   /locus_tag="mCG_1035661"
FT                   /note="gene_id=mCG1035661.1"
FT   mRNA            complement(join(9882090..9882402,9885780..9886319))
FT                   /locus_tag="mCG_1035661"
FT                   /product="mCG1035661"
FT                   /note="gene_id=mCG1035661.1 transcript_id=mCT153365.0
FT                   created on 09-SEP-2002"
FT   assembly_gap    9883597..9883670
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   CDS             complement(9885922..9886077)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035661"
FT                   /product="mCG1035661"
FT                   /note="gene_id=mCG1035661.1 transcript_id=mCT153365.0
FT                   protein_id=mCP74788.1"
FT                   /protein_id="EDL00163.1"
FT                   /translation="MECSTALITLTNDDMNAKAKVQLLGKLFTKVCLSSDLKHRQKTKA
FT                   GYQSLL"
FT   gene            9903991..10610909
FT                   /locus_tag="mCG_113371"
FT                   /note="gene_id=mCG113371.1"
FT   mRNA            join(9903991..9904530,10032892..10032993,
FT                   10275133..10275304,10341204..10341313,10409510..10409598,
FT                   10418596..10418682,10424098..10424223,10425771..10425943,
FT                   10428741..10428880,10431016..10431144,10463283..10463468,
FT                   10476240..10476410,10481129..10481261,10496436..10496535,
FT                   10505094..10505209,10542206..10542250,10609731..10609937,
FT                   10610667..10610909)
FT                   /locus_tag="mCG_113371"
FT                   /product="mCG113371, transcript variant mCT114449"
FT                   /note="gene_id=mCG113371.1 transcript_id=mCT114449.1
FT                   created on 26-MAR-2003"
FT   mRNA            join(<9904167..9904530,10032892..10032993,
FT                   10275133..10275304,10341204..10341313,10409510..10409598,
FT                   10418596..10418682,10424098..10424223,10425771..10426129,
FT                   10428741..10428880,10431016..10431144,10463283..10463468,
FT                   10476240..10476410,10481129..10481261,10496436..10496535,
FT                   10505094..10505209,10542206..10542250,10609731..10609937,
FT                   10610667..>10610795)
FT                   /locus_tag="mCG_113371"
FT                   /product="mCG113371, transcript variant mCT189258"
FT                   /note="gene_id=mCG113371.1 transcript_id=mCT189258.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<9904168..9904530,10032892..10032993,
FT                   10275133..10275304,10341204..10341313,10409510..10409598,
FT                   10418596..10418682,10424098..10424223,10425771..10426129,
FT                   10428741..10428880,10431016..10431144,10463283..10463468,
FT                   10476240..10476410,10481129..10481261,10496436..10496535,
FT                   10505094..10505209,10542206..10542250,10609731..10609937,
FT                   10610667..>10610795)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113371"
FT                   /product="mCG113371, isoform CRA_b"
FT                   /note="gene_id=mCG113371.1 transcript_id=mCT189258.0
FT                   protein_id=mCP110237.0 isoform=CRA_b"
FT                   /protein_id="EDL00165.1"
FT                   /translation="QFHFGAWSLRLRPADPPRPRVSEPAFPPSASRGAAGEQLWVPVPE
FT                   ARVGQRRVRPTSPDGGAVPGGQAPVRPSPAREPRARMKVTVCFGRTGIVVPCKDGQLRV
FT                   RELTQQALQRYLKTRDQDPGYWVKIHHLEYTDGGILDPDDVLADVVEDKDKLIAVFDEQ
FT                   EPLQKTESPGGNPADRQSPDAFETEVAAQLAAFKPVGGEIVVTPSALKLGTPLLVRRSS
FT                   DPAPGPHADAQPSTASLSGQSLKPVVLDSTQNVENKEAMNGEQAGLLSLHRPKDELSDM
FT                   TRAVEISGEGDPLGIHVVPFFSSLSGRILGLFIRGIEENSRCKQEGLFQENECIVKINN
FT                   VELLDKTFAQAQDVFRQAMKSPSVILHVLLPQNREQYEKSVIGPLNIFGNNDGASRTKA
FT                   APPARGKPGLKAVHLTRASSPEGEEPASPQQSKSPRVPRLGRKPSSPSLSPLMGFGSKK
FT                   NAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGAAVKDGRLQSGDRILEV
FT                   NGRDVTGRTQEELVAMLRSTKQGETVSLVIARQEGSFLPRELKGEPDCYALSLESSEQL
FT                   TLEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVN
FT                   GETLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPLEELSECGALSRPGFENC
FT                   QEALSTSRRNDSSILYPFGTYSPQDKRKDLLLPSDGWAENEVPPSPPPHPALEWGLEDF
FT                   SHSSGVDSTGYFPDQHVNFRTVTPVRQPELINLKASKSMDLVPDEGKVQSLADRRSDSP
FT                   GKDFGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPRPHMVRGRGCNESFRAAIDKSYD
FT                   GPEEADADGLSDKSSRSGHTALNCESAPQGNPELDNVENKAKNIKKTKEK"
FT   CDS             join(9904411..9904530,10032892..10032993,
FT                   10275133..10275304,10341204..10341313,10409510..10409598,
FT                   10418596..10418682,10424098..10424223,10425771..10425943,
FT                   10428741..10428880,10431016..10431144,10463283..10463468,
FT                   10476240..10476410,10481129..10481261,10496436..10496535,
FT                   10505094..10505209,10542206..10542250,10609731..10609937,
FT                   10610667..10610908)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113371"
FT                   /product="mCG113371, isoform CRA_a"
FT                   /note="gene_id=mCG113371.1 transcript_id=mCT114449.1
FT                   protein_id=mCP74737.1 isoform=CRA_a"
FT                   /protein_id="EDL00164.1"
FT                   /translation="MKVTVCFGRTGIVVPCKDGQLRVRELTQQALQRYLKTRDQDPGYW
FT                   VKIHHLEYTDGGILDPDDVLADVVEDKDKLIAVFDEQEPLQKTESPGGNPADRQSPDAF
FT                   ETEVAAQLAAFKPVGGEIVVTPSALKLGTPLLVRRSSDPAPGPHADAQPSTASLSGQSL
FT                   KPVVLDSTQNVENKEAMNGEQAGLLSLHRPKDELSDMTRAVEISGEGDPLGIHVVPFFS
FT                   SLSGRILGLFIRGIEENSRCKQEGLFQENECIVKINNVELLDKTFAQAQDVFRQAMKSP
FT                   SVILHVLLPQNREQYEKSVIGPLNIFGNNDGASRTKAAPPARGKPGPEGLGFTVVTRDS
FT                   SIHGPGPIFVKNILPKGAAVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGET
FT                   VSLVIARQEGSFLPRELKGEPDCYALSLESSEQLTLEIPLNDSGSAGLGVSLKGNKSRE
FT                   TGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGETLLGKSNHEAMETLRRSMSMEGN
FT                   IRGMIQLVILRRPERPLEELSECGALSRPGFENCQEALSTSRRNDSSILYPFGTYSPQD
FT                   KRKDLLLPSDGWAENEVPPSPPPHPALEWGLEDFSHSSGVDSTGYFPDQHVNFRTVTPV
FT                   RQPELINLKASKSMDLVPDEGKVQSLADRRSDSPGKDFGPTLGLKKSSSLESLQTAVAE
FT                   VRKNDLPFHRPRPHMVRGRGCNESFRAAIDKSYDGPEEADADGLSDKSSRSGHTALNCE
FT                   SAPQGNPELDNVENKAKNIKKTKEKEKKKGKGKLKVKEKKLKEEHEDAERKMKRKGFGA
FT                   MLR"
FT   assembly_gap    9920743..9920881
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    9934313..9934332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9936384..9940957
FT                   /estimated_length=4574
FT                   /gap_type="unknown"
FT   assembly_gap    9943182..9943383
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    9947607..9947626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9973609..9973628
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9999656..9999675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10001401..10001420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10051690..>10116435)
FT                   /locus_tag="mCG_144500"
FT                   /note="gene_id=mCG144500.0"
FT   mRNA            complement(join(10051690..10051900,10113315..10113429,
FT                   10116028..>10116435))
FT                   /locus_tag="mCG_144500"
FT                   /product="mCG144500"
FT                   /note="gene_id=mCG144500.0 transcript_id=mCT183924.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(10051834..10051900,10113315..>10113412))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144500"
FT                   /product="mCG144500"
FT                   /note="gene_id=mCG144500.0 transcript_id=mCT183924.0
FT                   protein_id=mCP106107.0"
FT                   /protein_id="EDL00166.1"
FT                   /translation="SLSSTAQAGAFSATFYIKFTSSLSFEEIQHRVGFPVTKGDLFFYI
FT                   LNTEDEIPL"
FT   assembly_gap    10079977..10079996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10160295..10160347
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    10187659..10187698
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    10196964..10196983
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10200436..10200455
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10246431..10246538
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    10259386..10259405
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10268104..10268169
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    10283607..10283650
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    10330885..10331043
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    10332737..10332789
FT                   /estimated_length=53
FT                   /gap_type="unknown"
FT   assembly_gap    10364840..10368290
FT                   /estimated_length=3451
FT                   /gap_type="unknown"
FT   assembly_gap    10371714..10371860
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    10376814..10377599
FT                   /estimated_length=786
FT                   /gap_type="unknown"
FT   assembly_gap    10401825..10401844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10451339..10451358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10485338..10487571
FT                   /estimated_length=2234
FT                   /gap_type="unknown"
FT   assembly_gap    10489442..10492876
FT                   /estimated_length=3435
FT                   /gap_type="unknown"
FT   assembly_gap    10496341..10496360
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10518790..10518809
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10535718..10535787
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    10556854..10556873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10563519..10569251
FT                   /estimated_length=5733
FT                   /gap_type="unknown"
FT   assembly_gap    10604803..10604822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10629117..10629136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10665232..10665832
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    10683390..10683409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10722662..10764944)
FT                   /locus_tag="mCG_146952"
FT                   /note="gene_id=mCG146952.0"
FT   mRNA            complement(join(10722662..10723353,10764775..10764944))
FT                   /locus_tag="mCG_146952"
FT                   /product="mCG146952"
FT                   /note="gene_id=mCG146952.0 transcript_id=mCT187215.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10722886..10723044)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146952"
FT                   /product="mCG146952"
FT                   /note="gene_id=mCG146952.0 transcript_id=mCT187215.0
FT                   protein_id=mCP109551.0"
FT                   /protein_id="EDL00167.1"
FT                   /translation="MSGGEYSEPTEHHNFATQSTAEYWLLMLGKNGPLGAVAGCLLPSQ
FT                   CCNTEKA"
FT   assembly_gap    10738504..10738539
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    10765972..10765991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10814978..10814997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10827916..10827935
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10867218..10867694
FT                   /estimated_length=477
FT                   /gap_type="unknown"
FT   assembly_gap    10868912..10868931
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10870650..10870669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10873871..10873942
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    10901703..10901722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10902778..10902797
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10906453..10908117
FT                   /locus_tag="mCG_1035668"
FT                   /note="gene_id=mCG1035668.1"
FT   mRNA            10906453..10908117
FT                   /locus_tag="mCG_1035668"
FT                   /product="mCG1035668"
FT                   /note="gene_id=mCG1035668.1 transcript_id=mCT153372.1
FT                   created on 09-SEP-2002"
FT   CDS             10906582..10906821
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035668"
FT                   /product="mCG1035668"
FT                   /note="gene_id=mCG1035668.1 transcript_id=mCT153372.1
FT                   protein_id=mCP74543.1"
FT                   /protein_id="EDL00168.1"
FT                   /translation="MSGVGKQNRACWSGHTESNVLGMSVPDQVPNSTHLPLEQQVDESV
FT                   CVCVCVCVCVCVCARMSALVRTHKHVITSMEKRR"
FT   assembly_gap    10915456..10915522
FT                   /estimated_length=67
FT                   /gap_type="unknown"
FT   assembly_gap    10919314..10919333
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10928439..10929389
FT                   /pseudo
FT                   /locus_tag="mCG_114995"
FT                   /note="gene_id=mCG114995.1"
FT   mRNA            10928439..10929389
FT                   /pseudo
FT                   /locus_tag="mCG_114995"
FT                   /note="gene_id=mCG114995.1 transcript_id=mCT116093.0
FT                   created on 16-JUL-2002"
FT   assembly_gap    10951346..10951365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10957826..10957850
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   gene            10964725..11076557
FT                   /locus_tag="mCG_115000"
FT                   /note="gene_id=mCG115000.2"
FT   mRNA            join(10964725..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047034,11076003..11076557)
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, transcript variant mCT116098"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT116098.2
FT                   created on 28-SEP-2004"
FT   mRNA            join(10964725..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047019,11073226..11073276,11076003..11076557)
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, transcript variant mCT194529"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT194529.0
FT                   created on 28-SEP-2004"
FT   mRNA            join(10964725..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047034,11056398..11057681)
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, transcript variant mCT173661"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT173661.1
FT                   created on 28-SEP-2004"
FT   CDS             join(10965499..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047034,11076003..11076307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, isoform CRA_c"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT116098.2
FT                   protein_id=mCP74771.2 isoform=CRA_c"
FT                   /protein_id="EDL00171.1"
FT                   /translation="MDMFPLTWVFLALYFSGHEVRSQQDPPCGGRLNSKDAGYITSPGY
FT                   PQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKH
FT                   CGNIAPPTIISSGSVLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESP
FT                   GFPEKYPHNLDCTFTILAKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHV
FT                   GPLIGKYCGTKTPSKLRSSTGILSLTFHTDMAVAKDGFSARYYLIHQEPPENFQCNVPL
FT                   GMESGRIANEQISASSTFSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLT
FT                   AIATQGAISRETQKGYYVKSYKLEVSTNGEDWMVYRHGKNHKIFQANNDATEVVLNKLH
FT                   MPLLTRFIRIRPQTWHLGIALRLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREY
FT                   LWSPSAARLVSSRSGWFPRNPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEA
FT                   RAFVRKFKVSYSLNGKDWEYIQDPRTQQTKLFEGNMHYDTPDIRRFDPVPAQYVRVYPE
FT                   RWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPMDEDATECGENCSFEDD
FT                   KDLQLPSGFNCNFDFPEETCGWVYDHAKWLRSTWISSANPNDRTFPDDKNFLKLQSDGR
FT                   REGQYGRLISPPVHLPRSPVCMEFQYQAMGGHGVALQVVREASQESKLLWVIREDQGSE
FT                   WKHGRIILPSYDMEYQIVFEGVIGKGRSGEISIDDIRISTDVPLENCMEPISAFAGEDF
FT                   KDEYEGDWSNSSSSTSGAGDPSSGKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLL
FT                   YCTCSYSGLSSRSCTTLENYNFELYDGLKHKVKINHQKCCSEA"
FT   CDS             join(10965499..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047019,11073226..11073276,11076003..11076307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, isoform CRA_a"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT194529.0
FT                   protein_id=mCP115558.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8QZY7"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR000998"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR014648"
FT                   /db_xref="InterPro:IPR022579"
FT                   /db_xref="InterPro:IPR027143"
FT                   /db_xref="MGI:MGI:1100492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8QZY7"
FT                   /protein_id="EDL00169.1"
FT                   /translation="MDMFPLTWVFLALYFSGHEVRSQQDPPCGGRLNSKDAGYITSPGY
FT                   PQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKH
FT                   CGNIAPPTIISSGSVLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESP
FT                   GFPEKYPHNLDCTFTILAKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHV
FT                   GPLIGKYCGTKTPSKLRSSTGILSLTFHTDMAVAKDGFSARYYLIHQEPPENFQCNVPL
FT                   GMESGRIANEQISASSTFSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLT
FT                   AIATQGAISRETQKGYYVKSYKLEVSTNGEDWMVYRHGKNHKIFQANNDATEVVLNKLH
FT                   MPLLTRFIRIRPQTWHLGIALRLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREY
FT                   LWSPSAARLVSSRSGWFPRNPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEA
FT                   RAFVRKFKVSYSLNGKDWEYIQDPRTQQTKLFEGNMHYDTPDIRRFDPVPAQYVRVYPE
FT                   RWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPMDEDATECGENCSFEDD
FT                   KDLQLPSGFNCNFDFPEETCGWVYDHAKWLRSTWISSANPNDRTFPDDKNFLKLQSDGR
FT                   REGQYGRLISPPVHLPRSPVCMEFQYQAMGGHGVALQVVREASQESKLLWVIREDQGSE
FT                   WKHGRIILPSYDMEYQIVFEGVIGKGRSGEISIDDIRISTDVPLENCMEPISAFAVDIP
FT                   ETHGGEGYEDEIDDEYEGDWSNSSSSTSGAGDPSSGKEKSWLYTLDPILITIIAMSSLG
FT                   VLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNFELYDGLKHKVKINHQKCCSEA"
FT   CDS             join(10965499..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047034,11056398..11056678)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, isoform CRA_b"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT173661.1
FT                   protein_id=mCP96580.1 isoform=CRA_b"
FT                   /protein_id="EDL00170.1"
FT                   /translation="MDMFPLTWVFLALYFSGHEVRSQQDPPCGGRLNSKDAGYITSPGY
FT                   PQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKH
FT                   CGNIAPPTIISSGSVLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESP
FT                   GFPEKYPHNLDCTFTILAKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHV
FT                   GPLIGKYCGTKTPSKLRSSTGILSLTFHTDMAVAKDGFSARYYLIHQEPPENFQCNVPL
FT                   GMESGRIANEQISASSTFSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLT
FT                   AIATQGAISRETQKGYYVKSYKLEVSTNGEDWMVYRHGKNHKIFQANNDATEVVLNKLH
FT                   MPLLTRFIRIRPQTWHLGIALRLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREY
FT                   LWSPSAARLVSSRSGWFPRNPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEA
FT                   RAFVRKFKVSYSLNGKDWEYIQDPRTQQTKLFEGNMHYDTPDIRRFDPVPAQYVRVYPE
FT                   RWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPMDEDATECGENCSFEDD
FT                   KDLQLPSGFNCNFDFPEETCGWVYDHAKWLRSTWISSANPNDRTFPDDKNFLKLQSDGR
FT                   REGQYGRLISPPVHLPRSPVCMEFQYQAMGGHGVALQVVREASQESKLLWVIREDQGSE
FT                   WKHGRIILPSYDMEYQIVFEGVIGKGRSGEISIDDIRISTDVPLENCMEPISAFAGEDF
FT                   KGGTLPPGTEPTVDTVPVQPIPAYWYYVMAAGGAVLVLASVVLALVLHYHRFRYAAKKT
FT                   DHSITYKTSHYTNGAPLAVEPTLTIKLEQERGSHC"
FT   assembly_gap    10967199..10967218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            10985710..10987432
FT                   /locus_tag="mCG_146945"
FT                   /note="gene_id=mCG146945.0"
FT   mRNA            10985710..10987432
FT                   /locus_tag="mCG_146945"
FT                   /product="mCG146945"
FT                   /note="gene_id=mCG146945.0 transcript_id=mCT187208.0
FT                   created on 13-JAN-2004"
FT   CDS             10985792..10986340
FT                   /codon_start=1
FT                   /locus_tag="mCG_146945"
FT                   /product="mCG146945"
FT                   /note="gene_id=mCG146945.0 transcript_id=mCT187208.0
FT                   protein_id=mCP109545.0"
FT                   /protein_id="EDL00172.1"
FT                   /translation="MCKGGTLKRGLSLALGSTVINMADLHFLSCECCQGRGKRRKAVLV
FT                   TFATNPLPGKKKKKKKKMPDMLLNSISWPGDFPHLLRRGTQSRKQERLGLWGVYGPALP
FT                   AVVMSLLPRSLCPDVLRIMESVVCSGTVQVTIWIKSSSVHSCPDPRSLFFSLGNQITQL
FT                   EVWLQLGTPEVETEPVSVV"
FT   assembly_gap    10987848..10987867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10994291..10994496
FT                   /estimated_length=206
FT                   /gap_type="unknown"
FT   assembly_gap    11004535..11004578
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   gene            complement(11051663..>11055433)
FT                   /locus_tag="mCG_144506"
FT                   /note="gene_id=mCG144506.0"
FT   mRNA            complement(join(11051663..11052301,11055095..11055170,
FT                   11055252..>11055433))
FT                   /locus_tag="mCG_144506"
FT                   /product="mCG144506"
FT                   /note="gene_id=mCG144506.0 transcript_id=mCT183930.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(11052216..11052301,11055095..11055170,
FT                   11055252..>11055356))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144506"
FT                   /product="mCG144506"
FT                   /note="gene_id=mCG144506.0 transcript_id=mCT183930.0
FT                   protein_id=mCP106113.0"
FT                   /protein_id="EDL00173.1"
FT                   /translation="FSQGFTSDENLAQKGTKAVLSLPKADMIFTSEKADGVPEEGQMSC
FT                   LFTASVCGPTFAHHAVGNKMFSIPQPFFINFHPPNSPQSFLIV"
FT   assembly_gap    11060170..11060189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11068402..11069105
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    11074582..11074601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11082005..11093017)
FT                   /locus_tag="mCG_146959"
FT                   /note="gene_id=mCG146959.0"
FT   mRNA            complement(join(11082005..11082596,11092745..11093017))
FT                   /locus_tag="mCG_146959"
FT                   /product="mCG146959"
FT                   /note="gene_id=mCG146959.0 transcript_id=mCT187222.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(11082553..11082596,11092745..11092937))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146959"
FT                   /product="mCG146959"
FT                   /note="gene_id=mCG146959.0 transcript_id=mCT187222.0
FT                   protein_id=mCP109558.0"
FT                   /protein_id="EDL00174.1"
FT                   /translation="MHEDVRRWCDPGGELQKPPSIPSVLALLPVWGSGCELSAVPASHL
FT                   PATILPAITMDDGLLSLWNWVSNLMEAQVSEGL"
FT   assembly_gap    11125910..11128395
FT                   /estimated_length=2486
FT                   /gap_type="unknown"
FT   assembly_gap    11129341..11130521
FT                   /estimated_length=1181
FT                   /gap_type="unknown"
FT   assembly_gap    11147913..11147932
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11149988..11150113
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            complement(11218838..>11319150)
FT                   /locus_tag="mCG_114999"
FT                   /note="gene_id=mCG114999.1"
FT   mRNA            complement(join(11218838..11219052,11223010..11223154,
FT                   11241238..11241314,11242001..11242183,11318988..>11319150))
FT                   /locus_tag="mCG_114999"
FT                   /product="mCG114999"
FT                   /note="gene_id=mCG114999.1 transcript_id=mCT116097.1
FT                   created on 25-SEP-2002"
FT   assembly_gap    11235255..11235398
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   CDS             complement(join(11242062..11242183,11318988..11319150))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114999"
FT                   /product="mCG114999"
FT                   /note="gene_id=mCG114999.1 transcript_id=mCT116097.1
FT                   protein_id=mCP74770.1"
FT                   /protein_id="EDL00175.1"
FT                   /translation="MGPSAELMASTSPKQQLPQFSAAFGHQLSSHSGIPKDLQPSHSSI
FT                   APPTGFTATVTESSAVKISSKDLYLLSHLPGQNVNCCRLAPGLLLFYFA"
FT   assembly_gap    11247090..11247296
FT                   /estimated_length=207
FT                   /gap_type="unknown"
FT   assembly_gap    11254703..11254722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11267054..11267195
FT                   /estimated_length=142
FT                   /gap_type="unknown"
FT   assembly_gap    11293876..11294861
FT                   /estimated_length=986
FT                   /gap_type="unknown"
FT   assembly_gap    11298829..11298848
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11321084..11375151)
FT                   /locus_tag="mCG_115001"
FT                   /note="gene_id=mCG115001.1"
FT   mRNA            complement(join(11321084..11322146,11322985..11323202,
FT                   11326658..11326791,11329138..11329247,11335469..11335693,
FT                   11340100..11340208,11346811..11347541,11354366..11354521,
FT                   11354721..11354811,11366791..11366894,11375046..11375151))
FT                   /locus_tag="mCG_115001"
FT                   /product="mCG115001, transcript variant mCT173662"
FT                   /note="gene_id=mCG115001.1 transcript_id=mCT173662.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11321084..11322146,11322985..11323202,
FT                   11326658..11326791,11329138..11329247,11335469..11335693,
FT                   11340100..11340208,11346811..11347541,11354366..11354612,
FT                   11354721..11354811,11366791..11366894,11375046..11375151))
FT                   /locus_tag="mCG_115001"
FT                   /product="mCG115001, transcript variant mCT116099"
FT                   /note="gene_id=mCG115001.1 transcript_id=mCT116099.1
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(11321960..11322146,11322985..11323202,
FT                   11326658..11326791,11329138..11329247,11335469..11335693,
FT                   11340100..11340208,11346811..11347541,11354366..11354583))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115001"
FT                   /product="mCG115001, isoform CRA_b"
FT                   /note="gene_id=mCG115001.1 transcript_id=mCT116099.1
FT                   protein_id=mCP74508.1 isoform=CRA_b"
FT                   /protein_id="EDL00177.1"
FT                   /translation="MYEGKHIHFSEVDNKPLCSYSPKLCKQRRLNGYAFCIRHVLEDKT
FT                   APFKQCEYVAKYNSQRCTNPIPKSEDRRYCNSHLQVLGFIPKKERKKKTDPVDEVKARH
FT                   QMDAMAFSLTVPTLALKMPNGLDSMSLSPPGARVPLHYLDTELEDPFAFNEEDDDLKKG
FT                   VTVRKKLQSKLAQNRQRQRETEILKVRQEHFSTPPTPPQQHTHLSPLSTSLKPPAPPQG
FT                   SVCKSPQPQNTSLPMQGVAPTTHSIAQIRQASHKRPLPLLPSSRAPISDAPRTDRILMK
FT                   AAAFSPHLSCISRLQRLVKLCTQKRQLDADLFPHLGLDWSEESGEELEDADQASPYQVA
FT                   WSIRETLRHERHTSDDDDMESRSSRVTQLCTYFQQKYKHLCRLERAESRQKKCRHTFRK
FT                   ALLQAASKEPECTGQLIQELRRAACSRASLRQTKLKEVEPAACSGTVKGEQCTKQALPF
FT                   TRHCFQHILLNRSQQLFSSCTAKFADGQQCSVPVFDITHQTPLCEEHAKKMDNFLRGDN
FT                   SRKVQHQQQRKPRKKTKPPALTKKHKKKRRRGPRRPQKPIPPAVPQGNLSMPTSVSLPV
FT                   EASQMRSPSTPELSADELPDDIANEITDIPHDLELNQEDFADVLPRLPDDLQDFDFFEG
FT                   MVSVLLRN"
FT   CDS             complement(join(11321960..11322146,11322985..11323202,
FT                   11326658..11326791,11329138..11329247,11335469..11335693,
FT                   11340100..11340208,11346811..11347444))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115001"
FT                   /product="mCG115001, isoform CRA_a"
FT                   /note="gene_id=mCG115001.1 transcript_id=mCT173662.0
FT                   protein_id=mCP96581.0 isoform=CRA_a"
FT                   /protein_id="EDL00176.1"
FT                   /translation="MDAMAFSLTVPTLALKMPNGLDSMSLSPPGARVPLHYLDTELEDP
FT                   FAFNEEDDDLKKGVTVRKKLQSKLAQNRQRQRETEILKVRQEHFSTPPTPPQQHTHLSP
FT                   LSTSLKPPAPPQGSVCKSPQPQNTSLPMQGVAPTTHSIAQIRQASHKRPLPLLPSSRAP
FT                   ISDAPRTDRILMKAAAFSPHLSCISRLQRLVKLCTQKRQLDADLFPHLGLDWSEESGEE
FT                   LEDADQASPYQVAWSIRETLRHERHTSDDDDMESRSSRVTQLCTYFQQKYKHLCRLERA
FT                   ESRQKKCRHTFRKALLQAASKEPECTGQLIQELRRAACSRASLRQTKLKEVEPAACSGT
FT                   VKGEQCTKQALPFTRHCFQHILLNRSQQLFSSCTAKFADGQQCSVPVFDITHQTPLCEE
FT                   HAKKMDNFLRGDNSRKVQHQQQRKPRKKTKPPALTKKHKKKRRRGPRRPQKPIPPAVPQ
FT                   GNLSMPTSVSLPVEASQMRSPSTPELSADELPDDIANEITDIPHDLELNQEDFADVLPR
FT                   LPDDLQDFDFFEGMVSVLLRN"
FT   assembly_gap    11332172..11332191
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11349236..11349255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11358231..11358340
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    11365591..11365724
FT                   /estimated_length=134
FT                   /gap_type="unknown"
FT   assembly_gap    11373020..11373045
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    11374483..11374966
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   gene            <11375306..11419037
FT                   /locus_tag="mCG_145850"
FT                   /note="gene_id=mCG145850.0"
FT   mRNA            join(<11375306..11375379,11404863..11404929,
FT                   11416967..11417068,11417705..11419037)
FT                   /locus_tag="mCG_145850"
FT                   /product="mCG145850"
FT                   /note="gene_id=mCG145850.0 transcript_id=mCT185958.0
FT                   created on 03-JUL-2003"
FT   gene            11382446..11386616
FT                   /locus_tag="mCG_1035670"
FT                   /note="gene_id=mCG1035670.1"
FT   mRNA            join(11382446..11383134,11386433..11386616)
FT                   /locus_tag="mCG_1035670"
FT                   /product="mCG1035670"
FT                   /note="gene_id=mCG1035670.1 transcript_id=mCT153374.0
FT                   created on 18-MAR-2003"
FT   CDS             join(11382931..11383134,11386433..11386453)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035670"
FT                   /product="mCG1035670"
FT                   /note="gene_id=mCG1035670.1 transcript_id=mCT153374.0
FT                   protein_id=mCP74558.0"
FT                   /protein_id="EDL00179.1"
FT                   /translation="MYEGQLCNLLPTEFILQMSCRNNGSPPFVVGHTGASCCPAQDDVN
FT                   INLREGRWTSLEPNSSHCVCIEEIVSMCR"
FT   assembly_gap    11392571..11392590
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11401257..11401276
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11404338..11437559)
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /note="gene_id=mCG114998.1"
FT   mRNA            complement(join(11404338..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431662,11437353..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT116096"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT116096.1
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11404347..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11429977..11430084,
FT                   11430798..11430889,11431597..11431662,11437353..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT173660"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173660.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11404347..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431662,11432902..11433005,11437353..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT173657"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173657.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11404347..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431662,11437195..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT173658"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173658.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11404347..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431662,11432902..11433005,11437195..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT173659"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173659.0
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11429977..11430084,
FT                   11430798..11430889,11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173660.0
FT                   protein_id=mCP96576.0 isoform=CRA_b"
FT                   /protein_id="EDL00183.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKDQSMMFGSDRSRFLEGK
FT                   RAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMS
FT                   ELSGNVIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILP
FT                   RMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFE
FT                   GNAVAAIAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAG
FT                   VEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKIL
FT                   QDIASGRHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWK
FT                   VMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQG
FT                   HHGDVGAPMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEI
FT                   AGITLPYDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQ
FT                   LTIKDFYMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173657.0
FT                   protein_id=mCP96579.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VD9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="MGI:MGI:2443241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VD9"
FT                   /protein_id="EDL00180.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILT
FT                   NSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDK
FT                   NIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNV
FT                   IDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDI
FT                   NEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAA
FT                   IAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADV
FT                   VLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASG
FT                   RHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILH
FT                   RIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVG
FT                   APMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLP
FT                   YDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDF
FT                   YMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173658.0
FT                   protein_id=mCP96577.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VD9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="MGI:MGI:2443241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VD9"
FT                   /protein_id="EDL00181.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILT
FT                   NSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDK
FT                   NIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNV
FT                   IDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDI
FT                   NEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAA
FT                   IAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADV
FT                   VLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASG
FT                   RHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILH
FT                   RIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVG
FT                   APMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLP
FT                   YDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDF
FT                   YMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173659.0
FT                   protein_id=mCP96578.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VD9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="MGI:MGI:2443241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VD9"
FT                   /protein_id="EDL00182.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILT
FT                   NSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDK
FT                   NIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNV
FT                   IDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDI
FT                   NEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAA
FT                   IAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADV
FT                   VLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASG
FT                   RHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILH
FT                   RIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVG
FT                   APMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLP
FT                   YDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDF
FT                   YMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT116096.1
FT                   protein_id=mCP74738.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VD9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="MGI:MGI:2443241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VD9"
FT                   /protein_id="EDL00184.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILT
FT                   NSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDK
FT                   NIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNV
FT                   IDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDI
FT                   NEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAA
FT                   IAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADV
FT                   VLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASG
FT                   RHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILH
FT                   RIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVG
FT                   APMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLP
FT                   YDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDF
FT                   YMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             join(<11417010..11417068,11417705..11417939)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145850"
FT                   /product="mCG145850"
FT                   /note="gene_id=mCG145850.0 transcript_id=mCT185958.0
FT                   protein_id=mCP107690.0"
FT                   /protein_id="EDL00178.1"
FT                   /translation="KNNICFFHTSNCGIEKIIGTKTIAENSCNTHLQSKYLGGKDRKFF
FT                   CYTEFKASLGYKKLKNQNEIPNSSLEHSLLLLTQLLQWGRSLQCISCQSQLY"
FT   gene            11437681..11440745
FT                   /gene="Eef1b2"
FT                   /locus_tag="mCG_114996"
FT                   /note="gene_id=mCG114996.1"
FT   mRNA            join(11437681..11438058,11438521..11438643,
FT                   11439206..11439332,11439599..11439665,11440015..11440140,
FT                   11440225..11440745)
FT                   /gene="Eef1b2"
FT                   /locus_tag="mCG_114996"
FT                   /product="eukaryotic translation elongation factor 1 beta
FT                   2"
FT                   /note="gene_id=mCG114996.1 transcript_id=mCT116094.1
FT                   created on 16-JUL-2002"
FT   CDS             join(11437979..11438058,11438521..11438643,
FT                   11439206..11439332,11439599..11439665,11440015..11440140,
FT                   11440225..11440379)
FT                   /codon_start=1
FT                   /gene="Eef1b2"
FT                   /locus_tag="mCG_114996"
FT                   /product="eukaryotic translation elongation factor 1 beta
FT                   2"
FT                   /note="gene_id=mCG114996.1 transcript_id=mCT116094.1
FT                   protein_id=mCP74727.1"
FT                   /protein_id="EDL00185.1"
FT                   /translation="MGFGDLKTPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPP
FT                   PADLCHALRWYNHIKSYEKEKASLPGVKKSLGKYGPSSVEDTTGSGAADAKDDDDIDLF
FT                   GSDDEEESEEAKKLREERLAQYESKKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVR
FT                   SIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAF
FT                   NKI"
FT   gene            complement(11443341..11474963)
FT                   /gene="Gpr1"
FT                   /locus_tag="mCG_1035531"
FT                   /note="gene_id=mCG1035531.1"
FT   mRNA            complement(join(11443341..11444872,11470513..11470658,
FT                   11474925..11474963))
FT                   /gene="Gpr1"
FT                   /locus_tag="mCG_1035531"
FT                   /product="G protein-coupled receptor 1"
FT                   /note="gene_id=mCG1035531.1 transcript_id=mCT153235.1
FT                   created on 19-SEP-2002"
FT   CDS             complement(11443781..11444842)
FT                   /codon_start=1
FT                   /gene="Gpr1"
FT                   /locus_tag="mCG_1035531"
FT                   /product="G protein-coupled receptor 1"
FT                   /note="gene_id=mCG1035531.1 transcript_id=mCT153235.1
FT                   protein_id=mCP74656.1"
FT                   /protein_id="EDL00186.1"
FT                   /translation="MEVSKEMLFEELDNYSYALDYYSQESDPEEKVYLGLVHWISLFLY
FT                   ALAFVLGIPGNAIVIWLMGFKWKKTVTTLWFLNLAIADFIFVLFLPLYISYVALSFHWP
FT                   FGLWLCKVNSFIAQLNMFSSVFFLTVISLDRYIHLLHPGLSHRHRTLKSSLVVVILVWL
FT                   LASLLGGPTLYFRDTMEVNNHIICYNNFQEHELTLMRHHVLTWVKFLFGYLFPLLTMSS
FT                   CYLCLIFKMKKRNILISRKHLWMILSVVIAFLVCWTPYHLFSIWELSIHHNSSFQNVLQ
FT                   GGIPLSTGLAFLNSCLNPILYVLISKTFQARFRASVAEVLKRSLWEASCSGTVSEQLRS
FT                   AETKSLSLLETAQ"
FT   assembly_gap    11452648..11452684
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    11460501..11460520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11476978..11477001
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    11494644..11494810
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    11518779..11518975
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    11529174..11529652
FT                   /estimated_length=479
FT                   /gap_type="unknown"
FT   assembly_gap    11530674..11530693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11534263..>11564779
FT                   /locus_tag="mCG_114997"
FT                   /note="gene_id=mCG114997.1"
FT   mRNA            join(11534263..11534471,11536056..11536138,
FT                   11538891..11538943,11542004..11542114,11551923..11552058,
FT                   11556192..11556322,11563912..>11564779)
FT                   /locus_tag="mCG_114997"
FT                   /product="mCG114997, transcript variant mCT116095"
FT                   /note="gene_id=mCG114997.1 transcript_id=mCT116095.1
FT                   created on 18-APR-2003"
FT   mRNA            join(<11534264..11534471,11536056..11536138,
FT                   11538891..11538943,11542004..11542114,11551956..11552058,
FT                   11556192..11556322,11563912..>11564209)
FT                   /locus_tag="mCG_114997"
FT                   /product="mCG114997, transcript variant mCT189306"
FT                   /note="gene_id=mCG114997.1 transcript_id=mCT189306.0
FT                   created on 08-MAR-2004"
FT   assembly_gap    11534484..11534503
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11540340..11540359
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11551619..11551733
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   CDS             join(<11552008..11552058,11556192..11556322,
FT                   11563912..>11564209)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114997"
FT                   /product="mCG114997, isoform CRA_b"
FT                   /note="gene_id=mCG114997.1 transcript_id=mCT189306.0
FT                   protein_id=mCP110298.0 isoform=CRA_b"
FT                   /protein_id="EDL00188.1"
FT                   /translation="FQMEAQSYQEVMKNNGQHLFSSQHRSLTRQSRRRTATNNTLMERF
FT                   LQDVLRHHPYNYQDNRSAPNEPEAAAAAAAAADPGSPEVVVVLDDSDEKEDDTADSGAE
FT                   RNSEDSGSVEEIDYRPGTSQEHAEVAVRPSVIQKLERGQQQSLELAHKVESGVKKV"
FT   CDS             join(11552014..11552058,11556192..11556322,
FT                   11563912..>11564779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114997"
FT                   /product="mCG114997, isoform CRA_a"
FT                   /note="gene_id=mCG114997.1 transcript_id=mCT116095.1
FT                   protein_id=mCP74728.1 isoform=CRA_a"
FT                   /protein_id="EDL00187.1"
FT                   /translation="MEAQSYQEVMKNNGQHLFSSQHRSLTRQSRRRTATNNTLMERFLQ
FT                   DVLRHHPYNYQDNRSAPNEPEAAAAAAAAADPGSPEVVVVLDDSDEKEDDTADSGAERN
FT                   SEDSGSVEEIDYRPGTSQEHAEVAVRPSVIQKLERGQQQSLELAHKVESGVKKVNSVGV
FT                   VQATTSGKKLVRPPVICNAPASSLPSGSFERPVAANSVPRLVLAVASDSFPACDTENLE
FT                   TYFDSPDQGPSNPSSQPKTKDPKKKLSINLDKLLAQRNLRAKGASFSPVVRVRELTGSE
FT                   LCSVRAESSELEAGTAGNPRETDTLPEQAREGAIPKRREASRSNTVRPQEETRLVLNKP
FT                   TLLKQKRS"
FT   assembly_gap    11570483..11570863
FT                   /estimated_length=381
FT                   /gap_type="unknown"
FT   assembly_gap    11581253..11581272
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11590135..11590154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11592875..11592894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11632025..11632044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11634605..11634624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11642438..11642851
FT                   /estimated_length=414
FT                   /gap_type="unknown"
FT   assembly_gap    11644292..11644311
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11658460..11658479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11659843..11663797
FT                   /estimated_length=3955
FT                   /gap_type="unknown"
FT   assembly_gap    11670177..11671192
FT                   /estimated_length=1016
FT                   /gap_type="unknown"
FT   assembly_gap    11693331..11693350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11707926..11708123
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    11711056..11711088
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    11715881..11715996
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            <11718476..11866402
FT                   /gene="Adam23"
FT                   /locus_tag="mCG_114994"
FT                   /note="gene_id=mCG114994.1"
FT   mRNA            join(<11718476..11718520,11718760..11718880,
FT                   11720185..11720405,11750119..11750195,11788336..11788399,
FT                   11801736..11801818,11803214..11803277,11807263..11807335,
FT                   11808112..11808185,11809906..11809971,11816172..11816243,
FT                   11818533..11818696,11819518..11819602,11820638..11820728,
FT                   11822656..11822704,11824669..11824768,11828063..11828134,
FT                   11828722..11828811,11830316..11830396,11836316..11836366,
FT                   11837052..11837115,11839505..11839610,11840752..11840871,
FT                   11843813..11843981,11845779..11845890,11858783..11858873,
FT                   11866032..11866402)
FT                   /gene="Adam23"
FT                   /locus_tag="mCG_114994"
FT                   /product="a disintegrin and metallopeptidase domain 23"
FT                   /note="gene_id=mCG114994.1 transcript_id=mCT116092.1
FT                   created on 16-JUL-2002"
FT   assembly_gap    11718521..11718759
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   CDS             join(<11718760..11718880,11720185..11720405,
FT                   11750119..11750195,11788336..11788399,11801736..11801818,
FT                   11803214..11803277,11807263..11807335,11808112..11808185,
FT                   11809906..11809971,11816172..11816243,11818533..11818696,
FT                   11819518..11819602,11820638..11820728,11822656..11822704,
FT                   11824669..11824768,11828063..11828134,11828722..11828811,
FT                   11830316..11830396,11836316..11836366,11837052..11837115,
FT                   11839505..11839610,11840752..11840871,11843813..11843981,
FT                   11845779..11845890,11858783..11858873,11866032..11866080)
FT                   /codon_start=1
FT                   /gene="Adam23"
FT                   /locus_tag="mCG_114994"
FT                   /product="a disintegrin and metallopeptidase domain 23"
FT                   /note="gene_id=mCG114994.1 transcript_id=mCT116092.1
FT                   protein_id=mCP74706.1"
FT                   /protein_id="EDL00189.1"
FT                   /translation="CPAGPVPARAPPCRLLLVLLMLPALATSSRPRARGAAAPSAPHWN
FT                   ETAEKTLGVLADEDNTLQQNSSSRNTSYSSAVQKEITLPSRLVYYINQDSESPYHVLDT
FT                   KARHQQKHNKAVHLAQASFQIEAFGSKFILDLTLNNGLLSSDYVEIHYEDGKQMYSKGG
FT                   EHCYYHGSIRGVKDSRVALSTCNGLHGMFEDDTFVYMIEPLELTDDEKSTGRPHIIQKT
FT                   LAGQYSKQMKNLSTDGSDQWPLLPELQWLRRRKRAVNPSRGVFEEMKYLELMIVNDHKT
FT                   YKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDHIDITINPVQMLH
FT                   DFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRIRGVGVNEYGLPMAVAQVL
FT                   SQSLAQNLGIQWEPSSRKPKCECIESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGG
FT                   GACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGVCCKKCSLSNGAHCSDGPCCN
FT                   NTSCLFQSRGYECRDAVNSCDITEYCTGDSGQCPPNLHKQDGYSCNQNQGRCYNGECKT
FT                   RDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIPCSKHDVFCGFLLCTNL
FT                   TRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRK
FT                   CLQIQALNMSSCPLDSRGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNPNPPKDE
FT                   GPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI"
FT   assembly_gap    11719607..11719626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11734473..11734555
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    11768544..11770600
FT                   /estimated_length=2057
FT                   /gap_type="unknown"
FT   assembly_gap    11781399..11781446
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    11788180..11788253
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    11793521..11794181
FT                   /estimated_length=661
FT                   /gap_type="unknown"
FT   assembly_gap    11814923..11815047
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    11816668..11816687
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11820260..11820303
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    11838276..11838295
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11850724..11851271
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    11872342..11872361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11895928..11895947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11905042..11905081
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    11928080..11928099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11943291..11943310
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11945567..11945805
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    11967292..11967708
FT                   /estimated_length=417
FT                   /gap_type="unknown"
FT   assembly_gap    11971117..11971265
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   gene            complement(11975582..12007196)
FT                   /gene="Mdh1b"
FT                   /locus_tag="mCG_113879"
FT                   /note="gene_id=mCG113879.1"
FT   mRNA            complement(join(11975582..11975792,11978331..11978396,
FT                   11987864..11987915,11988201..11988340,11992072..11992235,
FT                   11995399..11995540,11996402..11996898,11998320..11998462,
FT                   11998640..11998774,12002442..12002554,12007127..12007196))
FT                   /gene="Mdh1b"
FT                   /locus_tag="mCG_113879"
FT                   /product="malate dehydrogenase 1B, NAD (soluble)"
FT                   /note="gene_id=mCG113879.1 transcript_id=mCT114968.1
FT                   created on 01-APR-2003"
FT   CDS             complement(join(11975764..11975792,11978331..11978396,
FT                   11987864..11987915,11988201..11988340,11992072..11992235,
FT                   11995399..11995540,11996402..11996898,11998320..11998462,
FT                   11998640..11998774,12002442..12002554,12007127..12007148))
FT                   /codon_start=1
FT                   /gene="Mdh1b"
FT                   /locus_tag="mCG_113879"
FT                   /product="malate dehydrogenase 1B, NAD (soluble)"
FT                   /note="gene_id=mCG113879.1 transcript_id=mCT114968.1
FT                   protein_id=mCP74812.1"
FT                   /protein_id="EDL00190.1"
FT                   /translation="MAKFVIAGKANCPYYAKAELLADYLQKNLPDFRIFKITQHPDKWE
FT                   DWVEDVCERNMWDHRTSPIIWRELLDRGGRGLLLGGYNEFLEHAQLYYGVTSNMTTELM
FT                   MVIAKENMQTHTEQQLDKETMKDLISPLQVWIASAGTYVCCHLIPLLLSGEVFGMHTEI
FT                   SLTLFDQEQREDCLRSIVMETQDLASPVLRTVSFCTTVKEAFLQAQVIIILDDSTEEEV
FT                   YSLESCLRSRVPLCRLYGYLIEKNAHKSVKVIVGGKNFVNLKTTLLMQYAPNIASNIIA
FT                   VALGVEGQAKAVLARKMKTTSANIKDVIIWGNITGNNYVDLRKAKVYNYESAVKGPPGH
FT                   YHSVLSLIFDREWITKEFVQTLKILSSTGKQFGGILAAHSIATTLKYWYHGSPPGEIVS
FT                   LGVMSEGQFDIPEGIVFSMPVKFENGTWVVLTDLEDISLSEKTLSRLTGDLIQEKLVAC
FT                   GDLLTFQPIEEDPKDNEPSNTGMNEEKEQPGSDDSDEKNEDQ"
FT   assembly_gap    11990663..11990776
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    11997973..11998189
FT                   /estimated_length=217
FT                   /gap_type="unknown"
FT   gene            12007111..12029343
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /note="gene_id=mCG113881.1"
FT   mRNA            join(12007111..12007118,12028141..12028250,
FT                   12029169..12029334)
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, transcript variant
FT                   mCT173265"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT173265.0
FT                   created on 09-SEP-2002"
FT   mRNA            join(12007327..12007344,12028161..12028250,
FT                   12029169..12029343)
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, transcript variant
FT                   mCT173266"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT173266.0
FT                   created on 09-SEP-2002"
FT   mRNA            join(<12007416..12007547,12008256..12009077,
FT                   12011596..12011699,12012327..12012435,12012710..12012833,
FT                   12014644..12014783,12016047..12016219,12022704..12022867,
FT                   12024831..12025043,12026558..12026642,12028136..12028250,
FT                   12029169..12029336)
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, transcript variant
FT                   mCT114970"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT114970.1
FT                   created on 09-SEP-2002"
FT   CDS             join(12007416..12007547,12008256..12009077,
FT                   12011596..12011699,12012327..12012435,12012710..12012833,
FT                   12014644..12014783,12016047..12016219,12022704..12022867,
FT                   12024831..12025043,12026558..12026642,12028136..12028250,
FT                   12029169..12029276)
FT                   /codon_start=1
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, isoform CRA_b"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT114970.1
FT                   protein_id=mCP74823.1 isoform=CRA_b"
FT                   /protein_id="EDL00192.1"
FT                   /translation="MASTVAENRCFLTYKRIRNTSPDAPLEEELSWLRLCVVTGFCSKD
FT                   SPQHVLFFRKTATCVASWVFESVPIDSRMNSKARSLLWTIRRFSTLLPRSRALRIDPLG
FT                   TCRPEVIHSKWNPRNHRLNVFDEGLQPSVRYLFQDIFISKSVDGCIQTKGISHSAVFKP
FT                   DRLLCPRRLSFDAKHSFVSDGTSDHDLKKINFHHTSSEDVFTKKVRPTPVNYKKLAQEC
FT                   NSLSDVLDTFSKAPTFPGSNYFLAMWIIAKRISEDKRRFERQLMFSHPAFNQLCEQMMR
FT                   EAKIMHYDHLLFSLNAIVKLGIPQNTLMVQTLLRTIQERINECDERCLSILSTALVSME
FT                   PCMNVNALRAGLRILVDQQVWNIKHVFTLQTVMKCIGKDAPSALKKKLEMKALKELGRF
FT                   SILNSQHMFEVLAAMDLRSVVLLNECSKVVIDNVHGCPFKVLISILQSCRDLRYQNEDL
FT                   FKSIAEYVATTFDIWKLKQVIFFLLLFETLGFRPPGLMDKLMEKVVQEPGSLNVKNIVS
FT                   ILHVYSSLNHVHKIHNREFLEALASALTGCLHHISSESLLNAVHSFCMMNYFPLAPINQ
FT                   LIKENIINELLTSGDTEKNIHKLHVLNTCLKLDESTYKSVHIPLPQLPLSASQPNEKLA
FT                   EVLSRLLEGEGRFSRNVPLPHNYHIDFEIRMDTNRTQVFSFSDVDASSATNMQRVAVLC
FT                   VPKSVYCLNSCHPRGLMAMKIRHLNVMGFHVILIHNWELKKLKMEDAVTFVRKKIYSDE
FT                   VLPTADTTV"
FT   CDS             join(12028200..12028250,12029169..12029276)
FT                   /codon_start=1
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, isoform CRA_a"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT173265.0
FT                   protein_id=mCP96184.0 isoform=CRA_a"
FT                   /protein_id="EDL00191.1"
FT                   /translation="MAMKIRHLNVMGFHVILIHNWELKKLKMEDAVTFVRKKIYSDEVL
FT                   PTADTTV"
FT   CDS             join(12028200..12028250,12029169..12029276)
FT                   /codon_start=1
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, isoform CRA_a"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT173266.0
FT                   protein_id=mCP96185.0 isoform=CRA_a"
FT                   /protein_id="EDL00193.1"
FT                   /translation="MAMKIRHLNVMGFHVILIHNWELKKLKMEDAVTFVRKKIYSDEVL
FT                   PTADTTV"
FT   gene            complement(12031778..12046233)
FT                   /locus_tag="mCG_113882"
FT                   /note="gene_id=mCG113882.1"
FT   mRNA            complement(join(12031778..12033291,12045349..12045506,
FT                   12046145..12046233))
FT                   /locus_tag="mCG_113882"
FT                   /product="mCG113882"
FT                   /note="gene_id=mCG113882.1 transcript_id=mCT114971.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(join(12032971..12033291,12045349..12045506,
FT                   12046145..12046169))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113882"
FT                   /product="mCG113882"
FT                   /note="gene_id=mCG113882.1 transcript_id=mCT114971.0
FT                   protein_id=mCP74848.1"
FT                   /db_xref="GOA:Q9D4D3"
FT                   /db_xref="MGI:MGI:1921676"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4D3"
FT                   /protein_id="EDL00194.1"
FT                   /translation="MDMNYFRRGQPALFSTDLKPNCPRRLEMFAAATERKLESAVLHNF
FT                   PKSKENIGKLSARSQKDNMIPGWEQCLRGQWKTCSELWEKNRKPKCEKNRRKTKGGGMV
FT                   SLLPCLLEKCAESKITCQSSLKKPLVRMTRHCHRTCSQKELHLLLRAQNLGNHHDDLSR
FT                   ALLH"
FT   assembly_gap    12034537..12034668
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    12049465..12050098
FT                   /estimated_length=634
FT                   /gap_type="unknown"
FT   assembly_gap    12059030..12060108
FT                   /estimated_length=1079
FT                   /gap_type="unknown"
FT   assembly_gap    12064957..12065202
FT                   /estimated_length=246
FT                   /gap_type="unknown"
FT   assembly_gap    12066418..12066965
FT                   /estimated_length=548
FT                   /gap_type="unknown"
FT   assembly_gap    12072919..12075862
FT                   /estimated_length=2944
FT                   /gap_type="unknown"
FT   assembly_gap    12104086..12108183
FT                   /estimated_length=4098
FT                   /gap_type="unknown"
FT   assembly_gap    12110810..12111674
FT                   /estimated_length=865
FT                   /gap_type="unknown"
FT   assembly_gap    12125606..12125625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12135695..12137407
FT                   /estimated_length=1713
FT                   /gap_type="unknown"
FT   assembly_gap    12147613..12147978
FT                   /estimated_length=366
FT                   /gap_type="unknown"
FT   assembly_gap    12161016..12161052
FT                   /estimated_length=37
FT                   /gap_type="unknown"
FT   assembly_gap    12172674..12172693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12184525..12184637
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    12190295..12190427
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    12210899..12211045
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    12223394..12223413
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12230146..12234318
FT                   /locus_tag="mCG_146953"
FT                   /note="gene_id=mCG146953.0"
FT   mRNA            join(12230146..12230218,12232959..12234318)
FT                   /locus_tag="mCG_146953"
FT                   /product="mCG146953"
FT                   /note="gene_id=mCG146953.0 transcript_id=mCT187216.0
FT                   created on 13-JAN-2004"
FT   assembly_gap    12230494..12230580
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    12231825..12231844
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             12233329..12233430
FT                   /codon_start=1
FT                   /locus_tag="mCG_146953"
FT                   /product="mCG146953"
FT                   /note="gene_id=mCG146953.0 transcript_id=mCT187216.0
FT                   protein_id=mCP109552.0"
FT                   /protein_id="EDL00195.1"
FT                   /translation="MAWHFDSRLTHHPSHCSSYSLPASLYPVSAARS"
FT   assembly_gap    12236234..12236253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12246729..12246748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12279784..12279803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12286604..12286623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12287945..12287964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            12296109..12299576
FT                   /locus_tag="mCG_1035680"
FT                   /note="gene_id=mCG1035680.1"
FT   mRNA            join(12296109..12296494,12296764..12299576)
FT                   /locus_tag="mCG_1035680"
FT                   /product="mCG1035680"
FT                   /note="gene_id=mCG1035680.1 transcript_id=mCT153384.1
FT                   created on 19-MAR-2003"
FT   CDS             12298240..12298485
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035680"
FT                   /product="mCG1035680"
FT                   /note="gene_id=mCG1035680.1 transcript_id=mCT153384.1
FT                   protein_id=mCP74777.1"
FT                   /protein_id="EDL00196.1"
FT                   /translation="MLELANPPPPPFVFPWMQIDTDHLEAYPKFKSLNTLFSNFKEDLK
FT                   IKNKLKKIPRNPSCSSDMRLALFLPCYHQAIKDGKG"
FT   gene            complement(12299971..12388002)
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /note="gene_id=mCG113878.1"
FT   mRNA            complement(join(12299971..12302432,12308971..12309094,
FT                   12345375..12346002,12387478..12388002))
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /product="Kruppel-like factor 7 (ubiquitous), transcript
FT                   variant mCT114967"
FT                   /note="gene_id=mCG113878.1 transcript_id=mCT114967.1
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(12302381..12302432,12308971..12309094,
FT                   12345375..12346002,12387478..12387579))
FT                   /codon_start=1
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /product="Kruppel-like factor 7 (ubiquitous), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG113878.1 transcript_id=mCT114967.1
FT                   protein_id=mCP74805.1 isoform=CRA_a"
FT                   /protein_id="EDL00197.1"
FT                   /translation="MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQT
FT                   EPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEATICEKSSAVDILLSRDKL
FT                   LSETCLSLQPTSSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVT
FT                   LKLVAKKASLSSVKVGGVAAAAAVTPAGAVKSGQSDSEQGGGGADTCPENKKRVHRCQF
FT                   NGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCN
FT                   HCDRCFSRSDHLALHMKRHI"
FT   mRNA            complement(join(<12302383..12302432,12308971..12309094,
FT                   12345375..12346002,12387478..12387717,12387964..>12387978))
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /product="Kruppel-like factor 7 (ubiquitous), transcript
FT                   variant mCT189248"
FT                   /note="gene_id=mCG113878.1 transcript_id=mCT189248.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<12302383..12302432,12308971..12309094,
FT                   12345375..12346002,12387478..>12387624))
FT                   /codon_start=1
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /product="Kruppel-like factor 7 (ubiquitous), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG113878.1 transcript_id=mCT189248.0
FT                   protein_id=mCP110238.0 isoform=CRA_b"
FT                   /protein_id="EDL00198.1"
FT                   /translation="ARGRVSPPVLPGSSSMDVLASYSIFQELQLVHDTGYFSALPSLEE
FT                   TWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEATIC
FT                   EKSSAVDILLSRDKLLSETCLSLQPTSSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHL
FT                   VKTSQTLSAVDGTVTLKLVAKKASLSSVKVGGVAAAAAVTPAGAVKSGQSDSEQGGGGA
FT                   DTCPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELT
FT                   RHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRHI"
FT   assembly_gap    12388096..12388181
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   gene            12416721..12417430
FT                   /pseudo
FT                   /locus_tag="mCG_1035533"
FT                   /note="gene_id=mCG1035533.2"
FT   mRNA            12416721..12417430
FT                   /pseudo
FT                   /locus_tag="mCG_1035533"
FT                   /note="gene_id=mCG1035533.2 transcript_id=mCT153237.1
FT                   created on 16-JUL-2003"
FT   assembly_gap    12418208..12418227
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12436510..12436702
FT                   /estimated_length=193
FT                   /gap_type="unknown"
FT   assembly_gap    12442690..12443154
FT                   /estimated_length=465
FT                   /gap_type="unknown"
FT   gene            complement(12445858..12562617)
FT                   /locus_tag="mCG_146955"
FT                   /note="gene_id=mCG146955.0"
FT   mRNA            complement(join(12445858..12447106,12562580..12562617))
FT                   /locus_tag="mCG_146955"
FT                   /product="mCG146955"
FT                   /note="gene_id=mCG146955.0 transcript_id=mCT187218.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12446862..12447104)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146955"
FT                   /product="mCG146955"
FT                   /note="gene_id=mCG146955.0 transcript_id=mCT187218.0
FT                   protein_id=mCP109554.0"
FT                   /protein_id="EDL00199.1"
FT                   /translation="MNAGKYDYEDLTICPIEGKLSFPLGKGEGSSCTRVSTRPSDLVIS
FT                   VYCSGIRTLLTSWLLSCVSELRGRHMQRRRSTYPH"
FT   assembly_gap    12487227..12487246
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12498928..12498947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12515393..12515412
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12520312..12520331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12524362..12525552
FT                   /estimated_length=1191
FT                   /gap_type="unknown"
FT   assembly_gap    12536272..12536291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12562702..12562721
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12585330..12585349
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12679460..12679513
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    12688408..12688427
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12698237..12698539
FT                   /estimated_length=303
FT                   /gap_type="unknown"
FT   assembly_gap    12720172..12720331
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    12723649..12724003
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    12773348..12773463
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   gene            <12784683..12854752
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /note="gene_id=mCG113880.1"
FT   mRNA            join(12784683..12784904,12803007..12803128,
FT                   12810656..12810802,12811499..12811540,12817970..12818070,
FT                   12821887..12822029,12825826..12826008,12827922..12828072,
FT                   12849018..12854752)
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   transcript variant mCT114969"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT114969.0
FT                   created on 22-JUL-2002"
FT   mRNA            join(12784683..12784904,12803007..12803128,
FT                   12810656..12810802,12817970..12818070,12821887..12822029,
FT                   12827922..12828072,12849018..12854752)
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   transcript variant mCT171045"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171045.0
FT                   created on 22-JUL-2002"
FT   mRNA            join(<12784683..12784904,12810656..12810802,
FT                   12817970..12818070,12821887..12822029,12825826..12826008,
FT                   12827922..12828072,12849018..12854752)
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   transcript variant mCT171046"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171046.0
FT                   created on 22-JUL-2002"
FT   mRNA            join(12784684..12784904,12803007..12803128,
FT                   12810656..12810802,12817970..12818070,12821887..12822029,
FT                   12825826..12826008,12827922..12828072,12849018..12854752)
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   transcript variant mCT171044"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171044.0
FT                   created on 22-JUL-2002"
FT   CDS             join(<12784818..12784904,12810656..12810802,
FT                   12817970..12818070,12821887..12822029,12825826..12826008,
FT                   12827922..12828072,12849018..12849162)
FT                   /codon_start=1
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171046.0
FT                   protein_id=mCP93964.0 isoform=CRA_d"
FT                   /protein_id="EDL00203.1"
FT                   /translation="RGVLRGGENKTPARSGPRTKAVTEELVPPVSMPAAHATSSAPTVT
FT                   LVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREI
FT                   LSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAIT
FT                   QGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAA
FT                   SGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKK
FT                   KEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD"
FT   assembly_gap    12785005..12785525
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    12797160..12797179
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(12803015..12803128,12810656..12810802,
FT                   12811499..12811540,12817970..12818070,12821887..12822029,
FT                   12825826..12826008,12827922..12828072,12849018..12849162)
FT                   /codon_start=1
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT114969.0
FT                   protein_id=mCP74815.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q547S9"
FT                   /db_xref="InterPro:IPR001630"
FT                   /db_xref="InterPro:IPR003102"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="MGI:MGI:88494"
FT                   /db_xref="UniProtKB/TrEMBL:Q547S9"
FT                   /protein_id="EDL00202.1"
FT                   /translation="MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAH
FT                   ATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQIST
FT                   IAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAP
FT                   AITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTIL
FT                   QYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEE
FT                   AARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKS
FT                   D"
FT   CDS             join(12803015..12803128,12810656..12810802,
FT                   12817970..12818070,12821887..12822029,12825826..12826008,
FT                   12827922..12828072,12849018..12849162)
FT                   /codon_start=1
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171044.0
FT                   protein_id=mCP93963.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q543W0"
FT                   /db_xref="InterPro:IPR001630"
FT                   /db_xref="InterPro:IPR003102"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="MGI:MGI:88494"
FT                   /db_xref="UniProtKB/TrEMBL:Q543W0"
FT                   /protein_id="EDL00200.1"
FT                   /translation="MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAH
FT                   ATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSV
FT                   TDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQT
FT                   SSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVP
FT                   SNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNRE
FT                   AARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD"
FT   CDS             join(12803021..12803128,12810656..12810802,
FT                   12817970..12818070,12821887..12822029,12827922..12828072,
FT                   12849018..12849162)
FT                   /codon_start=1
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171045.0
FT                   protein_id=mCP93962.0 isoform=CRA_b"
FT                   /protein_id="EDL00201.1"
FT                   /translation="MESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHAT
FT                   SSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTD
FT                   SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSS
FT                   GQYTASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARE
FT                   CRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD"
FT   assembly_gap    12840239..12840314
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            complement(12858264..12869036)
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /note="gene_id=mCG123126.1"
FT   mRNA            complement(join(12858264..12859921,12866906..12867017,
FT                   12868081..12868252,12868970..12869036))
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /product="RIKEN cDNA 2310038H17, transcript variant
FT                   mCT124355"
FT                   /note="gene_id=mCG123126.1 transcript_id=mCT124355.1
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(12858264..12859921,12866906..12867017,
FT                   12868081..>12868977))
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /product="RIKEN cDNA 2310038H17, transcript variant
FT                   mCT189292"
FT                   /note="gene_id=mCG123126.1 transcript_id=mCT189292.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(12859524..12859921,12866906..12867017,
FT                   12868081..>12868236))
FT                   /codon_start=1
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /product="RIKEN cDNA 2310038H17, isoform CRA_a"
FT                   /note="gene_id=mCG123126.1 transcript_id=mCT189292.0
FT                   protein_id=mCP110265.0 isoform=CRA_a"
FT                   /protein_id="EDL00204.1"
FT                   /translation="TEEMALVPYEESAAIGLQKFHKPLATFSFANHTIQIRQDWRQLGV
FT                   AAVVWDAAVVLSMYLEMGAVELRGCSAVELGAGTGLVGIVAALLGAQVTITDRKVALEF
FT                   LKSNVEANLPPHIQPKAVVKELTWGQNLESFSPGEFDLILGADVIYLEDTFTDLLQTLG
FT                   HLCSNNSVILLACRIRYERDSNFLTMLERQFTVSKVHYDPEKDVHIYKAQKRNQREDL"
FT   CDS             complement(join(12859524..12859921,12866906..12867017,
FT                   12868081..12868227))
FT                   /codon_start=1
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /product="RIKEN cDNA 2310038H17, isoform CRA_b"
FT                   /note="gene_id=mCG123126.1 transcript_id=mCT124355.1
FT                   protein_id=mCP74830.1 isoform=CRA_b"
FT                   /protein_id="EDL00205.1"
FT                   /translation="MALVPYEESAAIGLQKFHKPLATFSFANHTIQIRQDWRQLGVAAV
FT                   VWDAAVVLSMYLEMGAVELRGCSAVELGAGTGLVGIVAALLGAQVTITDRKVALEFLKS
FT                   NVEANLPPHIQPKAVVKELTWGQNLESFSPGEFDLILGADVIYLEDTFTDLLQTLGHLC
FT                   SNNSVILLACRIRYERDSNFLTMLERQFTVSKVHYDPEKDVHIYKAQKRNQREDL"
FT   assembly_gap    12882363..12883117
FT                   /estimated_length=755
FT                   /gap_type="unknown"
FT   assembly_gap    12927262..12927811
FT                   /estimated_length=550
FT                   /gap_type="unknown"
FT   gene            complement(12931921..12942630)
FT                   /locus_tag="mCG_1035592"
FT                   /note="gene_id=mCG1035592.1"
FT   mRNA            complement(join(12931921..12932435,12942434..12942630))
FT                   /locus_tag="mCG_1035592"
FT                   /product="mCG1035592"
FT                   /note="gene_id=mCG1035592.1 transcript_id=mCT153296.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(12932096..12932242)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035592"
FT                   /product="mCG1035592"
FT                   /note="gene_id=mCG1035592.1 transcript_id=mCT153296.0
FT                   protein_id=mCP74570.1"
FT                   /protein_id="EDL00206.1"
FT                   /translation="MSNTPDTTNLHFATGSHHMLSSHPSPLKNKRKMYDGQVKNDRKSS
FT                   SQA"
FT   assembly_gap    12943246..12943278
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   gene            12943279..12977661
FT                   /locus_tag="mCG_123133"
FT                   /note="gene_id=mCG123133.1"
FT   mRNA            join(12943279..12943351,12952918..12952992,
FT                   12954295..12954329,12960327..12960427,12963329..12963402,
FT                   12965056..12965107,12966514..12966633,12970163..12970329,
FT                   12973660..12973822,12975674..12977661)
FT                   /locus_tag="mCG_123133"
FT                   /product="mCG123133"
FT                   /note="gene_id=mCG123133.1 transcript_id=mCT124362.1
FT                   created on 18-NOV-2002"
FT   CDS             join(12960425..12960427,12963329..12963402,
FT                   12965056..12965107,12966514..12966633,12970163..12970329,
FT                   12973660..12973822,12975674..12975952)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123133"
FT                   /product="mCG123133"
FT                   /note="gene_id=mCG123133.1 transcript_id=mCT124362.1
FT                   protein_id=mCP74452.1"
FT                   /protein_id="EDL00207.1"
FT                   /translation="MKTNCFKYFFSFHSVTLAIYYHIKNRDANRSLDIFDERSHPLTRE
FT                   KVPEEYFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPTNWKR
FT                   IVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPASVYAK
FT                   YYFDLRSLADDNNLNFLFAPLSKERAQNLERETRGVRTPGTPHRQAGATAPLLIREQQR
FT                   WDSTGWEDLGFKRLWTVTADSIGKNGTLSKQQLSVLCNVNGYRNHSTATALTTDRAYHV
FT                   GQWL"
FT   assembly_gap    12967782..12967801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12978704..12978723
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12981155..12981527
FT                   /estimated_length=373
FT                   /gap_type="unknown"
FT   gene            complement(12986522..12989860)
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /note="gene_id=mCG123123.1"
FT   mRNA            complement(join(12986522..12988963,12989350..12989860))
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /product="frizzled homolog 5 (Drosophila), transcript
FT                   variant mCT170710"
FT                   /note="gene_id=mCG123123.1 transcript_id=mCT170710.0
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(12986523..12988963,12989243..12989492))
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /product="frizzled homolog 5 (Drosophila), transcript
FT                   variant mCT124352"
FT                   /note="gene_id=mCG123123.1 transcript_id=mCT124352.1
FT                   created on 16-JUL-2002"
FT   CDS             complement(12986953..12988710)
FT                   /codon_start=1
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /product="frizzled homolog 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG123123.1 transcript_id=mCT124352.1
FT                   protein_id=mCP74653.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9EQD0"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026547"
FT                   /db_xref="MGI:MGI:108571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQD0"
FT                   /protein_id="EDL00208.1"
FT                   /translation="MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIG
FT                   YNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPP
FT                   CRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSF
FT                   PAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPC
FT                   YQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCV
FT                   SLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTW
FT                   FLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNS
FT                   LRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYT
FT                   VPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITS
FT                   GVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAY
FT                   HKQVSLSHV"
FT   CDS             complement(12986953..12988710)
FT                   /codon_start=1
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /product="frizzled homolog 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG123123.1 transcript_id=mCT170710.0
FT                   protein_id=mCP93628.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9EQD0"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026547"
FT                   /db_xref="MGI:MGI:108571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQD0"
FT                   /protein_id="EDL00209.1"
FT                   /translation="MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIG
FT                   YNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPP
FT                   CRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSF
FT                   PAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPC
FT                   YQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCV
FT                   SLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTW
FT                   FLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNS
FT                   LRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYT
FT                   VPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITS
FT                   GVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAY
FT                   HKQVSLSHV"
FT   assembly_gap    13011691..13011710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13046090..>13207792)
FT                   /locus_tag="mCG_123132"
FT                   /note="gene_id=mCG123132.1"
FT   mRNA            complement(join(13046090..13046986,13070483..13070640,
FT                   13111729..13111792,13133639..13133832,13143234..13143379,
FT                   13172065..13172997,13188490..13189171,13207661..13207792))
FT                   /locus_tag="mCG_123132"
FT                   /product="mCG123132, transcript variant mCT124361"
FT                   /note="gene_id=mCG123132.1 transcript_id=mCT124361.1
FT                   created on 18-NOV-2002"
FT   mRNA            complement(join(13046679..13046986,13070483..13070640,
FT                   13111729..13111792,13133639..13133832,13143234..13143379,
FT                   13172065..13172997,13188329..13189171,13207741..>13207792))
FT                   /locus_tag="mCG_123132"
FT                   /product="mCG123132, transcript variant mCT189249"
FT                   /note="gene_id=mCG123132.1 transcript_id=mCT189249.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(13046809..13046986,13070483..13070640,
FT                   13111729..13111792,13133639..13133832,13143234..13143379,
FT                   13172065..13172997,13188329..>13188959))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123132"
FT                   /product="mCG123132, isoform CRA_b"
FT                   /note="gene_id=mCG123132.1 transcript_id=mCT189249.0
FT                   protein_id=mCP110266.0 isoform=CRA_b"
FT                   /protein_id="EDL00211.1"
FT                   /translation="KLGPCVMEALEVDDISPALEVTEDFFSTFDSKLEKAVQQAEVYGI
FT                   QEVPELVGHEVLGNIADNGALRSVASLGKGTMIWDHCKSRLLETKAQNVFPAKEQLMVQ
FT                   RGTAPDNLSWMAQKEASTFNFFNICQRRRDRPRSVNDLLDETTTFKPGHARSRSDVTHV
FT                   DWRVVLSTMPLQQQQQQQQASLQGIHFPGPSFLLSSPSKVEDAQGNTEHKQTFPNILKK
FT                   GYLEIRKNHDSYWQSCYAELSPYNLNFYSLDSSGNQNLYATYQLSHFQSISVLGNLEAR
FT                   MVDTVLYDNSQLQLKAESPWEALDWGQKLWEVVHAAVPNYMGRQGEMANSPGLIHHGDC
FT                   AQNHCLQKKSSGLLASPVLDSPKQYQNILKSGTLYRLTVQNNWKAFTFVLSKAYLMAFH
FT                   PGKLDEDPLLSYNVDVCLAVQIDNLDGCDSCFQVIFPQDVLRLRAETRQRAQEWMEALK
FT                   TAANAARSSEQNLQVTLRNKPKDQLDGRELRKNKRQSVTTSFLSILTTLSLERGLTAQS
FT                   FKCAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQAK
FT                   EFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYLFSCRAAVAEDLRRR
FT                   IFPREYLLQQIHLYSLADLQQVIEGKLAPFLGKVIKFATAHVYSCSLCSQKGFICEICN
FT                   NGEILYPFEDISTSRCESCGAVFHSECKEKSVPCPRCVRRELQKKQKSFWRQLNVDESL
FT                   EEACAMFELSYQST"
FT   CDS             complement(join(13046809..13046986,13070483..13070640,
FT                   13111729..13111792,13133639..13133832,13143234..13143379,
FT                   13172065..13172785))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123132"
FT                   /product="mCG123132, isoform CRA_a"
FT                   /note="gene_id=mCG123132.1 transcript_id=mCT124361.1
FT                   protein_id=mCP74448.1 isoform=CRA_a"
FT                   /protein_id="EDL00210.1"
FT                   /translation="MVDTVLYDNSQLQLKAESPWEALDWGQKLWEVVHAAVPNYMGRQG
FT                   EMANSPGLIHHGDCAQNHCLQKKSSGLLASPVLDSPKQYQNILKSGTLYRLTVQNNWKA
FT                   FTFVLSKAYLMAFHPGKLDEDPLLSYNVDVCLAVQIDNLDGCDSCFQVIFPQDVLRLRA
FT                   ETRQRAQEWMEALKTAANAARSSEQNLQVTLRNKPKDQLDGRELRKNKRQSVTTSFLSI
FT                   LTTLSLERGLTAQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVH
FT                   NWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYL
FT                   FSCRAAVAEDLRRRIFPREYLLQQIHLYSLADLQQVIEGKLAPFLGKVIKFATAHVYSC
FT                   SLCSQKGFICEICNNGEILYPFEDISTSRCESCGAVFHSECKEKSVPCPRCVRRELQKK
FT                   QKSFWRQLNVDESLEEACAMFELSYQST"
FT   assembly_gap    13108914..13108933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13152803..13152822
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13185562..13185836
FT                   /estimated_length=275
FT                   /gap_type="unknown"
FT   assembly_gap    13191683..13191702
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13195183..13195202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13237807..13238506)
FT                   /locus_tag="mCG_123122"
FT                   /note="gene_id=mCG123122.1"
FT   mRNA            complement(13237807..13238506)
FT                   /locus_tag="mCG_123122"
FT                   /product="mCG123122"
FT                   /note="gene_id=mCG123122.1 transcript_id=mCT124351.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(13237838..13238491)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123122"
FT                   /product="mCG123122"
FT                   /note="gene_id=mCG123122.1 transcript_id=mCT124351.0
FT                   protein_id=mCP74652.1"
FT                   /db_xref="GOA:Q5XJF6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="MGI:MGI:1343877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XJF6"
FT                   /protein_id="EDL00212.1"
FT                   /translation="MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQK
FT                   DKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLA
FT                   KKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVL
FT                   CLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY"
FT   assembly_gap    13247989..13248008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13256439..13276139)
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /note="gene_id=mCG123121.1"
FT   mRNA            complement(join(13256439..13257059,13258427..13258509,
FT                   13259817..13259982,13260415..13260524,13264777..13264899,
FT                   13265313..13265390,13268057..13268173,13268957..13269124,
FT                   13275975..13276137))
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /product="RIKEN cDNA 4921521F21, transcript variant
FT                   mCT124350"
FT                   /note="gene_id=mCG123121.1 transcript_id=mCT124350.0
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(13256836..13257059,13258427..13258509,
FT                   13259817..13259982,13260415..13260524,13264777..13264899,
FT                   13265313..13265390,13268057..13268173,13268957..13269124,
FT                   13273962..13274082,13275975..13276139))
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /product="RIKEN cDNA 4921521F21, transcript variant
FT                   mCT170709"
FT                   /note="gene_id=mCG123121.1 transcript_id=mCT170709.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(13257017..13257059,13258427..13258509,
FT                   13259817..13259982,13260415..13260524,13264777..13264899,
FT                   13265313..13265390,13268057..13268173,13268957..13269124,
FT                   13273962..13274042))
FT                   /codon_start=1
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /product="RIKEN cDNA 4921521F21, isoform CRA_b"
FT                   /note="gene_id=mCG123121.1 transcript_id=mCT170709.0
FT                   protein_id=mCP93627.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UXL1"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:1918111"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UXL1"
FT                   /protein_id="EDL00214.1"
FT                   /translation="MNPKRYMELSDGHHIPVLGFGTFVPGEVSKSMVAKATKIAIDAGF
FT                   RHIDSAYFYQNEEEVGLAIRSKVADGTVRREDIFYTSKLPCTCHRPELVQPCLEQSLRK
FT                   LQLDYVDLYLIHCPVSMKPGNDLIPTDENGKLLFDTVDLCDTWEAMEKCKDSGLAKSIG
FT                   VSNFNRRQLEMILNKPGLRYKPVCNQVECHPYLNQSKLLDYCKSKDIVLVAYGALGSQR
FT                   CKNWIEENAPYLLEDPTLCAMAEKHKQTPALISLRYLLQRGIVIVTKSFNEKRIKENLK
FT                   VFEFHLPAEDMAVIDRLNRNYRYATARIISAHPNYPFLDEY"
FT   CDS             complement(join(13257017..13257059,13258427..13258509,
FT                   13259817..13259982,13260415..13260524,13264777..13264899,
FT                   13265313..13265390,13268057..13268173,13268957..13269112))
FT                   /codon_start=1
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /product="RIKEN cDNA 4921521F21, isoform CRA_a"
FT                   /note="gene_id=mCG123121.1 transcript_id=mCT124350.0
FT                   protein_id=mCP74643.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA14"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:1918111"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA14"
FT                   /protein_id="EDL00213.1"
FT                   /translation="MVAKATKIAIDAGFRHIDSAYFYQNEEEVGLAIRSKVADGTVRRE
FT                   DIFYTSKLPCTCHRPELVQPCLEQSLRKLQLDYVDLYLIHCPVSMKPGNDLIPTDENGK
FT                   LLFDTVDLCDTWEAMEKCKDSGLAKSIGVSNFNRRQLEMILNKPGLRYKPVCNQVECHP
FT                   YLNQSKLLDYCKSKDIVLVAYGALGSQRCKNWIEENAPYLLEDPTLCAMAEKHKQTPAL
FT                   ISLRYLLQRGIVIVTKSFNEKRIKENLKVFEFHLPAEDMAVIDRLNRNYRYATARIISA
FT                   HPNYPFLDEY"
FT   assembly_gap    13260660..13262008
FT                   /estimated_length=1349
FT                   /gap_type="unknown"
FT   assembly_gap    13280248..13280348
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   gene            complement(13291923..13294570)
FT                   /locus_tag="mCG_123124"
FT                   /note="gene_id=mCG123124.1"
FT   mRNA            complement(join(13291923..13292260,13294190..13294432,
FT                   13294525..13294570))
FT                   /locus_tag="mCG_123124"
FT                   /product="mCG123124"
FT                   /note="gene_id=mCG123124.1 transcript_id=mCT124353.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(13291988..13292260,13294190..13294432,
FT                   13294525..13294533))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123124"
FT                   /product="mCG123124"
FT                   /note="gene_id=mCG123124.1 transcript_id=mCT124353.1
FT                   protein_id=mCP74824.1"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="MGI:MGI:88525"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTH4"
FT                   /protein_id="EDL00215.1"
FT                   /translation="MGKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWML
FT                   YEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHSSSHRIKIYEREDYRGQMVE
FT                   ITDDCSHLQDRFHFSDFHSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNAR
FT                   VGSLRRIMDFY"
FT   assembly_gap    13301747..13302047
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   gene            complement(13305289..13306885)
FT                   /locus_tag="mCG_123130"
FT                   /note="gene_id=mCG123130.2"
FT   mRNA            complement(join(13305289..13305628,13306507..13306749,
FT                   13306842..13306885))
FT                   /locus_tag="mCG_123130"
FT                   /product="mCG123130"
FT                   /note="gene_id=mCG123130.2 transcript_id=mCT124359.2
FT                   created on 23-NOV-2004"
FT   CDS             complement(join(13305356..13305628,13306507..13306749,
FT                   13306842..13306850))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123130"
FT                   /product="mCG123130"
FT                   /note="gene_id=mCG123130.2 transcript_id=mCT124359.2
FT                   protein_id=mCP74430.1"
FT                   /protein_id="EDL00216.1"
FT                   /translation="MGKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWML
FT                   YEQPNFAGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHAGSHRIRLYEREEYRGQMIE
FT                   FTEDCPSLQDRFHFNEIYSLNVLEGCWVLYDMTNYRGRQYLLRPGEYRRYHDWGAMNAR
FT                   VGSLRRVMDFY"
FT   assembly_gap    13312689..13312838
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   gene            complement(13315115..13317099)
FT                   /gene="Crygc"
FT                   /locus_tag="mCG_123125"
FT                   /note="gene_id=mCG123125.1"
FT   mRNA            complement(join(13315115..13315453,13316745..13316987,
FT                   13317080..13317099))
FT                   /gene="Crygc"
FT                   /locus_tag="mCG_123125"
FT                   /product="crystallin, gamma C"
FT                   /note="gene_id=mCG123125.1 transcript_id=mCT124354.1
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(13315181..13315453,13316745..13316987,
FT                   13317080..13317088))
FT                   /codon_start=1
FT                   /gene="Crygc"
FT                   /locus_tag="mCG_123125"
FT                   /product="crystallin, gamma C"
FT                   /note="gene_id=mCG123125.1 transcript_id=mCT124354.1
FT                   protein_id=mCP74829.1"
FT                   /db_xref="GOA:A3RLD4"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="InterPro:IPR033483"
FT                   /db_xref="MGI:MGI:88523"
FT                   /db_xref="UniProtKB/TrEMBL:A3RLD4"
FT                   /protein_id="EDL00217.1"
FT                   /translation="MGKITFFEDRSFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWML
FT                   YERPNYQGHQYFLRRGEYPDYQQWMGFSDSIRSCRLIPHAGSHRMRLYEKEDHKGVMME
FT                   LSEDCSCIQDRFHLSEVRSLQVLEGCWVLYEMPNYRGRQYLLRPQEYRRFQDWGSVDAK
FT                   AGSLRRVVDLY"
FT   assembly_gap    13318249..13318268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13323791..13325830)
FT                   /gene="Crygb"
FT                   /locus_tag="mCG_146941"
FT                   /note="gene_id=mCG146941.0"
FT   mRNA            complement(join(13323791..13324130,13325478..13325720,
FT                   13325810..13325830))
FT                   /gene="Crygb"
FT                   /locus_tag="mCG_146941"
FT                   /product="crystallin, gamma B"
FT                   /note="gene_id=mCG146941.0 transcript_id=mCT187204.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(13323855..13324130,13325478..13325720,
FT                   13325810..13325818))
FT                   /codon_start=1
FT                   /gene="Crygb"
FT                   /locus_tag="mCG_146941"
FT                   /product="crystallin, gamma B"
FT                   /note="gene_id=mCG146941.0 transcript_id=mCT187204.0
FT                   protein_id=mCP109540.0"
FT                   /protein_id="EDL00218.1"
FT                   /translation="MGKITFFEDRSFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWML
FT                   YERPNYQGHQYFLRRGEYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYEKDDFRGQMS
FT                   EITDDCLSLQDRFHFSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANA
FT                   KVGSFRRVMDFY"
FT   assembly_gap    13328402..13328605
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    13330772..13330791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13344089..13346450)
FT                   /gene="Cryga"
FT                   /locus_tag="mCG_123129"
FT                   /note="gene_id=mCG123129.1"
FT   mRNA            complement(join(13344089..13344425,13346083..13346325,
FT                   13346431..13346450))
FT                   /gene="Cryga"
FT                   /locus_tag="mCG_123129"
FT                   /product="crystallin, gamma A"
FT                   /note="gene_id=mCG123129.1 transcript_id=mCT124358.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(13344153..13344425,13346083..13346325,
FT                   13346431..13346439))
FT                   /codon_start=1
FT                   /gene="Cryga"
FT                   /locus_tag="mCG_123129"
FT                   /product="crystallin, gamma A"
FT                   /note="gene_id=mCG123129.1 transcript_id=mCT124358.1
FT                   protein_id=mCP74428.1"
FT                   /protein_id="EDL00219.1"
FT                   /translation="MGKITFYEDRGFQGRCYECSSDCPNLQTYFSRCNSIRVDSGCWML
FT                   YERPNYQGYQYFLRRGDYPDYQQWMGFSDSIRSCRSIPYTSSHRIRLYERDDYRGLVSE
FT                   LMDDCSCIHDRFRLHEIYSMHVLEGCWVLYEMPNYRGRQYLLRPGDYRRYHDWGAMDAK
FT                   VGSLRRVMDLY"
FT   gene            complement(13348452..13365132)
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /note="gene_id=mCG123135.1"
FT   mRNA            complement(join(13348452..13348797,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..>13360545))
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, transcript variant
FT                   mCT176049"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT176049.0
FT                   created on 21-APR-2003"
FT   CDS             complement(join(13348776..13348797,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..>13360544))
FT                   /codon_start=1
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, isoform CRA_b"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT176049.0
FT                   protein_id=mCP98971.0 isoform=CRA_b"
FT                   /protein_id="EDL00221.1"
FT                   /translation="RAPLHVRPAYPNRKEREAMILSSYAGVLMNSIPIEEVLKIYGANS
FT                   SASPDSTKVAQALLPRRSLHPFAMLTAPRAAECNRRQSVKLRRGATNKNTTSSSTKKAT
FT                   GQNGDPVGKGTHTPATKSLRNVD"
FT   mRNA            complement(join(13350360..13351845,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..13360545,
FT                   13363280..13363362,13365033..13365132))
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, transcript variant
FT                   mCT124364"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT124364.1
FT                   created on 21-APR-2003"
FT   mRNA            complement(join(13351563..13351845,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..13360545,
FT                   13365051..13365132))
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, transcript variant
FT                   mCT182081"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT182081.0
FT                   created on 21-APR-2003"
FT   CDS             complement(join(13351737..13351845,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..13360545,
FT                   13365051..13365058))
FT                   /codon_start=1
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, isoform CRA_c"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT182081.0
FT                   protein_id=mCP105003.0 isoform=CRA_c"
FT                   /protein_id="EDL00222.1"
FT                   /translation="MIWRAPLHVRPAYPNRKEREAMILSSYAGVLMNSIPIEEVLKIYG
FT                   ANSSASPDSTKVAQALLPRRSLHPFAMLTAPRAAECNRRQSVKLRRGATNKNTTSSSTK
FT                   KATGQNGDPVGKGTHTPATNISPTPVLSSAQPFHSSTVMWRNLESAQRQMGLEGK"
FT   CDS             complement(join(13351737..13351845,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..13360545,
FT                   13363280..13363362,13365033..13365053))
FT                   /codon_start=1
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, isoform CRA_a"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT124364.1
FT                   protein_id=mCP74674.1 isoform=CRA_a"
FT                   /protein_id="EDL00220.1"
FT                   /translation="MVNQVTLAHYDLAISVASQWLDCSENLTWLQWEKVRAPLHVRPAY
FT                   PNRKEREAMILSSYAGVLMNSIPIEEVLKIYGANSSASPDSTKVAQALLPRRSLHPFAM
FT                   LTAPRAAECNRRQSVKLRRGATNKNTTSSSTKKATGQNGDPVGKGTHTPATNISPTPVL
FT                   SSAQPFHSSTVMWRNLESAQRQMGLEGK"
FT   assembly_gap    13352187..13352258
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    13357579..13357848
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    13358786..13359710
FT                   /estimated_length=925
FT                   /gap_type="unknown"
FT   assembly_gap    13362899..13362918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13363991..13364010
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13366068..13366931
FT                   /estimated_length=864
FT                   /gap_type="unknown"
FT   assembly_gap    13368026..13368045
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13370157..13370176
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13382800..13382819
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13385517..13386057
FT                   /estimated_length=541
FT                   /gap_type="unknown"
FT   assembly_gap    13388184..13388203
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(13399596..13427421)
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /note="gene_id=mCG123128.1"
FT   mRNA            complement(join(13399596..13400530,13402025..13402187,
FT                   13402775..13402915,13406075..13406226,13407082..13407259,
FT                   13409483..13409588,13411942..13412233,13416214..13416351,
FT                   13427288..13427421))
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   transcript variant mCT171055"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT171055.0
FT                   created on 17-JUL-2002"
FT   mRNA            complement(join(13399596..13400530,13402025..13402187,
FT                   13402775..13402915,13406075..13406226,13407082..13407259,
FT                   13409483..13409588,13411942..13412233,13416214..13416351,
FT                   13419973..13420078))
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   transcript variant mCT124357"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT124357.1
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(13400440..13400530,13402025..13402187,
FT                   13402775..13402915,13406075..13406226,13407082..13407259,
FT                   13409483..13409588,13411942..13412233,13416214..13416335))
FT                   /codon_start=1
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT124357.1
FT                   protein_id=mCP74872.1 isoform=CRA_a"
FT                   /db_xref="GOA:O88844"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="MGI:MGI:96413"
FT                   /db_xref="PDB:2CMJ"
FT                   /db_xref="PDB:2CMV"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88844"
FT                   /protein_id="EDL00223.1"
FT                   /translation="MSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLG
FT                   IENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILG
FT                   GTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGTQ
FT                   KVTYMVHDFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGR
FT                   FKDIFQEIYDKKYKSQFEAQKICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSV
FT                   AQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGL
FT                   AHRAKLDNNTELSFFAKALEDVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMD
FT                   KLGENLKAKLAQAKL"
FT   CDS             complement(join(13400440..13400530,13402025..13402187,
FT                   13402775..13402915,13406075..13406226,13407082..13407259,
FT                   13409483..13409588,13411942..13412233,13416214..13416335))
FT                   /codon_start=1
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT171055.0
FT                   protein_id=mCP93972.0 isoform=CRA_a"
FT                   /db_xref="GOA:O88844"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="MGI:MGI:96413"
FT                   /db_xref="PDB:2CMJ"
FT                   /db_xref="PDB:2CMV"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88844"
FT                   /protein_id="EDL00225.1"
FT                   /translation="MSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLG
FT                   IENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILG
FT                   GTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGTQ
FT                   KVTYMVHDFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGR
FT                   FKDIFQEIYDKKYKSQFEAQKICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSV
FT                   AQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGL
FT                   AHRAKLDNNTELSFFAKALEDVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMD
FT                   KLGENLKAKLAQAKL"
FT   mRNA            complement(join(<13407190..13407227,13412152..13412233,
FT                   13416214..13416351,13422611..13422681,13427192..>13427355))
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   transcript variant mCT171054"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT171054.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(<13407190..13407227,13412152..13412233,
FT                   13416214..13416351,13422611..13422681,13427192..>13427275))
FT                   /codon_start=1
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT171054.0
FT                   protein_id=mCP93973.0 isoform=CRA_b"
FT                   /protein_id="EDL00224.1"
FT                   /translation="LSGSFQDSANTNYVSLNKSLVSLGLTPLKSVCHSKTKCNRYLCCS
FT                   PAGNRNWVIEVKMSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIE
FT                   NRDATNDQVTKDAAEAIKKYNQDKSIEDFAHSS"
FT   assembly_gap    13409267..13409286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13427495..13427601
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   gene            <13427732..13515066
FT                   /gene="Pip5k3"
FT                   /locus_tag="mCG_123127"
FT                   /note="gene_id=mCG123127.1"
FT   mRNA            join(<13427732..13427864,13431347..13431527,
FT                   13433173..13433322,13433562..13433594,13436684..13436802,
FT                   13437640..13437811,13443749..13443956,13446622..13446711,
FT                   13456905..13457043,13460725..13460882,13463241..13463352,
FT                   13464476..13464623,13471763..13471822,13474699..13474828,
FT                   13475223..13475403,13475979..13476053,13479408..13479515,
FT                   13485370..13485510,13486684..13486810,13487036..13488192,
FT                   13491230..13491330,13492649..13492720,13493456..13493627,
FT                   13494396..13494574,13496086..13496199,13496567..13496675,
FT                   13496984..13497138,13497593..13497683,13498956..13499016,
FT                   13499830..13499967,13501046..13501166,13503824..13503919,
FT                   13505291..13505374,13506193..13506290,13506706..13506870,
FT                   13508769..13508828,13509638..13509814,13510813..13510916,
FT                   13512202..13512330,13513381..13513642,13513967..13514041,
FT                   13514577..13515066)
FT                   /gene="Pip5k3"
FT                   /locus_tag="mCG_123127"
FT                   /product="phosphatidylinositol-3-phosphate/phosphatidylinositol
FT                   5-kinase, type III"
FT                   /note="gene_id=mCG123127.1 transcript_id=mCT124356.1
FT                   created on 17-JUL-2002"
FT   CDS             join(<13427814..13427864,13431347..13431527,
FT                   13433173..13433322,13433562..13433594,13436684..13436802,
FT                   13437640..13437811,13443749..13443956,13446622..13446711,
FT                   13456905..13457043,13460725..13460882,13463241..13463352,
FT                   13464476..13464623,13471763..13471822,13474699..13474828,
FT                   13475223..13475403,13475979..13476053,13479408..13479515,
FT                   13485370..13485510,13486684..13486810,13487036..13488192,
FT                   13491230..13491330,13492649..13492720,13493456..13493627,
FT                   13494396..13494574,13496086..13496199,13496567..13496675,
FT                   13496984..13497138,13497593..13497683,13498956..13499016,
FT                   13499830..13499967,13501046..13501166,13503824..13503919,
FT                   13505291..13505374,13506193..13506290,13506706..13506870,
FT                   13508769..13508828,13509638..13509814,13510813..13510916,
FT                   13512202..13512330,13513381..13513642,13513967..13514041,
FT                   13514577..13514692)
FT                   /codon_start=1
FT                   /gene="Pip5k3"
FT                   /locus_tag="mCG_123127"
FT                   /product="phosphatidylinositol-3-phosphate/phosphatidylinositol
FT                   5-kinase, type III"
FT                   /note="gene_id=mCG123127.1 transcript_id=mCT124356.1
FT                   protein_id=mCP74837.0"
FT                   /protein_id="EDL00226.1"
FT                   /translation="GGGRGGGRPAGPGREAKTHEMATDDKSSPTLDSANDLPRSPASPS
FT                   HLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERGEGGQGEQQSPSSSWASPQIPSRTQ
FT                   SVRSPVPYKKQLNEELHRRSSVLENTLPHPQESTDSRRKAEPACGGHDPRTAVQLRSLS
FT                   TVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRC
FT                   CNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSTCSVSILDPSE
FT                   PRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNSALSTRLVSVQEDAGKSPARNRSASIT
FT                   NLSLDRSGSPMVPSYETSVSPQANRNYIRTETTEDERKILLDSAQLKDLWKKICHHTSG
FT                   MEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLDCVSHHDQ
FT                   LFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDD
FT                   NLAKYLVSDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENEE
FT                   KQAMERLLSANHNHMMALLQQLLQNESLSSSWRDIIVSLVCQVVQTVRPDVKHQDDDMD
FT                   IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKNPKILLLKCSIEYLYREET
FT                   KFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQ
FT                   VLERISRMTQGDLVVSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGC
FT                   TIKLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQSPSFHLLTEGR
FT                   GEEGASQEQVSGSSLPQDPECPREALSSEDSTLLESRTVLEKGELDNKSIPQAVASLKH
FT                   QDYTTPTCPAGIPCALFALVPESLLPLHMDQQDAVGNEQPETSQQTDEQQDPKSQMKAF
FT                   RDPLQDDTGMYVTEEVTSSEDQRKTYALTFKQELKDVILCISPVITFREPFLLTEKGMR
FT                   CSTRDYFPEQIYWSPLLNKEVKEMESRRKKQLLRDLSGLQGMNGSVQAKSIQVLPSHEL
FT                   VSTRIAEHLGDSQTLGRMLADYRARGGRIQSKHLDPFVHSKDASCTSGGKSGNKTESDE
FT                   ERGLIPSDVIWPTKVDCLNPANHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKND
FT                   LTLGIFLERYCFRSSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTI
FT                   LTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQ
FT                   YFSYNQMVASFSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYLAVD
FT                   ERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWTEKMQARLMSSSVDTPQQLQSIF
FT                   ESLIAKKQSLCEVLQAWNSRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKINAMDTSPR
FT                   NISPGLHNGEKEDRFLTTLSSQSSTSSTHLQLPTPPEALAEQVVGGPTDLDSASGSEDV
FT                   FDGHLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCE
FT                   KEPSSIIAFALSCKEYRNALEELSKATLRNSAEEGLPANSALDNRPKSSSPIRLPEISG
FT                   GQTNRTVEAEPQPTKKASGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQAGKEG
FT                   LESQGLEPQDEVDGGDTQKKQLTNPHVELQFSDANAKFYCRLYYAGEFHKMREVILGSS
FT                   EEEFIRSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITN
FT                   AVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNR
FT                   NVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKSVLRTSIHSDAHFLSSHLIIDYS
FT                   LLVGRDDTSNELVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFC
FT                   EAMDKYFLMVPDHWTGLDLNC"
FT   assembly_gap    13455008..13455045
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    13488506..13488729
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   assembly_gap