spacer

EBI Dbfetch

ID   CH466548; SV 1; linear; genomic DNA; CON; MUS; 26984737 BP.
XX
AC   CH466548;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 181000113612773 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-26984737
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-26984737
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; fa47c30f01d6b16451a58504f01e96b2.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000209.
DR   Ensembl-Gn; ENSMUSG00000002881; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006299; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006301; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006538; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000006576; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000018417; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025952; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025955; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025958; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025961; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025968; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025969; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025981; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025982; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000025997; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026009; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026012; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026014; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026019; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026024; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026029; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026031; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026034; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026037; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026095; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026100; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026104; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026135; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026176; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026180; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026182; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026185; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026193; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026199; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026201; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026209; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000026235; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032883; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000032968; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033227; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000037805; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038331; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000039323; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041075; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042807; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000043015; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000045005; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000046994; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048495; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050533; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000054770; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000055197; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000060715; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000061816; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000062939; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000063558; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064272; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064294; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000073676; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000078974; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090071; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001027; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006462; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000006716; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000016309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027089; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027102; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027127; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027146; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027151; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027165; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027168; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027178; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027189; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027198; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027269; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027277; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027315; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027372; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027374; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027401; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000027451; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000034868; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000035779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037105; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000037330; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000040999; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000042334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000046390; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047328; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049932; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000055226; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000056409; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059980; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063594; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063982; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000066668; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000068631; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069792; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000070968; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000072235; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075242; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077985; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087366; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087521; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087617; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000087659; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097709; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000097741; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000102827; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000106899; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109641; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109642; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000109643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113605; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113796; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113819; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000113995; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114309; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114313; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114337; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114410; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000114415; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000116133; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117438; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119429; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120904; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000122038; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000123519; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000124341; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000142704; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000148330; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000151338; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000152233; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160379; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000160837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000162800; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000163058; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000164097; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165549; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165859; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166950; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168099; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168302; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169032; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000171597; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000178855; mus_musculus.
XX
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..26984737
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gap             845..5956
FT                   /estimated_length=5112
FT   gap             11839..12523
FT                   /estimated_length=685
FT   gap             14177..14196
FT                   /estimated_length=20
FT   gene            complement(38264..196185)
FT                   /gene="Myo1b"
FT                   /locus_tag="mCG_123680"
FT                   /note="gene_id=mCG123680.1"
FT   mRNA            complement(join(38264..39801,44195..44322,45657..45809,
FT                   46428..46560,48852..48958,51057..51191,52454..52528,
FT                   55388..55474,57573..57659,59442..59510,61847..61996,
FT                   62923..63016,64819..65019,66938..67164,68180..68380,
FT                   70589..70651,73066..73170,82269..82334,82941..83027,
FT                   85701..85819,86090..86237,88231..88334,89883..89981,
FT                   101764..101827,108903..108949,112859..112963,
FT                   123222..123316,152085..152200,171863..172006,
FT                   195999..196185))
FT                   /gene="Myo1b"
FT                   /locus_tag="mCG_123680"
FT                   /product="myosin IB"
FT                   /note="gene_id=mCG123680.1 transcript_id=mCT124915.1
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(39678..39801,44195..44322,45657..45809,
FT                   46428..46560,48852..48958,51057..51191,52454..52528,
FT                   55388..55474,57573..57659,59442..59510,61847..61996,
FT                   62923..63016,64819..65019,66938..67164,68180..68380,
FT                   70589..70651,73066..73170,82269..82334,82941..83027,
FT                   85701..85819,86090..86237,88231..88334,89883..89981,
FT                   101764..101827,108903..108949,112859..112963,
FT                   123222..123316,152085..152200,171863..171997))
FT                   /codon_start=1
FT                   /gene="Myo1b"
FT                   /locus_tag="mCG_123680"
FT                   /product="myosin IB"
FT                   /note="gene_id=mCG123680.1 transcript_id=mCT124915.1
FT                   protein_id=mCP74517.1"
FT                   /db_xref="GOA:P46735"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR001609"
FT                   /db_xref="InterPro:IPR010926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:107752"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46735"
FT                   /protein_id="EDK99961.1"
FT                   /translation="MAKMEVKSSLLDNMIGVGDMVLLEPLNEETFIDNLKKRFDHNEIY
FT                   TYIGSVVISVNPYRSLPIYSPEKVEDYRNRNFYELSPHIFALSDEAYRSLRDQDKDQCI
FT                   LITGESGAGKTEASKLVMSYVAAVCGKGAEVNQVKEQLLQSNPVLEAFGNAKTVRNDNS
FT                   SRFGKYMDIEFDFKGDPLGGVISNYLLEKSRVVKQPRGERNFHVFYQLLSGASEELLYK
FT                   LKLERDFSRYNYLSLDSAKVNGVDDAANFRTVRNAMQIVGFLDHEAEAVLEVVAAVLKL
FT                   GNIEFKPESRVNGLDESKIKDKNELKEICELTSIDQVVLERAFSFRTVEAKQEKVSTTL
FT                   NVAQAYYARDALAKNLYSRLFSWLVNRINESIKAQTKVRKKVMGVLDIYGFEIFEDNSF
FT                   EQFIINYCNEKLQQIFIELTLKEEQEEYIREDIEWTHIDYFNNAIICDLIENNTNGILA
FT                   MLDEECLRPGTVTDETFLEKLNQVCATHQHFESRMSKCSRFLNDTTLPHSCFRIQHYAG
FT                   KVLYQVEGFVDKNNDLLYRDLSQAMWKAGHSLIKSLFPEGNPAKVNLKRPPTAGSQFKA
FT                   SVATLMRNLQTKNPNYIRCIKPNDKKAAHIFNESLVCHQIRYLGLLENVRVRRAGYAFR
FT                   QAYEPCLERYKMLCKQTWPHWKGPARSGVEVLFNELEIPVEEHSFGRSKIFIRNPRTLF
FT                   QLEDLRKQRLEDLATLIQKIYRGWKCRTHFLLMKRSQVVIAAWYRRYAQQKRYQQIKSS
FT                   ALVIQSYIRGWKARKILRELKHQKRCKEAATTIAAYWHGTQARRELKRLKEEARRKHAV
FT                   AVIWAYWLGLKVRREYRKFFRANAGKKIYEFTLQRIVQKYLLEMKNKMPSLSPIDKNWP
FT                   SRPYLFLDSTHKELKRIFHLWRCKKYRDQFTDQQKLIYEEKLEASELFKDKKALYPSSV
FT                   GQPFQGAYLEINKNPKYKKLKDAIEEKIIIAEVVNKINRANGKSTSRIFLLTNNNLLLA
FT                   DQKSGQIKSEVPLVDVTKVSMSSQNDGFFAVHLKEGSEAASKGDFLFSSDHLIEMATKL
FT                   YRTTLSQTKQKLNIEISDEFLVQFRQDKVCVKFIQGNQKNGSVPTCKRKNNRLLEVAVP
FT                   "
FT   gap             39858..39974
FT                   /estimated_length=117
FT   gap             57689..57829
FT                   /estimated_length=141
FT   gap             95833..95852
FT                   /estimated_length=20
FT   gap             179035..179054
FT                   /estimated_length=20
FT   gap             186233..186351
FT                   /estimated_length=119
FT   gap             197217..197236
FT                   /estimated_length=20
FT   gene            complement(229450..230211)
FT                   /pseudo
FT                   /locus_tag="mCG_123679"
FT                   /note="gene_id=mCG123679.1"
FT   mRNA            complement(229450..230211)
FT                   /pseudo
FT                   /locus_tag="mCG_123679"
FT                   /note="gene_id=mCG123679.1 transcript_id=mCT124914.1
FT                   created on 11-JUL-2002"
FT   gene            <297138..396006
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /note="gene_id=mCG123678.1"
FT   mRNA            join(297138..297625,300278..300406,302296..302440,
FT                   354143..354241,357574..357666,360689..360767,
FT                   363505..363590,365361..365512,367322..367480,
FT                   368588..368680,371365..371424,371709..371726,
FT                   371825..371918,372930..372974,385605..385688,
FT                   387207..387305,389144..389279,390672..390721,
FT                   390937..391031,391301..391437,391668..391859,
FT                   394028..394094,394490..394598,395732..396006)
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /product="signal transducer and activator of transcription
FT                   4, transcript variant mCT124913"
FT                   /note="gene_id=mCG123678.1 transcript_id=mCT124913.1
FT                   created on 11-JUL-2002"
FT   mRNA            join(<297138..297625,300278..300406,302296..302440,
FT                   354143..354241,357574..357666,360689..360767,
FT                   363505..363590,365361..365512,367322..367480,
FT                   368588..368680,371365..371424,371811..371918,
FT                   372930..372974,385605..385688,387207..387305,
FT                   389144..389279,390672..390721,390937..391031,
FT                   391301..391437,391668..391859,394028..394094,
FT                   394490..394598,395732..396006)
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /product="signal transducer and activator of transcription
FT                   4, transcript variant mCT189247"
FT                   /note="gene_id=mCG123678.1 transcript_id=mCT189247.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<297564..297625,300278..300406,302296..302440,
FT                   354143..354241,357574..357666,360689..360767,
FT                   363505..363590,365361..365512,367322..367480,
FT                   368588..368680,371365..371424,371811..371918,
FT                   372930..372945)
FT                   /codon_start=1
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /product="signal transducer and activator of transcription
FT                   4, isoform CRA_b"
FT                   /note="gene_id=mCG123678.1 transcript_id=mCT189247.0
FT                   protein_id=mCP110267.0 isoform=CRA_b"
FT                   /protein_id="EDK99963.1"
FT                   /translation="RPILTLDLCSATTWTERERASMSQWNQVQQLEIKFLEQVDQFYDD
FT                   NFPMEIRHLLAQWIETQDWEVASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNL
FT                   KRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPIQGPLEKSLQSSSVSERQRN
FT                   VEHKVSAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQGDKNSILVNQEVLTLQEM
FT                   LNSLDFKRKEALSKMTQIVNETDLLMNSMLLEELQDWKKRQQIACIGGPLHNGLDQLQN
FT                   CFTLLAESLFQLRQQLEKLQEQSTKMTYEGDPIPAQRAHLLERATFLIYNLFKNSFVVE
FT                   RQPCMPTHPQRPMVLKTLIQFTVKLRLLIKLPELNYQVKVKASIDKFFSLAIEDLCFVE
FT                   LTSKLCPVRNLPMGASQWSLDICNPRR"
FT   gap             299881..299900
FT                   /estimated_length=20
FT   CDS             join(300279..300406,302296..302440,354143..354241,
FT                   357574..357666,360689..360767,363505..363590,
FT                   365361..365512,367322..367480,368588..368680,
FT                   371365..371424,371709..371726,371825..371918,
FT                   372930..372974,385605..385688,387207..387305,
FT                   389144..389279,390672..390721,390937..391031,
FT                   391301..391437,391668..391859,394028..394094,
FT                   394490..394598,395732..395758)
FT                   /codon_start=1
FT                   /gene="Stat4"
FT                   /locus_tag="mCG_123678"
FT                   /product="signal transducer and activator of transcription
FT                   4, isoform CRA_a"
FT                   /note="gene_id=mCG123678.1 transcript_id=mCT124913.1
FT                   protein_id=mCP74782.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3V157"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001217"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR012345"
FT                   /db_xref="InterPro:IPR013799"
FT                   /db_xref="InterPro:IPR013800"
FT                   /db_xref="InterPro:IPR013801"
FT                   /db_xref="InterPro:IPR015988"
FT                   /db_xref="MGI:MGI:103062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V157"
FT                   /protein_id="EDK99962.1"
FT                   /translation="MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIETQDWEV
FT                   ASNNETMATILLQNLLIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVV
FT                   ISNCLREERRILAAANMPIQGPLEKSLQSSSVSERQRNVEHKVSAIKNSVQMTEQDTKY
FT                   LEDLQDEFDYRYKTIQTMDQGDKNSILVNQEVLTLQEMLNSLDFKRKEALSKMTQIVNE
FT                   TDLLMNSMLLEELQDWKKRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRQQLEKLQE
FT                   QSTKMTYEGDPIPAQRAHLLERATFLIYNLFKNSFVVERQPCMPTHPQRPMVLKTLIQF
FT                   TVKLRLLIKLPELNYQVKVKASIDKNVSTLSNRRFVLCGTHVKAMSSEESSNGSLSVEF
FT                   RHLQPKEMKCSTGSKGNEGCHMVTEELHSITFETQICLYGLTINLETSSLPVVMISNVS
FT                   QLPNAWASIIWYNVSTNDSQNLVFFNNPPSVTLGQLLEVMSWQFSSYVGRGLNSEQLNM
FT                   LAEKLTVQSNYNDGHLTWAKFCKEHLPGKTFTFWTWLEAILDLIKKHILPLWIDGYIMG
FT                   FVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDQSENGEVRFHSVEPYNKGRLSA
FT                   LPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYV
FT                   PSVFIPISTIRSDSTEPQSPSDLLPMSPSAYAVLRENLSPTTIETAMNSPYSAE"
FT   gap             330155..330528
FT                   /estimated_length=374
FT   gap             335395..335749
FT                   /estimated_length=355
FT   gap             345713..345732
FT                   /estimated_length=20
FT   gap             350706..350725
FT                   /estimated_length=20
FT   gap             368194..368213
FT                   /estimated_length=20
FT   gap             374383..374402
FT                   /estimated_length=20
FT   gene            405397..449855
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /note="gene_id=mCG123683.2"
FT   mRNA            join(405397..405543,407799..407937,408311..408442,
FT                   408731..408854,411409..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436749..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443909,444831..444930,448131..449810)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT124917"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT124917.1
FT                   created on 11-JUL-2002"
FT   mRNA            join(<408255..408442,408731..408891,411410..411540,
FT                   411933..412077,415339..415437,421392..421481,
FT                   424451..424529,425727..425818,426127..426278,
FT                   428042..428200,429425..429517,431749..431808,
FT                   432934..432963,433052..433145,433998..434039,
FT                   436142..436225,436749..436847,437751..437886,
FT                   439467..439516,440086..440180,441081..441226,
FT                   442692..442877,443834..444121)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT189275"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189275.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<408275..408442,408731..408891,411410..411540,
FT                   411933..412077,415339..415437,421392..421481,
FT                   424451..424529,425727..425818,426127..426278,
FT                   428042..428200,429425..429517,431749..431808,
FT                   432934..432963,433052..433145,433998..434039,
FT                   436142..436225,436749..436847,437751..437886,
FT                   439467..439516,440086..440180,441081..441226,
FT                   442692..442877,443834..443909,444831..444930,
FT                   448131..449811)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT189273"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189273.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<408308..408427,408731..408891,411410..411540,
FT                   411933..412077,415339..415437,421392..421481,
FT                   424451..424529,425727..425818,426127..426278,
FT                   428042..428200,429425..429517,431749..431808,
FT                   432934..432963,433052..433145,433998..434039,
FT                   436142..436225,436749..436847,437751..437886,
FT                   439467..439516,440086..440180,441081..441226,
FT                   442692..442877,443834..443909,444831..444930,
FT                   448131..449855)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT189274"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189274.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<408441..408612,408731..408854,411410..411540,
FT                   411933..412077,415339..415437,421392..421481,
FT                   424451..424529,425727..425818,426127..426278,
FT                   428042..428200,429425..429517,431749..431808,
FT                   432934..432963,433052..433145,433998..434039,
FT                   436142..436225,436731..436847,437751..437886,
FT                   439467..439516,440086..440180,441081..441226,
FT                   442692..442877,443834..443909,444831..444930,
FT                   448131..449578)
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, transcript variant mCT189276"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189276.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<408813..408854,411410..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436731..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443909,444831..444930,448131..448145)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_c"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189276.0
FT                   protein_id=mCP110271.0 isoform=CRA_c"
FT                   /protein_id="EDK99967.1"
FT                   /translation="LLVLNPEPAPGDSPRMSQWFELQQLDSKFLEQVHQLYDDSFPMEI
FT                   RQYLAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRN
FT                   LQDNFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRN
FT                   VKDQVMCIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLD
FT                   NKRKEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIV
FT                   AETLQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCM
FT                   PTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILG
FT                   THTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPG
FT                   LVIDLEVFVPFQTTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWS
FT                   QLSEVLSWQFSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFW
FT                   PWIDTILELIKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITF
FT                   TWVERSQNGGEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDK
FT                   DHAFGKYYSRPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFD
FT                   EMSRIVGPEFDSMMSTV"
FT   CDS             join(<408859..408891,411410..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436749..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443909,444831..444930,448131..448145)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189273.0
FT                   protein_id=mCP110268.0 isoform=CRA_a"
FT                   /protein_id="EDK99964.1"
FT                   /translation="VYVGTEAFGISRMSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQY
FT                   LAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQD
FT                   NFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKD
FT                   QVMCIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKR
FT                   KEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAET
FT                   LQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTH
FT                   PQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHT
FT                   KVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVI
FT                   DLETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQ
FT                   FSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILEL
FT                   IKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNG
FT                   GEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYS
FT                   RPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEMSRIVGPE
FT                   FDSMMSTV"
FT   CDS             join(<408859..408891,411410..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436749..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443909,444831..444930,448131..448145)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_a"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189274.0
FT                   protein_id=mCP110269.0 isoform=CRA_a"
FT                   /protein_id="EDK99965.1"
FT                   /translation="VYVGTEAFGISRMSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQY
FT                   LAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQD
FT                   NFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKD
FT                   QVMCIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKR
FT                   KEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAET
FT                   LQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTH
FT                   PQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHT
FT                   KVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVI
FT                   DLETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQ
FT                   FSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILEL
FT                   IKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNG
FT                   GEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYS
FT                   RPKEAPEPMELDDPKRTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEMSRIVGPE
FT                   FDSMMSTV"
FT   CDS             join(<408859..408891,411410..411540,411933..412077,
FT                   415339..415437,421392..421481,424451..424529,
FT                   425727..425818,426127..426278,428042..428200,
FT                   429425..429517,431749..431808,432934..432963,
FT                   433052..433145,433998..434039,436142..436225,
FT                   436749..436847,437751..437886,439467..439516,
FT                   440086..440180,441081..441226,442692..442877,
FT                   443834..443913)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_b"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT189275.0
FT                   protein_id=mCP110270.0 isoform=CRA_b"
FT                   /protein_id="EDK99966.1"
FT                   /translation="VYVGTEAFGISRMSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQY
FT                   LAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQD
FT                   NFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKD
FT                   QVMCIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKR
FT                   KEIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAET
FT                   LQQIRQQLKKLEELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTH
FT                   PQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHT
FT                   KVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVI
FT                   DLETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQ
FT                   FSSVTKRGLNADQLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILEL
FT                   IKKHLLCLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNG
FT                   GEPDFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYS
FT                   RPKEAPEPMELDDPKRTGYIKTELISVSEV"
FT   CDS             join(411413..411540,411933..412077,415339..415437,
FT                   421392..421481,424451..424529,425727..425818,
FT                   426127..426278,428042..428200,429425..429517,
FT                   431749..431808,432934..432963,433052..433145,
FT                   433998..434039,436142..436225,436749..436847,
FT                   437751..437886,439467..439516,440086..440180,
FT                   441081..441226,442692..442877,443834..443909,
FT                   444831..444930,448131..448145)
FT                   /codon_start=1
FT                   /gene="Stat1"
FT                   /locus_tag="mCG_123683"
FT                   /product="signal transducer and activator of transcription
FT                   1, isoform CRA_d"
FT                   /note="gene_id=mCG123683.2 transcript_id=mCT124917.1
FT                   protein_id=mCP74557.1 isoform=CRA_d"
FT                   /db_xref="GOA:Q8C3V4"
FT                   /db_xref="InterPro:IPR000980"
FT                   /db_xref="InterPro:IPR001217"
FT                   /db_xref="InterPro:IPR008967"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR012345"
FT                   /db_xref="InterPro:IPR013799"
FT                   /db_xref="InterPro:IPR013800"
FT                   /db_xref="InterPro:IPR013801"
FT                   /db_xref="InterPro:IPR015988"
FT                   /db_xref="InterPro:IPR022752"
FT                   /db_xref="MGI:MGI:103063"
FT                   /db_xref="UniProtKB/TrEMBL:Q8C3V4"
FT                   /protein_id="EDK99968.1"
FT                   /translation="MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEH
FT                   AAYDVSFATIRFHDLLSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPVQMSMI
FT                   IYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQKELDSKVRNVKDQVMCIEQEIKTL
FT                   EELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKRKEIIHKIRELLN
FT                   SIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAETLQQIRQQLKKLE
FT                   ELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQ
FT                   FTVKLRLLVKLQELNYNLKVKVSFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGS
FT                   LAAEFRHLQLKEQKNAGNRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVI
FT                   SNVSQLPSGWASILWYNMLVTEPRNLSFFLNPPCAWWSQLSEVLSWQFSSVTKRGLNAD
FT                   QLSMLGEKLLGPNAGPDGLIPWTRFCKENINDKNFSFWPWIDTILELIKKHLLCLWNDG
FT                   CIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYT
FT                   KKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELD
FT                   DPKRTGYIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEMSRIVGPEFDSMMSTV"
FT   gap             416334..416727
FT                   /estimated_length=394
FT   gene            complement(452299..>521752)
FT                   /locus_tag="mCG_123685"
FT                   /note="gene_id=mCG123685.1"
FT   mRNA            complement(join(452299..455162,457184..457247,
FT                   457333..457409,457745..457806,477527..477619,
FT                   478271..478402,479959..480135,485013..485063,
FT                   485591..485657,488559..488617,488703..488735,
FT                   496149..496207,501051..501214,503326..503405,
FT                   504413..504542,508336..508457,508791..508887,
FT                   521440..>521752))
FT                   /locus_tag="mCG_123685"
FT                   /product="mCG123685"
FT                   /note="gene_id=mCG123685.1 transcript_id=mCT124919.1
FT                   created on 01-APR-2003"
FT   CDS             complement(join(455006..455162,457184..457247,
FT                   457333..457409,457745..457806,477527..477619,
FT                   478271..478402,479959..480135,485013..485063,
FT                   485591..485657,488559..488617,488703..488735,
FT                   496149..496207,501051..501214,503326..503405,
FT                   504413..504542,508336..508457,508791..508887,
FT                   521440..>521750))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123685"
FT                   /product="mCG123685"
FT                   /note="gene_id=mCG123685.1 transcript_id=mCT124919.1
FT                   protein_id=mCP74803.1"
FT                   /protein_id="EDK99969.1"
FT                   /translation="LGTLCRRPRGGSRPTAGLVAAARLHPWWGGGGRAKGPGAGGLSSS
FT                   PSEILQELGKGGTPPQQQQQQQQQPGASPPAAPGPKDSPGETDAFGNSEGKEMVAAGDN
FT                   KIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMDMLRLTLQT
FT                   TSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELYESAKKQSGGKVA
FT                   DYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVH
FT                   RYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKM
FT                   AGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTC
FT                   ESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSG
FT                   VAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDP
FT                   RREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEV
FT                   VKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDDGKGNQT
FT                   VHKNLDGLL"
FT   gap             521753..521872
FT                   /estimated_length=120
FT   gap             527269..527288
FT                   /estimated_length=20
FT   gap             578514..578608
FT                   /estimated_length=95
FT   gap             591495..591776
FT                   /estimated_length=282
FT   gap             612611..612647
FT                   /estimated_length=37
FT   gene            620709..627051
FT                   /locus_tag="mCG_146942"
FT                   /note="gene_id=mCG146942.0"
FT   mRNA            join(620709..620771,623568..627051)
FT                   /locus_tag="mCG_146942"
FT                   /product="mCG146942"
FT                   /note="gene_id=mCG146942.0 transcript_id=mCT187205.0
FT                   created on 13-JAN-2004"
FT   CDS             626670..626951
FT                   /codon_start=1
FT                   /locus_tag="mCG_146942"
FT                   /product="mCG146942"
FT                   /note="gene_id=mCG146942.0 transcript_id=mCT187205.0
FT                   protein_id=mCP109541.0"
FT                   /protein_id="EDK99970.1"
FT                   /translation="MSGKGSLLDKPSWASRYLISMENSVLGLYDHRAVSFMLEAWLVFQ
FT                   VRSLAGSWKSSKPQVCAHQVSGSRPALPYQTSWHGFTSHMFPGRVFSF"
FT   gap             634282..634404
FT                   /estimated_length=123
FT   gap             692679..695641
FT                   /estimated_length=2963
FT   gene            complement(746118..789182)
FT                   /gene="Nab1"
FT                   /locus_tag="mCG_123682"
FT                   /note="gene_id=mCG123682.1"
FT   mRNA            complement(join(746118..748127,750909..751025,
FT                   753606..753768,755711..755800,768060..768111,
FT                   769693..769826,778743..779577,789032..789182))
FT                   /gene="Nab1"
FT                   /locus_tag="mCG_123682"
FT                   /product="Ngfi-A binding protein 1"
FT                   /note="gene_id=mCG123682.1 transcript_id=mCT124916.1
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(748039..748127,750909..751025,
FT                   753606..753768,755711..755800,768060..768111,
FT                   769693..769826,778743..779558))
FT                   /codon_start=1
FT                   /gene="Nab1"
FT                   /locus_tag="mCG_123682"
FT                   /product="Ngfi-A binding protein 1"
FT                   /note="gene_id=mCG123682.1 transcript_id=mCT124916.1
FT                   protein_id=mCP74549.1"
FT                   /db_xref="GOA:Q61122"
FT                   /db_xref="InterPro:IPR006986"
FT                   /db_xref="InterPro:IPR006988"
FT                   /db_xref="InterPro:IPR006989"
FT                   /db_xref="MGI:MGI:107564"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61122"
FT                   /protein_id="EDK99971.1"
FT                   /translation="MATALPRTLGELQLYRILQKANLLSYFDAFIQQGGDDVQQLCEAG
FT                   EEEFLEIMALVGMASKPLHVRRLQKALRDWVTNPGLFNQPLTSLPVSSIPIYKLPEGSP
FT                   TWLGISCNSYERSSSSREPHLKIPKCAATTCVQSLGQGKSEVGSLALQSVSDSRLWQGH
FT                   HATESEHSLSPADLGSPASPKESSEALDAAAALSVAECVERMAPTLPKSDLSEVKELLK
FT                   NNKKLAKMIGHIFEMSDEDPHKEEEIRKYSAIYGRFDSKRKDGKHLTLHELTVNEAAAQ
FT                   LCVKDNALLTRRDELFALARQVSREVTYKYTYRTTRLKCGERDELSPKRIKIEDGFPDF
FT                   QESVPTLFQQARAKSEELAGLGSQQAEKGMAKQMELLCAQAGYERLQQERRLTAGLYRQ
FT                   SSGEQSPDGGLPSDSSDGQGERPLNLRIPSVQNRQPHHFVVDGELSRLYSSEAKSHSSE
FT                   SLGILKDYPHSAFTLEKKVIKTEPEDSR"
FT   gap             790033..790052
FT                   /estimated_length=20
FT   gap             795076..795095
FT                   /estimated_length=20
FT   gap             811321..811730
FT                   /estimated_length=410
FT   gene            <813478..873826
FT                   /locus_tag="mCG_145851"
FT                   /note="gene_id=mCG145851.0"
FT   mRNA            join(<813478..813733,827726..827804,843581..843641,
FT                   861087..861158,873590..873826)
FT                   /locus_tag="mCG_145851"
FT                   /product="mCG145851"
FT                   /note="gene_id=mCG145851.0 transcript_id=mCT185959.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<813628..813733,827726..827804,843581..843641,
FT                   861087..861158,873590..873595)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145851"
FT                   /product="mCG145851"
FT                   /note="gene_id=mCG145851.0 transcript_id=mCT185959.0
FT                   protein_id=mCP107691.0"
FT                   /protein_id="EDK99972.1"
FT                   /translation="VARNALQVREMEQITYRVSLQKLGAEQEKPESTRSGPGGKCGSSS
FT                   DVHWWWSQESESPQSMWPTSCLLELCPDHVHDSHLLQVHKRVSYGKSTEVKVLGVSQAQ
FT                   QQS"
FT   gap             840716..840735
FT                   /estimated_length=20
FT   gene            complement(861054..>871335)
FT                   /locus_tag="mCG_144896"
FT                   /note="gene_id=mCG144896.0"
FT   mRNA            complement(join(861054..863528,866175..866302,
FT                   867414..867506,867614..867704,869818..869943,
FT                   871302..>871335))
FT                   /locus_tag="mCG_144896"
FT                   /product="mCG144896"
FT                   /note="gene_id=mCG144896.0 transcript_id=mCT184320.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(861368..>861637)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144896"
FT                   /product="mCG144896"
FT                   /note="gene_id=mCG144896.0 transcript_id=mCT184320.0
FT                   protein_id=mCP106125.0"
FT                   /protein_id="EDK99973.1"
FT                   /translation="YNTLEKGYFICLGVLLLGCLVLEVQRWALQLPRLLLYTVVTHQVV
FT                   AGNQTQVLWKSIQCSKPQNSLSGKIIIIIIIIIIIIIIILSWLW"
FT   gap             872181..872265
FT                   /estimated_length=85
FT   gene            875595..876812
FT                   /pseudo
FT                   /locus_tag="mCG_115456"
FT                   /note="gene_id=mCG115456.1"
FT   mRNA            875595..876812
FT                   /pseudo
FT                   /locus_tag="mCG_115456"
FT                   /note="gene_id=mCG115456.1 transcript_id=mCT116562.0
FT                   created on 11-JUL-2002"
FT   gene            <921884..943067
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /note="gene_id=mCG115466.2"
FT   mRNA            join(<921884..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,936409..936634,
FT                   939898..940074,940854..943067)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT189270"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT189270.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<921885..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,936409..936507)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_d"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT189270.0
FT                   protein_id=mCP110245.0 isoform=CRA_d"
FT                   /protein_id="EDK99977.1"
FT                   /translation="TSAALAAMLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSL
FT                   KETDLIKTSVSDCYCYNQHSQIQWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESIL
FT                   SFIKCVTHNFWAPEEAEEITIVFSPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLV
FT                   FVTGIFLFLYAKTLSQSPVFYYSSGTVLGILMTLVFVLLMAKKHIPKAMWWLLDFVALL
FT                   PVTVTGLLLMRGAETFSCGP"
FT   mRNA            join(921891..921999,928513..928628,936409..936634,
FT                   939898..940074,940854..941081)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT173366"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT173366.0
FT                   created on 20-SEP-2002"
FT   mRNA            join(<921894..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934316..934384,
FT                   936409..936634,939898..940074,940854..941784)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT189269"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT189269.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<921894..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934316..934336)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_c"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT189269.0
FT                   protein_id=mCP110244.0 isoform=CRA_c"
FT                   /protein_id="EDK99976.1"
FT                   /translation="ALAAMLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSLKET
FT                   DLIKTSVSDCYCYNQHSQIQWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESILSFI
FT                   KCVTHNFWAPEEAEEITIVFSPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLVFVT
FT                   GIFLFLYAKTLSQSPVFYYSSGTVLGILMTLVFVLLMAKKHIPKFMFCAS"
FT   mRNA            join(921898..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934270..934384,
FT                   936409..936634,939898..940074,940854..943067)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT116573"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT116573.1
FT                   created on 20-SEP-2002"
FT   mRNA            join(921898..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934316..934384,
FT                   936409..936634,939898..940074,940854..941189,
FT                   942948..943066)
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, transcript variant
FT                   mCT173365"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT173365.0
FT                   created on 20-SEP-2002"
FT   CDS             join(921906..921999,928513..928628,931977..932208,
FT                   932319..932391,933467..933560,934270..934384,
FT                   936409..936634,939898..940074,940854..940992)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_a"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT116573.1
FT                   protein_id=mCP74831.1 isoform=CRA_a"
FT                   /protein_id="EDK99974.1"
FT                   /translation="MLPRLWWLVLWLQPLATLPASAVHDEEAAMSVPRCKSLKETDLIK
FT                   TSVSDCYCYNQHSQIQWTYMWSTVQVTVTSPGLLNIVYITGSHNCQHTESILSFIKCVT
FT                   HNFWAPEEAEEITIVFSPYGETVCFSVKPVGRLLPYIVSVSRNIVDFKLFLVFVTGIFL
FT                   FLYAKTLSQSPVFYYSSGTVLGILMTLVFVLLMAKKHIPKYSTFGALMIGCWFASVYVL
FT                   CQLMEDLKWLWYGNRMYILGYVVVVGLCSFAACYSHGPLADEGSRDLLMWTLRLFSLAL
FT                   VYTGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYLRWKMRPWFTAEPQVARYLTDDEYRE
FT                   QAEAATARALEELRQACCRPDFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQY
FT                   GLGGAFLEEQLFSLQTDSLPAS"
FT   CDS             join(934336..934384,936409..936634,939898..940074,
FT                   940854..940992)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_b"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT173365.0
FT                   protein_id=mCP96284.0 isoform=CRA_b"
FT                   /protein_id="EDK99975.1"
FT                   /translation="MEDLKWLWYGNRMYILGYVVVVGLCSFAACYSHGPLADEGSRDLL
FT                   MWTLRLFSLALVYTGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYLRWKMRPWFTAEPQV
FT                   ARYLTDDEYREQAEAATARALEELRQACCRPDFPSWLAVSRLQAPKKFAEFVLGASHLS
FT                   PEEVSTHEKQYGLGGAFLEEQLFSLQTDSLPAS"
FT   CDS             join(936495..936634,939898..940074,940854..940992)
FT                   /codon_start=1
FT                   /gene="5330401P04Rik"
FT                   /locus_tag="mCG_115466"
FT                   /product="RIKEN cDNA 5330401P04, isoform CRA_e"
FT                   /note="gene_id=mCG115466.2 transcript_id=mCT173366.0
FT                   protein_id=mCP96285.0 isoform=CRA_e"
FT                   /db_xref="GOA:Q8BSW9"
FT                   /db_xref="InterPro:IPR019358"
FT                   /db_xref="MGI:MGI:2444113"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BSW9"
FT                   /protein_id="EDK99978.1"
FT                   /translation="MWTLRLFSLALVYTGVAAPQFAYAVLIVLLFSWSLHYLLRAFSYL
FT                   RWKMRPWFTAEPQVARYLTDDEYREQAEAATARALEELRQACCRPDFPSWLAVSRLQAP
FT                   KKFAEFVLGASHLSPEEVSTHEKQYGLGGAFLEEQLFSLQTDSLPAS"
FT   gene            complement(947456..>1018861)
FT                   /gene="2210010L05Rik"
FT                   /locus_tag="mCG_115461"
FT                   /note="gene_id=mCG115461.1"
FT   mRNA            complement(join(947456..949695,951957..952237,
FT                   953540..953638,954466..954627,967800..967897,
FT                   999519..1001110,1018378..1018559,1018632..>1018861))
FT                   /gene="2210010L05Rik"
FT                   /locus_tag="mCG_115461"
FT                   /product="RIKEN cDNA 2210010L05"
FT                   /note="gene_id=mCG115461.1 transcript_id=mCT116567.1
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(949492..949695,951957..952237,
FT                   953540..953638,954466..954627,967800..967897,
FT                   999519..>1001062))
FT                   /codon_start=1
FT                   /gene="2210010L05Rik"
FT                   /locus_tag="mCG_115461"
FT                   /product="RIKEN cDNA 2210010L05"
FT                   /note="gene_id=mCG115461.1 transcript_id=mCT116567.1
FT                   protein_id=mCP74624.1"
FT                   /protein_id="EDK99979.1"
FT                   /translation="AMAADDKVAILTDDEEEQKRKYVLADPFNGICREPEPPSNETPSS
FT                   TETSAIPEEEIDWIEKHCVKVNNDLLISKVFYFFFYSAYGSLYPLLPVYYKQLGMSPSQ
FT                   SGLLVGIRYFIEFCSAPFWGVVADRFRKGKIVLLFSLLCWVLFNLGIGFVKPATLRCLP
FT                   KIPPTAHPTNVSHPVTVLPMNSSTVAFFSTPPKLLQKRDVQLSETEPNISDIDLVSTAL
FT                   TLTSEPTRRPQTEAITHPVTGLILNTSTVTLPPTGNVTRETTIAVVTTTKSLPSDQVTL
FT                   VYDQQEVEAIFLIILVVVIIGEFFSASSVTIVDTVTLQYLGKHRDRYGLQRMWGSLGWG
FT                   LAMLSVGIGIDYTHIDVLIDGKGCKPPEYRNYQIVFIVFGVLMTMALIVATQFRFRYNH
FT                   FNNSDGKGKEVEIPQVERDNSTESSEETPTAATHSQAFNFWDLIKLLCSVQYGSVLFVA
FT                   WFMGFGYGFVFTFLYWHLEDLNGTTTLFGVCSVLSHVSELTAYFFSHKLIELIGHIRVL
FT                   YIGLACNTARYIYISYLENAWTVLPMEVLQGVTHAAIWAACISYLSAAVPPELRTSAQG
FT                   ILQGLHLGLGRGCGAMIGGVLVNYFGAAATFRGIGMACLVILLLFALIQWLAVPDEEED
FT                   KTMLAERIPVPSSPVPIATIDLVQQQTEDVMPRVEARLPPKKTKHQEEQEDVNKPAWGV
FT                   SSSPWVTFVYALYQVKELIQLTRESRASEIQPLQGTSENREASPAGGAQRAPRETHSAS
FT                   PRNQPSPDTAASQTQSSPAHPSATPHGQESGEKQAQPTVGEH"
FT   gap             954209..954228
FT                   /estimated_length=20
FT   gap             958986..959515
FT                   /estimated_length=530
FT   gap             976505..976558
FT                   /estimated_length=54
FT   gap             1018560..1018631
FT                   /estimated_length=72
FT   gap             1029089..1029236
FT                   /estimated_length=148
FT   gap             1030638..1030713
FT                   /estimated_length=76
FT   gap             1043792..1044034
FT                   /estimated_length=243
FT   gap             1046382..1047128
FT                   /estimated_length=747
FT   gap             1048591..1048610
FT                   /estimated_length=20
FT   gap             1056348..1056367
FT                   /estimated_length=20
FT   gap             1062540..1063224
FT                   /estimated_length=685
FT   gene            complement(1079658..1108889)
FT                   /gene="Inpp1"
FT                   /locus_tag="mCG_115454"
FT                   /note="gene_id=mCG115454.1"
FT   mRNA            complement(join(1079658..1081409,1082880..1083054,
FT                   1085662..1085862,1088233..1088293,1090477..1090728,
FT                   1108602..1108889))
FT                   /gene="Inpp1"
FT                   /locus_tag="mCG_115454"
FT                   /product="inositol polyphosphate-1-phosphatase"
FT                   /note="gene_id=mCG115454.1 transcript_id=mCT116561.1
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(1080860..1081409,1082880..1083054,
FT                   1085662..1085862,1088233..1088293,1090477..1090680))
FT                   /codon_start=1
FT                   /gene="Inpp1"
FT                   /locus_tag="mCG_115454"
FT                   /product="inositol polyphosphate-1-phosphatase"
FT                   /note="gene_id=mCG115454.1 transcript_id=mCT116561.1
FT                   protein_id=mCP74580.1"
FT                   /protein_id="EDK99980.1"
FT                   /translation="MSDILLELLCVSEKAANIARACRQQETLFQLLIEEKKGAEKNKKF
FT                   AADFKTLADVLVQEVIKQNMENKFPGLGKKVFGEESNEFTNDLGEKITVELQSTEEETA
FT                   ELLSKVLNGNMPASEALAQVVHEDVDLTDPTLESLDISIPHESLGIWVDPIDSTYQYIK
FT                   GSANVKSNQGIFPSGLQCVTILIGVYDLQTGLPLMGVINQPFASQNLTTLRWKGQCYWG
FT                   LSYMGTNIHSLQLAISKSDSETQTENSDREFSSPFSAVISTSEKDTIKAALSRVCGGSV
FT                   FPAAGAGYKSLCVIQGLADIYIFSEDTTYKWDSCAAHAILRAMGGGIVDMKECLERSPD
FT                   TGLDLPQLLYHVENKGASGVELWANKGGLIAYRSRNRLDTFLSRLIQNLGPVKTQA"
FT   gap             1093765..1093784
FT                   /estimated_length=20
FT   gap             1128921..1128940
FT                   /estimated_length=20
FT   gap             1135049..1135183
FT                   /estimated_length=135
FT   gene            <1136382..1211952
FT                   /gene="Hibch"
FT                   /locus_tag="mCG_115463"
FT                   /note="gene_id=mCG115463.1"
FT   mRNA            join(<1136382..1136481,1145009..1145051,1151369..1151506,
FT                   1153609..1153693,1156890..1156970,1160247..1160299,
FT                   1176440..1176518,1192191..1192336,1193850..1193936,
FT                   1195647..1195705,1196376..1196457,1204736..1204855,
FT                   1207642..1207675,1211268..1211952)
FT                   /gene="Hibch"
FT                   /locus_tag="mCG_115463"
FT                   /product="3-hydroxyisobutyryl-Coenzyme A hydrolase"
FT                   /note="gene_id=mCG115463.1 transcript_id=mCT116569.1
FT                   created on 04-SEP-2002"
FT   CDS             join(<1136444..1136481,1145009..1145051,1151369..1151506,
FT                   1153609..1153693,1156890..1156970,1160247..1160299,
FT                   1176440..1176518,1192191..1192336,1193850..1193936,
FT                   1195647..1195705,1196376..1196457,1204736..1204855,
FT                   1207642..1207675,1211268..1211383)
FT                   /codon_start=1
FT                   /gene="Hibch"
FT                   /locus_tag="mCG_115463"
FT                   /product="3-hydroxyisobutyryl-Coenzyme A hydrolase"
FT                   /note="gene_id=mCG115463.1 transcript_id=mCT116569.1
FT                   protein_id=mCP74634.1"
FT                   /protein_id="EDK99981.1"
FT                   /translation="AMGQPYAWRLLSRVSSFRRASVILQHLRMSMHTEAAEVLLERRGC
FT                   GGVITLNRPKFLNALSLNMIRQIYPQLKTWEQDPDTFLIIIKGAGGKAFCAGGDIKALS
FT                   EAKKARQNLTQDLFREEYILNNAIASCQKPYVALIDGITMGGGVGLSVHGQFRVATERS
FT                   LFAMPETGIGLFPDVGGGYFLPRLQGKLGYFLALTGYRLKGRDVHRAGIATHFVDSEKL
FT                   RVLEEELLALKSPSAEDVAGVLESYHAKSKMDQDKSIIFEEHMDKINSCFSANTVEQII
FT                   ENLRQDGSPFAIEQMKVINKMSPTSLKITLRQLMEGSSKTLQEVLIMEYRITQACMEGH
FT                   DFHEGVRAVLIDKDQTPKWKPANLKDVTDEDLNSYFKSLGSSDLKF"
FT   gap             1181040..1183895
FT                   /estimated_length=2856
FT   gap             1214502..1215099
FT                   /estimated_length=598
FT   gene            complement(1215694..1253449)
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /note="gene_id=mCG115472.1"
FT   mRNA            complement(join(1215694..1216522,1253241..1253449))
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, transcript variant
FT                   mCT116579"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT116579.1
FT                   created on 04-SEP-2002"
FT   mRNA            complement(join(1215695..1216522,1242803..1242991))
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, transcript variant
FT                   mCT172696"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT172696.0
FT                   created on 04-SEP-2002"
FT   mRNA            complement(join(1215695..1216522,1238147..1238165))
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, transcript variant
FT                   mCT172697"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT172697.0
FT                   created on 04-SEP-2002"
FT   CDS             complement(1216035..1216355)
FT                   /codon_start=1
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, isoform CRA_a"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT172697.0
FT                   protein_id=mCP95616.0 isoform=CRA_a"
FT                   /protein_id="EDK99982.1"
FT                   /translation="MGCMKSKETFPFPTTLDIDKLHESEEAFIPDDSSQYRTPSPGEQQ
FT                   QVQEVKKLPEPGAVIGALILEFADRLASEIVEDALQQWACENIQYYNIPYIESEGSDTT
FT                   IN"
FT   CDS             complement(1216035..1216355)
FT                   /codon_start=1
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, isoform CRA_a"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT116579.1
FT                   protein_id=mCP74781.1 isoform=CRA_a"
FT                   /protein_id="EDK99983.1"
FT                   /translation="MGCMKSKETFPFPTTLDIDKLHESEEAFIPDDSSQYRTPSPGEQQ
FT                   QVQEVKKLPEPGAVIGALILEFADRLASEIVEDALQQWACENIQYYNIPYIESEGSDTT
FT                   IN"
FT   CDS             complement(1216035..1216355)
FT                   /codon_start=1
FT                   /gene="1700019D03Rik"
FT                   /locus_tag="mCG_115472"
FT                   /product="RIKEN cDNA 1700019D03, isoform CRA_a"
FT                   /note="gene_id=mCG115472.1 transcript_id=mCT172696.0
FT                   protein_id=mCP95615.0 isoform=CRA_a"
FT                   /protein_id="EDK99984.1"
FT                   /translation="MGCMKSKETFPFPTTLDIDKLHESEEAFIPDDSSQYRTPSPGEQQ
FT                   QVQEVKKLPEPGAVIGALILEFADRLASEIVEDALQQWACENIQYYNIPYIESEGSDTT
FT                   IN"
FT   gap             1233415..1233434
FT                   /estimated_length=20
FT   gap             1240691..1240710
FT                   /estimated_length=20
FT   gap             1246461..1246480
FT                   /estimated_length=20
FT   gap             1254534..1254606
FT                   /estimated_length=73
FT   gap             1271358..1271588
FT                   /estimated_length=231
FT   gap             1293833..1293949
FT                   /estimated_length=117
FT   gap             1322068..1322087
FT                   /estimated_length=20
FT   gap             1347415..1347434
FT                   /estimated_length=20
FT   gene            1351889..1358305
FT                   /gene="Gdf8"
FT                   /locus_tag="mCG_115453"
FT                   /note="gene_id=mCG115453.1"
FT   mRNA            join(1351889..1352367,1354109..1354482,1356477..1358305)
FT                   /gene="Gdf8"
FT                   /locus_tag="mCG_115453"
FT                   /product="growth differentiation factor 8"
FT                   /note="gene_id=mCG115453.1 transcript_id=mCT116559.0
FT                   created on 11-JUL-2002"
FT   CDS             join(1351992..1352367,1354109..1354482,1356477..1356857)
FT                   /codon_start=1
FT                   /gene="Gdf8"
FT                   /locus_tag="mCG_115453"
FT                   /product="growth differentiation factor 8"
FT                   /note="gene_id=mCG115453.1 transcript_id=mCT116559.0
FT                   protein_id=mCP74577.1"
FT                   /db_xref="GOA:Q540E2"
FT                   /db_xref="InterPro:IPR001111"
FT                   /db_xref="InterPro:IPR001839"
FT                   /db_xref="InterPro:IPR015615"
FT                   /db_xref="InterPro:IPR015616"
FT                   /db_xref="InterPro:IPR017948"
FT                   /db_xref="MGI:MGI:95691"
FT                   /db_xref="UniProtKB/TrEMBL:Q540E2"
FT                   /protein_id="EDK99985.1"
FT                   /translation="MMQKLQMYVYIYLFMLIAAGPVDLNEGSEREENVEKEGLCNACAW
FT                   RQNTRYSRIEAIKIQILSKLRLETAPNISKDAIRQLLPRAPPLRELIDQYDVQRDDSSD
FT                   GSLEDDDYHATTETIITMPTESDFLMQADGKPKCCFFKFSSKIQYNKVVKAQLWIYLRP
FT                   VKTPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMSPGTGIWQSIDVKTVLQNWLKQPES
FT                   NLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESR
FT                   CCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPC
FT                   CTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS"
FT   gap             1361134..1361153
FT                   /estimated_length=20
FT   gap             1369397..1369416
FT                   /estimated_length=20
FT   gap             1373855..1373874
FT                   /estimated_length=20
FT   gap             1384352..1384371
FT                   /estimated_length=20
FT   gap             1415982..1416200
FT                   /estimated_length=219
FT   gap             1420720..1423557
FT                   /estimated_length=2838
FT   gap             1443920..1444052
FT                   /estimated_length=133
FT   gap             1445320..1445353
FT                   /estimated_length=34
FT   gene            complement(1448085..1477292)
FT                   /locus_tag="mCG_115476"
FT                   /note="gene_id=mCG115476.1"
FT   mRNA            complement(join(1448085..1448297,1452735..1452754,
FT                   1459641..1459663,1459791..1459861,1467173..1467230,
FT                   1471518..1471570,1472170..1472219,1474890..1474965,
FT                   1477229..1477292))
FT                   /locus_tag="mCG_115476"
FT                   /product="mCG115476"
FT                   /note="gene_id=mCG115476.1 transcript_id=mCT116583.1
FT                   created on 04-SEP-2002"
FT   CDS             complement(join(1448256..1448297,1452735..1452754,
FT                   1459641..1459663,1459791..1459861,1467173..1467230,
FT                   1471518..1471570,1472170..1472219,1474890..1474965,
FT                   1477229..1477276))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115476"
FT                   /product="mCG115476"
FT                   /note="gene_id=mCG115476.1 transcript_id=mCT116583.1
FT                   protein_id=mCP74793.1"
FT                   /db_xref="GOA:Q9DA74"
FT                   /db_xref="MGI:MGI:1916647"
FT                   /db_xref="UniProtKB/TrEMBL:Q9DA74"
FT                   /protein_id="EDK99986.1"
FT                   /translation="MAGAGSNGETLATRMEIIEMNDKLRNRQEIVNGLNIFLEENEEEA
FT                   YLEELEEESDMFEEEETEALNEDGSKEAHNNVRTSHKVSLRSIASMTDEERFNMRIKKF
FT                   GITSKEFRKSPVASCFGLPLSTGKENADMEKKRRRLERFGLS"
FT   gap             1456548..1456589
FT                   /estimated_length=42
FT   gap             1468288..1470107
FT                   /estimated_length=1820
FT   gene            complement(1478316..>1586778)
FT                   /gene="Pms1"
FT                   /locus_tag="mCG_115459"
FT                   /note="gene_id=mCG115459.1"
FT   mRNA            complement(join(1478316..1479171,1481773..1481933,
FT                   1484601..1484731,1486496..1486975,1496235..1497085,
FT                   1497249..1497392,1497636..1497758,1505904..1506020,
FT                   1546378..1546541,1557588..1557690,1564852..1565034,
FT                   1571724..1571875,1586668..>1586778))
FT                   /gene="Pms1"
FT                   /locus_tag="mCG_115459"
FT                   /product="postmeiotic segregation increased 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG115459.1 transcript_id=mCT116566.1
FT                   created on 20-SEP-2002"
FT   CDS             complement(join(1479007..1479171,1481773..1481933,
FT                   1484601..1484731,1486496..1486975,1496235..1497085,
FT                   1497249..1497392,1497636..1497758,1505904..1506020,
FT                   1546378..1546541,1557588..1557690,1564852..1565034,
FT                   1571724..>1571873))
FT                   /codon_start=1
FT                   /gene="Pms1"
FT                   /locus_tag="mCG_115459"
FT                   /product="postmeiotic segregation increased 1 (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG115459.1 transcript_id=mCT116566.1
FT                   protein_id=mCP74619.0"
FT                   /protein_id="EDK99987.1"
FT                   /translation="TQVQARMKQLPAATVRLLSSSQTITSVVSVVKELIENSLDAGATS
FT                   IEVKLENYGFDKIEIRDNGEGIKAVDVPVMAVKYYTSKISSHEDLGNLTTYGFRGEALG
FT                   SICNVAEVVVTTRTSADDFSTQYVLDGSGHILSQKPSHLGQGTTVTALKLFKNLPVRKQ
FT                   FYSTAKKCKDELKNVQDLLISYGVLKPDVRITFVHNKAVIWQKSRVPDHRMALMSVLGT
FT                   AVMGNMESVEQHCEQSQIYLSGFFPKHDADHNSTSLSTPERSFIFINSRPVHQKDILKL
FT                   IRRYYNLKCLKESTRLYPIFFLKIDVPSAEVDINLTPDKSQVLLQNKESVLIALENLMM
FT                   TCYGPLPTTESSENNRVDISSANMVVSQTAETDVLFNKMESFGNNYPNADTSAIHFQKD
FT                   ESRKNIDHHLNEQINIGNYFDGHFSGDINKDTFQNIPMNNLSSETNQSNHSETHSVGSM
FT                   EHIQGENGRNGTGGSGGDGRETLPEKALEICADDWSKGNLCNSMGENIEPVKILVPQKS
FT                   LSCKVTSSHPRLEPETLSDGPCSRTSDVIHNRSGRLTAYDLISSRAVKKPMSASALFIQ
FT                   DHRTQFLTENPKTGLEDATEQIKARWETLSEEEKHKYEEKAKKDLERYNNQMKKAIEQE
FT                   TQVSLKDGRKKRATSSWGWTQKHKVKDSSNQPKLDELFQSQNEKKKSENIKITEIPFSM
FT                   ENLKANLKKQKEVDLEEKDEIYLIHSLKFPDSWLVTSRADVMLLNPYRVEEALLFKRLL
FT                   ENHKLLAEPLEKPIILTESLLNGSHYLEVLYKMSTVEERGSGSAYLCDPRLTANGFKIR
FT                   LTPGVSSTENYLEIEGMAQCLPFYGIMDLKEILNAIVNKNAKEIYECRPRKVINYLEGE
FT                   AVRLSRQLPMYLPREDVQDLIYRMKHQFGKEIKGCVHGRPFFHHLTHLPGTS"
FT   gene            <1485785..>1487366
FT                   /locus_tag="mCG_145849"
FT                   /note="gene_id=mCG145849.0"
FT   mRNA            join(<1485785..1485906,1486525..1486662,1487093..>1487366)
FT                   /locus_tag="mCG_145849"
FT                   /product="mCG145849"
FT                   /note="gene_id=mCG145849.0 transcript_id=mCT185957.0
FT                   created on 03-JUL-2003"
FT   CDS             <1487113..>1487366
FT                   /codon_start=1
FT                   /locus_tag="mCG_145849"
FT                   /product="mCG145849"
FT                   /note="gene_id=mCG145849.0 transcript_id=mCT185957.0
FT                   protein_id=mCP107689.0"
FT                   /protein_id="EDK99988.1"
FT                   /translation="DKLQTEHRNRPLKSSQKQMRKDCTCIHEARPSISRWELQESARRW
FT                   KALITLYHQNTDPCFQNNLKSRENPMCESSRENIKTLMN"
FT   gap             1511256..1511387
FT                   /estimated_length=132
FT   gap             1550800..1550850
FT                   /estimated_length=51
FT   gene            1586891..1600078
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /note="gene_id=mCG146958.1"
FT   mRNA            join(1586891..1586970,1588754..1588934,1595224..1595375,
FT                   1598596..1600078)
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /product="ORM1-like 1 (S. cerevisiae), transcript variant
FT                   mCT189319"
FT                   /note="gene_id=mCG146958.1 transcript_id=mCT189319.1
FT                   created on 29-SEP-2004"
FT   mRNA            join(1586891..1586970,1588754..1591737)
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /product="ORM1-like 1 (S. cerevisiae), transcript variant
FT                   mCT187221"
FT                   /note="gene_id=mCG146958.1 transcript_id=mCT187221.1
FT                   created on 29-SEP-2004"
FT   CDS             join(1588761..1588934,1595224..1595375,1598596..1598731)
FT                   /codon_start=1
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /product="ORM1-like 1 (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG146958.1 transcript_id=mCT189319.1
FT                   protein_id=mCP110308.1 isoform=CRA_a"
FT                   /protein_id="EDK99989.1"
FT                   /translation="MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSV
FT                   PVAWTLTNIIHNLGMYVFLHAVKGTPFETPDQGRARLLTHWEQLDYGVQFTSSRKFFTI
FT                   SPIILYFLASFYTKYDPTHFILNTASLLSVLIPKMPQLHGVRIFGINKY"
FT   CDS             1588761..1588973
FT                   /codon_start=1
FT                   /gene="Ormdl1"
FT                   /locus_tag="mCG_146958"
FT                   /product="ORM1-like 1 (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG146958.1 transcript_id=mCT187221.1
FT                   protein_id=mCP109557.1 isoform=CRA_b"
FT                   /protein_id="EDK99990.1"
FT                   /translation="MNVGVAHSEVNPNTRVMNSRGMWLTYALGVGLLHIVLLSIPFCSV
FT                   PVAWTLTNIIHNLVRTPSSFQYGEL"
FT   gap             1592654..1592673
FT                   /estimated_length=20
FT   gene            1603404..1616109
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /note="gene_id=mCG115464.1"
FT   mRNA            join(1603404..1603627,1604625..1604868,1607671..1608058,
FT                   1609712..1610065,1610849..1610979,1611265..1611336,
FT                   1612936..1613039,1615773..1616109)
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1,
FT                   transcript variant mCT116571"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT116571.1
FT                   created on 04-SEP-2002"
FT   mRNA            join(<1603423..1603627,1604625..1604868,1607676..1608058,
FT                   1609712..1610065,1610849..1610979,1612936..1613039,
FT                   1615773..1615919)
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1,
FT                   transcript variant mCT189268"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT189268.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<1603430..1603627,1604625..1604868,1607671..1608058,
FT                   1609712..1610065,1610849..1610979,1611265..1611336,
FT                   1612936..1613833)
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1,
FT                   transcript variant mCT189267"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT189267.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<1603603..1603627,1604625..1604868,1607671..1608058,
FT                   1609712..1610065,1610849..1610979,1611265..1611336,
FT                   1612936..1613014)
FT                   /codon_start=1
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT189267.0
FT                   protein_id=mCP110242.0 isoform=CRA_b"
FT                   /protein_id="EDK99992.1"
FT                   /translation="FTLSPVTAGSICRVTNMLMLRRTAGAIPKPPKSKVYGFLRRFSVH
FT                   PRTLSCHKLVLGIETSCDDTGAAVVDETGNVLGEALHSQTQVHLKTGGIVPPVAQQLHR
FT                   ENIQRIVEETLSACRITPSDLSAIATTIKPGLALSLGVGLSFSLQLVNQFKKPFIPIHH
FT                   MEAHALTIRLTNKVEFPFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVAR
FT                   RLSLIKHPECSTMSGGKAIEQLAKDGNRFHFTINPPMQNAKNCDFSFTGLQHITDKLIT
FT                   HKEKEEGIEKGQILSSAADIAAAVQHATACHLAKRTHRAILFCKQKNLLSPANAVLVVS
FT                   GGVASNLYIRKALEIVANATQCTLLCPPPRLCTDNGIMIAWNGIERLRAGLGVLHDVED
FT                   IRYEPKCPLGVDISREVAEAAIKVPRLKMAL"
FT   CDS             join(1604648..1604868,1607671..1608058,1609712..1610065,
FT                   1610849..1610979,1611265..1611336,1612936..1613014)
FT                   /codon_start=1
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT116571.1
FT                   protein_id=mCP74819.1 isoform=CRA_a"
FT                   /protein_id="EDK99991.1"
FT                   /translation="MLMLRRTAGAIPKPPKSKVYGFLRRFSVHPRTLSCHKLVLGIETS
FT                   CDDTGAAVVDETGNVLGEALHSQTQVHLKTGGIVPPVAQQLHRENIQRIVEETLSACRI
FT                   TPSDLSAIATTIKPGLALSLGVGLSFSLQLVNQFKKPFIPIHHMEAHALTIRLTNKVEF
FT                   PFLVLLISGGHCLLALVQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGG
FT                   KAIEQLAKDGNRFHFTINPPMQNAKNCDFSFTGLQHITDKLITHKEKEEGIEKGQILSS
FT                   AADIAAAVQHATACHLAKRTHRAILFCKQKNLLSPANAVLVVSGGVASNLYIRKALEIV
FT                   ANATQCTLLCPPPRLCTDNGIMIAWNGIERLRAGLGVLHDVEDIRYEPKCPLGVDISRE
FT                   VAEAAIKVPRLKMAL"
FT   CDS             join(<1604868..1604868,1607676..1608058,1609712..1610065,
FT                   1610849..1610979,1612936)
FT                   /codon_start=1
FT                   /gene="Osgepl1"
FT                   /locus_tag="mCG_115464"
FT                   /product="O-sialoglycoprotein endopeptidase-like 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG115464.1 transcript_id=mCT189268.0
FT                   protein_id=mCP110243.0 isoform=CRA_c"
FT                   /protein_id="EDK99993.1"
FT                   /translation="SGIVPPVAQQLHRENIQRIVEETLSACRITPSDLSAIATTIKPGL
FT                   ALSLGVGLSFSLQLVNQFKKPFIPIHHMEAHALTIRLTNKVEFPFLVLLISGGHCLLAL
FT                   VQGVSDFLLLGKSLDIAPGDMLDKVARRLSLIKHPECSTMSGGKAIEQLAKDGNRFHFT
FT                   INPPMQNAKNCDFSFTGLQHITDKLITHKEKEEGIEKGQILSSAADIAAAVQHATACHL
FT                   AKRTHRAILFCKQKNLLSPANAVLVVSGGVASNLYIRKALEIVANATQCTLLCPPPRLC
FT                   TDNGIMIA"
FT   gene            complement(1616001..1632794)
FT                   /locus_tag="mCG_115474"
FT                   /note="gene_id=mCG115474.1"
FT   mRNA            complement(join(1616001..1616226,1619981..1620177,
FT                   1632577..1632794))
FT                   /locus_tag="mCG_115474"
FT                   /product="mCG115474"
FT                   /note="gene_id=mCG115474.1 transcript_id=mCT116581.1
FT                   created on 20-SEP-2002"
FT   CDS             complement(join(1620104..1620177,1632577..1632685))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115474"
FT                   /product="mCG115474"
FT                   /note="gene_id=mCG115474.1 transcript_id=mCT116581.1
FT                   protein_id=mCP74789.1"
FT                   /protein_id="EDK99994.1"
FT                   /translation="MHIPGLRRNLHDGGPRTALTGSGVSQEFEPTLALSTGSHSMFLCP
FT                   LLPHLQCTCFPTSVN"
FT   gap             1629333..1629352
FT                   /estimated_length=20
FT   gene            complement(1635220..1643174)
FT                   /locus_tag="mCG_115470"
FT                   /note="gene_id=mCG115470.1"
FT   mRNA            complement(join(1635220..1635583,1637184..1637365,
FT                   1639050..1639162,1640591..1640666,1641484..1641537,
FT                   1643134..1643174))
FT                   /locus_tag="mCG_115470"
FT                   /product="mCG115470, transcript variant mCT171052"
FT                   /note="gene_id=mCG115470.1 transcript_id=mCT171052.0
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(1635220..1635583,1637184..1637365,
FT                   1637619..1639162,1640591..1640666,1641484..1641537,
FT                   1643134..1643174))
FT                   /locus_tag="mCG_115470"
FT                   /product="mCG115470, transcript variant mCT116577"
FT                   /note="gene_id=mCG115470.1 transcript_id=mCT116577.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(1635334..1635583,1637184..1637365,
FT                   1639050..1639070))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115470"
FT                   /product="mCG115470, isoform CRA_b"
FT                   /note="gene_id=mCG115470.1 transcript_id=mCT171052.0
FT                   protein_id=mCP93970.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3TGY6"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="MGI:MGI:1917646"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TGY6"
FT                   /protein_id="EDK99996.1"
FT                   /translation="MCGICCSVILTGIGADEQLAGYSRHRARFQSLGLEGLNEEIAMEL
FT                   GRISSRNLGRDDRVIGDHGKEARFPFLDENVVSFLNSLPVWEKVDLTLPRGVGEKLILR
FT                   LAAMELGLPASALLPKRAIQFGSRIAKLEKSNEKASDKCGRLQILP"
FT   CDS             complement(join(1635334..1635583,1637184..1637365,
FT                   1637619..1639070))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115470"
FT                   /product="mCG115470, isoform CRA_a"
FT                   /note="gene_id=mCG115470.1 transcript_id=mCT116577.0
FT                   protein_id=mCP74853.1 isoform=CRA_a"
FT                   /protein_id="EDK99995.1"
FT                   /translation="MCGICCSVSFSIEHFSKELKEDLLHNLRRRGPNSSRQLLKSAVNY
FT                   QCLFSGHVLHLRGVLTIQPVEDEHGNVFLWNGEVFNGVKVEAEDNDTQVMFNSLSACKN
FT                   ESEILLLFSKVQGPWSFIYYQASSHHLWFGRDFFGRRSLLWQFSNLGKSFCLSSVGTQV
FT                   YGVADQWQEVPASGIFQIDLNSAAVSRSVILKLYPWRYISKEDIAEECGNDLTQTPAGL
FT                   PEFVSVVINEANLYLSKPVVPLNKKLPESPLEIQCRNSSSTSGTRETLEVFLTDEHTKK
FT                   IVQQFIAILNVSVKRRILCLAREENLASKEVLKTCSSKANIAILFSGGVDSMVIAALAD
FT                   RHIPLDEPIDLLNVAFVPKQKTGLPIPNIERKQQNHHEIPSEESSQSPAADEGPGEAEV
FT                   PDRVTGKAGLKELQSVNPSRTWNFVEINVSLEELQKLRRARICHLVQPLDTVLDDSIGC
FT                   AVWFASRGIGWLVTQDAVRSYKSSAKVILTGIGADEQLAGYSRHRARFQSLGLEGLNEE
FT                   IAMELGRISSRNLGRDDRVIGDHGKEARFPFLDENVVSFLNSLPVWEKVDLTLPRGVGE
FT                   KLILRLAAMELGLPASALLPKRAIQFGSRIAKLEKSNEKASDKCGRLQILP"
FT   gap             1643175..1643763
FT                   /estimated_length=589
FT   gap             1649086..1649385
FT                   /estimated_length=300
FT   gene            complement(1686841..1952543)
FT                   /locus_tag="mCG_115458"
FT                   /note="gene_id=mCG115458.1"
FT   mRNA            complement(join(1686841..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718321..1718482,
FT                   1723386..1723586,1724446..1724607,1727926..1728102,
FT                   1734921..1735028,1737813..1738007,1739424..1739550,
FT                   1747031..1747366,1748166..1748299,1759115..1759305,
FT                   1763297..1763451,1770148..1770311,1773798..1773983,
FT                   1784482..1784662,1785590..1785936,1786720..1787050,
FT                   1791382..1791611,1793408..1794280,1808420..1808639,
FT                   1811056..1811182,1812169..1812337,1813749..1813904,
FT                   1814898..1815095,1818633..1818857,1821068..1821199,
FT                   1824381..1824557,1825335..1825517,1827457..1827606,
FT                   1830839..1831087,1834388..1834486,1837103..1837315,
FT                   1849021..1849148,1849260..1849362,1851883..1852051,
FT                   1855644..1855753,1857016..1857228,1867170..1867307,
FT                   1874446..1874615,1895750..1895940,1907681..1908315,
FT                   1925950..1926133,1930292..1930411,1933397..1933522,
FT                   1937275..1937350,1952357..1952543))
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, transcript variant mCT116564"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT116564.1
FT                   created on 01-OCT-2002"
FT   mRNA            complement(join(1686841..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718321..1718482,
FT                   1723386..1723586,1724446..1724592,1747030..1747366,
FT                   1748166..1748299,1759121..1759318,1763304..1763451,
FT                   1770148..1770296,1773798..1773983,1784482..1784662,
FT                   1785590..1785936,1786720..1787050,1791382..1791611,
FT                   1793408..1794280,1808420..1808599,1811061..1811182,
FT                   1812169..1812337,1824393..1824557,1825335..1825517,
FT                   1827457..1827606,1830839..1831087,1834388..1834486,
FT                   1837103..1837315,1849021..1849148,1849260..1849362,
FT                   1851883..1852051,1855644..1855753,1857016..1857228,
FT                   1867170..1867307,1874446..1874615,1895750..1895940,
FT                   1907681..1908315))
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, transcript variant mCT173363"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT173363.0
FT                   created on 01-OCT-2002"
FT   mRNA            complement(join(1686841..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718330..1718482,
FT                   1723386..1723586,1724455..1724595,1747078..1747366,
FT                   1748166..1748299,1759121..1759306,1763298..1763451,
FT                   1770148..1770311,1773798..1773958,1784478..1784662,
FT                   1785590..1785936,1786720..1787050,1791382..1791611,
FT                   1793408..1793977,1811121..1811182,1812169..1812337,
FT                   1814907..1815089,1825332..1825510,1827435..1827593,
FT                   1830847..1831087,1834388..1834486,1837049..1837315,
FT                   1849021..1849148,1849260..1849362,1851883..1852051,
FT                   1855644..1855744,1874449..1874624,1895750..1895940,
FT                   1907681..1907889))
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, transcript variant mCT173364"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT173364.0
FT                   created on 01-OCT-2002"
FT   CDS             complement(join(1687603..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718321..1718482,
FT                   1723386..1723586,1724446..1724607,1727926..1728102,
FT                   1734921..1735028,1737813..1738007,1739424..1739550,
FT                   1747031..1747366,1748166..1748299,1759115..1759305,
FT                   1763297..1763451,1770148..1770311,1773798..1773983,
FT                   1784482..1784662,1785590..1785936,1786720..1787050,
FT                   1791382..1791611,1793408..1794280,1808420..1808639,
FT                   1811056..1811182,1812169..1812337,1813749..1813904,
FT                   1814898..1815095,1818633..1818857,1821068..1821199,
FT                   1824381..1824557,1825335..1825517,1827457..1827606,
FT                   1830839..1831087,1834388..1834486,1837103..1837315,
FT                   1849021..1849148,1849260..1849362,1851883..1852051,
FT                   1855644..1855753,1857016..1857228,1867170..1867307,
FT                   1874446..1874615,1895750..1895940,1907681..1908315,
FT                   1925950..1926133,1930292..1930411,1933397..1933522,
FT                   1937275..1937350,1952357..1952486))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, isoform CRA_a"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT116564.1
FT                   protein_id=mCP74592.1 isoform=CRA_a"
FT                   /protein_id="EDK99997.1"
FT                   /translation="MEDSWLEHVLQLVPEHLKVLTNSIKVLSDEIREDYLLSVKKSIVD
FT                   FVLKDPREKDDDGKITELPPHRAEMEVLPKPWRRSFLSACSYIRDHLNAMNPMMLAVLD
FT                   LWHSTFKKLRLVDIEEFHSCQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIFNQG
FT                   NKKKQLPTGKSTAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLIAQPLYPQRKKIQDA
FT                   LNPYLHLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNAL
FT                   AMTKKVHSMVEEFKQYIPLIQVFCNPGLRPRHWEAMSTIVGYPLQPSDDSTVFSFIDMN
FT                   LEPFLDRFGSISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQML
FT                   LDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSRD
FT                   IMSQMPEEGRRFTAVDKTWRDVMKTVVQVVVTIERMLERLKKSNELLELILKGLNEYLE
FT                   KKRLFFPRFFFLSNDELLEILSETKDPIRDAIVAYTKTSRISWVRDWPGQTVLCVSQTF
FT                   WTVEVQIAIPEGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDV
FT                   LASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTD
FT                   RCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFF
FT                   KGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAV
FT                   FITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATY
FT                   RLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPNENEEILLLRSIIDVNLPKFLSHD
FT                   LPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHSMNLQMTDFFSEKILQIYEMMIVRH
FT                   GFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLV
FT                   SHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEII
FT                   QMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWINTLPQSVSIIQKE
FT                   FIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMDDFADENKQKERNDR
FT                   ESFSLLEGIFLFSLIWSVGATCTDDDRLKFDKILRELLEGPISNLTRNKFKLLSGTEQT
FT                   SSKVFIVPFPEKGTIYDYQFIPEGLGRWDKWIKDLADTPPIPKDVQFNEIIVPTLDTIR
FT                   YSALMNLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQ
FT                   NIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDL
FT                   KDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSNKSMFTIFSRILAWH
FT                   LRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLS
FT                   RPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLINYIQEILKNYMQEDFHDLFKNL
FT                   DFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPM
FT                   NLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKG
FT                   YGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDE
FT                   KQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAMSPIGDAFRIRLRK
FT                   FPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKRFHTSTINLSTS
FT                   FHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQ
FT                   SELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDEC
FT                   DADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPD
FT                   PTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKI
FT                   RNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAALHEVQ
FT                   DKLAKLQDTLELNKQKKADLEHQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLY
FT                   INLTGDILISSGVVAYLGAFTSNYRQNQTKQWSQSCKERDIPCSDDYSLMGTLGEAVTI
FT                   RAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPS
FT                   YVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPDFR
FT                   FYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQG
FT                   ADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKI
FT                   DITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRL
FT                   QILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNAINKTEWRFLLTGGIGLDN
FT                   PYTNPCTWLPQKSWDEICRLDDLPAFKTIREEFMRLKDGWKKVYDSMEPHHEMFPEDWG
FT                   NKANDFQRMLIIRCLRPDKASAGFVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCC
FT                   APLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVV
FT                   LQNCHLATSWMPTLEKVCEELSAESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPK
FT                   GLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPY
FT                   EFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFF
FT                   CTELVENPQYKFDSSGIYFVPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSE
FT                   TQLLFDNILLTQSHSSGSGTKSSDEVVNEVAGDILGKLPNNFDVEAAMRRYPTTYTQSM
FT                   NTVLVQEMGRFNKLLITIRESCINIQKAVKGLVVMSTELEEVVSSILNVKIPAMWMGKS
FT                   YPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIP
FT                   IDLLGFDYEVMDDKEYKKAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMW
FT                   LKPCKKSDIPRRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSVHPKEHWIGRGVA
FT                   LLCQLNS"
FT   CDS             complement(join(1687603..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718321..1718482,
FT                   1723386..1723586,1724446..1724592,1747030..1747366,
FT                   1748166..1748299,1759121..1759318,1763304..1763451,
FT                   1770148..1770296,1773798..1773983,1784482..1784662,
FT                   1785590..1785936,1786720..1787050,1791382..1791611,
FT                   1793408..1794280,1808420..1808599,1811061..1811182,
FT                   1812169..1812337,1824393..1824557,1825335..1825517,
FT                   1827457..1827549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, isoform CRA_b"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT173363.0
FT                   protein_id=mCP96283.0 isoform=CRA_b"
FT                   /protein_id="EDK99998.1"
FT                   /translation="MGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVD
FT                   AVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPH
FT                   MLGWRPLMVSWINTLPQSVSIIQKEFIEGLFDRMVPLSVEFIRIVFVDDVNMPAREVYG
FT                   AQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVT
FT                   INEFSNKSMFTIFSRILAWHLRIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQ
FT                   GVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLINYIQEILKNYMQEDFHD
FT                   LFKNLDFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNM
FT                   SKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQV
FT                   EISKGYGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNL
FT                   FALDEKQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAMSPIGDAFR
FT                   IRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKRFHTSTI
FT                   NLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQ
FT                   VATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKA
FT                   IKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKA
FT                   DKIPDPTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDF
FT                   VPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAA
FT                   LHEVQDKLAKLQDTLELNKQKKADLEHQVDLCSKKLERAEQLIGGLGGEKTRWSNSALE
FT                   LGHLYINLTGDILISSGVVAYLGAFTSNYRQWSQSCKERDIPCSDDYSLMGTLGEAVTI
FT                   RAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPS
FT                   YVRTLENCIQFGFLPLVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPD
FT                   FRFYITTKLRNPHYLPETSVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQG
FT                   ADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKI
FT                   DITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRK
FT                   LSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELSAESTHPDF
FT                   RIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEF
FT                   KKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALR
FT                   YMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYI
FT                   DYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSHSSGSGTKSSDEVVNEV
FT                   AGDILGKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAVK
FT                   GLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPP
FT                   PVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVMDDKEYKKAPEDGVYIHGLF
FT                   LDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPRRPSYVAPLYKTSERRGTLS
FT                   TTGHSTNFVIAMILPSVHPKEHWIGRGVALLCQLNS"
FT   CDS             complement(join(1687603..1687809,1696172..1696275,
FT                   1702002..1702179,1704227..1704379,1710040..1710270,
FT                   1713724..1713861,1715662..1715847,1718330..1718482,
FT                   1723386..1723586,1724455..1724595,1747078..1747366,
FT                   1748166..1748299,1759121..1759306,1763298..1763451,
FT                   1770148..1770311,1773798..1773958,1784478..1784662,
FT                   1785590..1785936,1786720..1787050,1791382..1791611,
FT                   1793408..1793977,1811121..1811182,1812169..1812337,
FT                   1814907..1815089,1825332..1825510,1827435..1827549))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115458"
FT                   /product="mCG115458, isoform CRA_c"
FT                   /note="gene_id=mCG115458.1 transcript_id=mCT173364.0
FT                   protein_id=mCP96282.0 isoform=CRA_c"
FT                   /protein_id="EDK99999.1"
FT                   /translation="MGQLYGQFDLVSHEWSDGVLAVSFRAFAASSVRVCLLTYRKWLIF
FT                   DGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVGRWDKW
FT                   IKDLADTPPIPKDVQFNEIIVPTLDTIRYSALMNLLTTHQKPSIFVGPTGTGKSVIVFV
FT                   DDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPI
FT                   TPRYMRHFNIVTINLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHM
FT                   ADYSLFQVEISKGYGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLL
FT                   NAGEVPNLFALDEKQEICEKMRQIDRQRDKSKQTDGSPIALFNMFIDCCRNQLHVVLAM
FT                   SPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMC
FT                   KRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLD
FT                   KLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVAN
FT                   DQAMAAKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAV
FT                   CILKGIKADKIPDPTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRK
FT                   SYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAME
FT                   GLRKKQAALHEVQDKLAKLQDTLELNKQKKADLEHQVERAEQLIGGLGGEKTRWSNSAL
FT                   ELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKQWSQSCKERDIPCSDDYSLMGTL
FT                   GEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLI
FT                   KLSDPSYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIE
FT                   YSPDFRFYITTKLRNPHYLPETSVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQAL
FT                   ILQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEET
FT                   EKKIDITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFSKLSSLSLGQGQG
FT                   PIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKELSAESTHPDFRIWLTSYPSPNFPV
FT                   SVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALV
FT                   QERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDELPYDALRYMTGECNYGGRVTDDWD
FT                   RRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIDYTKTLPLIPAPEVFGM
FT                   NANADITKDQSETQLLFDNILLTQSHSSGSGTKSSDEVVNEVAGDILGKLPNNFDVEAA
FT                   MRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAVKGLVVMSTELEEVVSSIL
FT                   NVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTG
FT                   AQQNYARKFTIPIDLLGFDYEVMDDKEYKKAPEDGVYIHGLFLDGASWDRKTKKLAESH
FT                   PKVLYDTVPVMWLKPCKKSDIPRRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSV
FT                   HPKEHWIGRGVALLCQLNS"
FT   gap             1781504..1781523
FT                   /estimated_length=20
FT   gap             1802112..1802168
FT                   /estimated_length=57
FT   gap             1810773..1810904
FT                   /estimated_length=132
FT   gap             1839496..1839975
FT                   /estimated_length=480
FT   gap             1894759..1894778
FT                   /estimated_length=20
FT   gap             1936557..1936660
FT                   /estimated_length=104
FT   gene            complement(<1987560..1996314)
FT                   /locus_tag="mCG_144888"
FT                   /note="gene_id=mCG144888.0"
FT   mRNA            complement(join(<1987560..1988058,1988162..1988224,
FT                   1991548..1991610,1996208..1996314))
FT                   /locus_tag="mCG_144888"
FT                   /product="mCG144888"
FT                   /note="gene_id=mCG144888.0 transcript_id=mCT184312.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(<1987560..1987870)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144888"
FT                   /product="mCG144888"
FT                   /note="gene_id=mCG144888.0 transcript_id=mCT184312.0
FT                   protein_id=mCP106115.0"
FT                   /protein_id="EDL00001.1"
FT                   /translation="MDTSQQEYQNQPGGQEKFSAVPLSMNGRSMKMQDQGRGAKLAMQA
FT                   SLPAIESNLYSLQTSHVLPQDLPRKTPHESVSPDISRNFHFSSFQRFTGSKLKIKYQIS
FT                   "
FT   gap             2007818..2007837
FT                   /estimated_length=20
FT   gap             2018049..2018068
FT                   /estimated_length=20
FT   gap             2022857..2023079
FT                   /estimated_length=223
FT   gap             2032850..2032869
FT                   /estimated_length=20
FT   gene            complement(2046195..2075887)
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /note="gene_id=mCG113058.1"
FT   mRNA            complement(join(2046195..2048456,2051668..2051847,
FT                   2053275..2053323,2054718..2054844,2056607..2056751,
FT                   2062296..2062508,2067203..2067365,2075684..2075887))
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /product="serine/threonine kinase 17b (apoptosis-inducing),
FT                   transcript variant mCT114134"
FT                   /note="gene_id=mCG113058.1 transcript_id=mCT114134.1
FT                   created on 19-JUL-2002"
FT   mRNA            complement(join(2046792..2048456,2051668..2051847,
FT                   2053275..2053323,2054718..2054844,2056607..2056751,
FT                   2062296..2062508,2067203..2067365,2075760..>2075856))
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /product="serine/threonine kinase 17b (apoptosis-inducing),
FT                   transcript variant mCT189288"
FT                   /note="gene_id=mCG113058.1 transcript_id=mCT189288.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(2048174..2048456,2051668..2051847,
FT                   2053275..2053323,2054718..2054844,2056607..2056751,
FT                   2062296..2062508,2067203..2067365,2075760..>2075856))
FT                   /codon_start=1
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /product="serine/threonine kinase 17b (apoptosis-inducing),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG113058.1 transcript_id=mCT189288.0
FT                   protein_id=mCP110236.0 isoform=CRA_b"
FT                   /protein_id="EDL00003.1"
FT                   /translation="VRSVGQRLCGRRRESPHRGLADGDQPLWGRVRGKSLPREAGLAVI
FT                   NMSRRRFDCRSVSGLLTTTPQTPIKTENFNNFYTLTPKELGRGKFAVVRQCISKSTGQE
FT                   YAAKSLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYENATEIILVLEYAAGGE
FT                   IFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQNILLSSIYPLGDIK
FT                   IVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPF
FT                   VGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKRPTAESCLSHSWLQ
FT                   QWDFGSLFHPEETSGSSQIQDLTLRSSEEKTSKSSCNGSCGAREDKENIPEDGSLVSKR
FT                   FRFDDSLPSPHELVPDLFC"
FT   CDS             complement(join(2048174..2048456,2051668..2051847,
FT                   2053275..2053323,2054718..2054844,2056607..2056751,
FT                   2062296..2062508,2067203..2067324))
FT                   /codon_start=1
FT                   /gene="Stk17b"
FT                   /locus_tag="mCG_113058"
FT                   /product="serine/threonine kinase 17b (apoptosis-inducing),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG113058.1 transcript_id=mCT114134.1
FT                   protein_id=mCP74707.1 isoform=CRA_a"
FT                   /protein_id="EDL00002.1"
FT                   /translation="MSRRRFDCRSVSGLLTTTPQTPIKTENFNNFYTLTPKELGRGKFA
FT                   VVRQCISKSTGQEYAAKSLKKRRRGQDCRAEILHEIAVLELARSCPHVINLHEVYENAT
FT                   EIILVLEYAAGGEIFNLCLPELAEMVSENDVIRLIKQILEGVHYLHQNNIVHLDLKPQN
FT                   ILLSSIYPLGDIKIVDFGMSRKIGNASELREIMGTPEYLAPEILNYDPITTATDMWNIG
FT                   IIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEEMFSSVSQLATDFIQSLLVKNPEKR
FT                   PTAESCLSHSWLQQWDFGSLFHPEETSGSSQIQDLTLRSSEEKTSKSSCNGSCGAREDK
FT                   ENIPEDGSLVSKRFRFDDSLPSPHELVPDLFC"
FT   gap             2076056..2076075
FT                   /estimated_length=20
FT   gap             2076534..2076618
FT                   /estimated_length=85
FT   gap             2094104..2094123
FT                   /estimated_length=20
FT   gene            complement(2101471..2331159)
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /note="gene_id=mCG113057.2"
FT   mRNA            complement(join(2101471..2104068,2118193..2118305,
FT                   2119202..2119287,2121959..2122073,2122827..2122973,
FT                   2123939..2124068,2130329..2130427,2132031..2132183,
FT                   2142892..2143005,2144576..2144696,2156448..2156557,
FT                   2160243..2160326,2176739..2176835,2178993..2179095,
FT                   2182536..2182670,2195678..2195863,2204670..2204794,
FT                   2205196..2205299,2205911..2206061,2215278..2215373,
FT                   2216689..2218062,2218444..2218544,2222349..2222488,
FT                   2224498..2224667,2228437..2228512,2234085..2234179,
FT                   2242156..2242263,2330828..2331159))
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /product="HECT, C2 and WW domain containing E3 ubiquitin
FT                   protein ligase 2, transcript variant mCT114133"
FT                   /note="gene_id=mCG113057.2 transcript_id=mCT114133.2
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(2103957..2104068,2118193..2118305,
FT                   2119202..2119287,2121959..2122073,2122827..2122973,
FT                   2123939..2124068,2130329..2130427,2132031..2132183,
FT                   2142892..2143005,2144576..2144696,2156448..2156557,
FT                   2160243..2160326,2176739..2176835,2178993..2179095,
FT                   2182536..2182670,2195678..2195863,2204670..2204794,
FT                   2205196..2205299,2205911..2206061,2215278..2215373,
FT                   2216689..2218062,2218444..2218544,2222349..2222488,
FT                   2224498..2224667,2228437..2228512,2234085..2234179,
FT                   2242156..2242263,2330828..2331119))
FT                   /codon_start=1
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /product="HECT, C2 and WW domain containing E3 ubiquitin
FT                   protein ligase 2, isoform CRA_a"
FT                   /note="gene_id=mCG113057.2 transcript_id=mCT114133.2
FT                   protein_id=mCP74530.2 isoform=CRA_a"
FT                   /protein_id="EDL00004.1"
FT                   /translation="MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQNSMPENMALQR
FT                   ANSDTDLVTSESRSSLTASMYEYTLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPAN
FT                   FWDSKNRGVTGTQKGQIVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPA
FT                   VMMGAEGMEGGASGSLHSRKLVSFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFP
FT                   TCAHHGQERRSTIISNTTNPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKL
FT                   TIPVQRLLERQAGDQMLSYNLGRRLPADHVSGYLQFKVEVTSSAHEDASPEAVGTILGV
FT                   HTVNGDLGSPSDEEDMPGSHHDSTICANGPVSEDSVADGTPKHSFRTSSTLEIDTEDLI
FT                   STSSRNSPPRGRQDSLNDYLDAIEHNGPARPGAASSSERSMGASPKLRSSFPTDTRLNA
FT                   MLHIDSDEEDHEFQQDLGYPSSLEEEGGLIMCSRASRIDDGSLTSQTKPEDDNPVENED
FT                   ASIHETASLEERLENLPEVADGSLPSSTAPDENEANLEPQPSADQGSTELCSSQEVDQP
FT                   TSGADAGASDTSGGSRRAASETESLDQGSEPSQVSSETEPSDPARTESVSEASTRPEGE
FT                   SDPEGADSSCNESVTTQLSSVETRCSSLESARFPETPAFSSQEEEDGACAAEPTSSGPA
FT                   EGSQESVCTPSSLPAVQVPSREEEGSAAEAAALSEQGELGEVWQRRGSLEGAAAAAPAA
FT                   AATDSQPQEDGDAGDAQGACEGATAQEEGATGGSQTNGHQPLRSLPSVRQDVSRYQRVD
FT                   EALPPNWEARIDSHGRIFYVDHVNRTTTWQRPTAPPAPQVLQRSNSIQQMEQLNRRYQS
FT                   IRRTMTNERPEENTSAIDGAGEEADFHQASADFRRENVLPHSTSRSRLTLLLQSPPVKF
FT                   LISPEFFTVLHSNPSAYRMFTNNTCLKHMITKVRRDTHHFERYQHNRDLVGFLNMFANK
FT                   QLELPRGWEMKHDHQGKAFFVDHNSRTTTFIDPRLPLQSSRPTSALVHRQHLTRQRSHS
FT                   AGEVGEDSRHAGPPVLPRPSSTFNTVSRPQYQDMVPVAYNDKIVAFLRQPNILEILQER
FT                   QPDLARNHSLREKIQFIRTEGTPGLVRLSSDADLVMLLSLFEEEIMSYVPPHALLHPSY
FT                   CQSPRGSPVSSPQNSPGTQRANARAPAPYKRDFEAKLRNFYRKLETKGYGQGPGKLKLI
FT                   IRRDHLLEDAFNQIMGYSRKDLQRNKLYVTFVGEEGLDYSGPSREFFFLVSRELFNPYY
FT                   GLFEYSANDTYTVQISPMSAFVDNHHEWFRFSGRILGLALIHQYLLDAFFTRPFYKALL
FT                   RILCDLSDLEYLDEEFHQSLQWMKDNDIHDILDLTFTVNEEVFGQITERELKPGGANIP
FT                   VTEKNKKEYIERMVKWRIERGVVQQTESLVRGFYEVVDARLVSVFDARELELVIAGTAE
FT                   IDLNDWRNNTEYRGGYHDNHIVIRWFWAAVERFNNEQRLRLLQFVTGTSSIPYEGFASL
FT                   RGSNGPRRFCVEKWGKITALPRAHTCFNRLDLPPYPSFSMLYEKLLTAVEETSTFGLE"
FT   gap             2109715..2109734
FT                   /estimated_length=20
FT   gap             2143606..2143688
FT                   /estimated_length=83
FT   gap             2184772..2184791
FT                   /estimated_length=20
FT   gap             2207739..2207826
FT                   /estimated_length=88
FT   mRNA            complement(join(2222196..2222488,2224498..2224667,
FT                   2228437..2228512,2234085..2234179,2242156..2242263,
FT                   2330828..2331159))
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /product="HECT, C2 and WW domain containing E3 ubiquitin
FT                   protein ligase 2, transcript variant mCT194448"
FT                   /note="gene_id=mCG113057.2 transcript_id=mCT194448.0
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(2222345..2222488,2224498..2224667,
FT                   2228437..2228512,2234085..2234179,2242156..2242263,
FT                   2330828..2331119))
FT                   /codon_start=1
FT                   /gene="Hecw2"
FT                   /locus_tag="mCG_113057"
FT                   /product="HECT, C2 and WW domain containing E3 ubiquitin
FT                   protein ligase 2, isoform CRA_b"
FT                   /note="gene_id=mCG113057.2 transcript_id=mCT194448.0
FT                   protein_id=mCP115477.0 isoform=CRA_b"
FT                   /db_xref="GOA:A3KPB7"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="MGI:MGI:2685817"
FT                   /db_xref="UniProtKB/TrEMBL:A3KPB7"
FT                   /protein_id="EDL00005.1"
FT                   /translation="MASSAREHLLFVRRRNPQMRYTLSPENLQSLAAQNSMPENMALQR
FT                   ANSDTDLVTSESRSSLTASMYEYTLGQAQNLIIFWDIKEEVDPSDWIGLYHIDENSPAN
FT                   FWDSKNRGVTGTQKGQIVWRIEPGPYFMEPEIKICFKYYHGISGALRATTPCITVKNPA
FT                   VMMGAEGMEGGASGSLHSRKLVSFTLSDLRAVGLKKGMFFNPDPYLKMSIQPGKKSSFP
FT                   TCAHHGQERRSTIISNTTNPIWHREKYSFFALLTDVLEIEIKDKFAKSRPIIKRFLGKL
FT                   TIPVQRLLERQAG"
FT   gap             2240708..2240877
FT                   /estimated_length=170
FT   gap             2248917..2249478
FT                   /estimated_length=562
FT   gap             2250442..2252246
FT                   /estimated_length=1805
FT   gap             2254187..2254448
FT                   /estimated_length=262
FT   gap             2265337..2265356
FT                   /estimated_length=20
FT   gap             2274677..2274696
FT                   /estimated_length=20
FT   gap             2280647..2280666
FT                   /estimated_length=20
FT   gap             2309988..2310007
FT                   /estimated_length=20
FT   gap             2320109..2322998
FT                   /estimated_length=2890
FT   gap             2342025..2342044
FT                   /estimated_length=20
FT   gap             2358269..2358402
FT                   /estimated_length=134
FT   gap             2445399..2445510
FT                   /estimated_length=112
FT   gap             2471148..2471234
FT                   /estimated_length=87
FT   gap             2485220..2488221
FT                   /estimated_length=3002
FT   gap             2490666..2490685
FT                   /estimated_length=20
FT   gap             2491701..2491807
FT                   /estimated_length=107
FT   gap             2506513..2506532
FT                   /estimated_length=20
FT   gap             2512786..2513056
FT                   /estimated_length=271
FT   gap             2533215..2533234
FT                   /estimated_length=20
FT   gap             2534535..2534554
FT                   /estimated_length=20
FT   gap             2536384..2536403
FT                   /estimated_length=20
FT   gap             2538095..2538114
FT                   /estimated_length=20
FT   gap             2539260..2539279
FT                   /estimated_length=20
FT   gap             2542299..2545324
FT                   /estimated_length=3026
FT   gene            2545874..2567560
FT                   /locus_tag="mCG_113060"
FT                   /note="gene_id=mCG113060.1"
FT   mRNA            join(2545874..2546130,2555169..2555332,2558689..2558909,
FT                   2559020..2559198,2561075..2561143,2566251..2566367,
FT                   2567308..2567560)
FT                   /locus_tag="mCG_113060"
FT                   /product="mCG113060"
FT                   /note="gene_id=mCG113060.1 transcript_id=mCT114136.1
FT                   created on 04-SEP-2002"
FT   CDS             join(2546074..2546130,2555169..2555332,2558689..2558909,
FT                   2559020..2559198,2561075..2561143,2566251..2566367,
FT                   2567308..2567472)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113060"
FT                   /product="mCG113060"
FT                   /note="gene_id=mCG113060.1 transcript_id=mCT114136.1
FT                   protein_id=mCP74729.1"
FT                   /protein_id="EDL00006.1"
FT                   /translation="METNLLPGGPSYGLLDESGVQMETTVCRPVLSPTHINGTASETFT
FT                   VLQQKMRIVEEQTSSLRDDLIMLGYGDRRGQLETPNYLEDPASQKAISPIPNEVICPES
FT                   PGNLWRNYEFLVNRMCYLENLIQSLKMNIFHLQTEKESNPQKTAFLNDQLNIIQGEHSK
FT                   GLKLLQLEVMNLRQQLKVVKEEEDRAQDEMQRLTATLEIATETKKNAAVIEEELKTTKR
FT                   KMNLKIQELRRQLAQEKLVRESLETSASSMLLKVQEMGSVVEAERQQVHALQEKCTALH
FT                   SSMKTTQDLLAQEQRKNEDLGMTISQLKSDLSMQTLLRARMV"
FT   gap             2578115..2578134
FT                   /estimated_length=20
FT   gap             2605221..2605240
FT                   /estimated_length=20
FT   gene            2618529..2657147
FT                   /locus_tag="mCG_113056"
FT                   /note="gene_id=mCG113056.1"
FT   mRNA            join(2618529..2619004,2641437..2641565,2643060..2643229,
FT                   2644128..2644221,2645105..2645274,2649424..2649550,
FT                   2652850..2653044,2653327..2653395,2653480..2653641,
FT                   2654570..2654656,2656325..2656444,2656712..2657147)
FT                   /locus_tag="mCG_113056"
FT                   /product="mCG113056"
FT                   /note="gene_id=mCG113056.1 transcript_id=mCT114132.1
FT                   created on 23-SEP-2002"
FT   CDS             join(2618678..2619004,2641437..2641565,2643060..2643229,
FT                   2644128..2644221,2645105..2645274,2649424..2649550,
FT                   2652850..2653044,2653327..2653395,2653480..2653641,
FT                   2654570..2654656,2656325..2656444,2656712..2656810)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113056"
FT                   /product="mCG113056"
FT                   /note="gene_id=mCG113056.1 transcript_id=mCT114132.1
FT                   protein_id=mCP74520.1"
FT                   /protein_id="EDL00007.1"
FT                   /translation="MPPRRRRSPERPTSSKSLEGSRFYVSNVKERAATVALPSVIPNVA
FT                   RRVSFAPTLPSMRMSQGMGDSRISLKTLLNAIKTMEGRLEGKIDILASRPFLSEESSNL
FT                   LKQDSMKSILGKNEEELAQAVKCRDAALKESQKLKGDLKALEDRESKKVGNFQKQLAEA
FT                   KEDNCKVTIMLENVLASHSKMQGALEKVQIELGRRDSEIAGLKKERSLNQQRVQKLEAE
FT                   VDQWQARMLIVEAQHGSEIEPLQKSLDITREDNRKLAMSLEQALQTNGHLQSKLDHLQE
FT                   KLESKERERQSLEAFKEQVAEESKVEAELHAERIEALRKQFQTERETAKKASQREVSEL
FT                   KKALDEANFRSVEVSRANRELRHKATELEKVVNSNKEKLKNQRAQIKLHLSAKANNAQN
FT                   MERMKQIEMELRQMEIIKDQYQKKNYEQSLSIQRFVSEMNTLQKEMELLTKSQYETSAR
FT                   NKQQELRLVAERKMRLELENRCKELEETIRHLKRCKEATENKLKEASVESEQITANLEE
FT                   AHRWFKCRFDGLQLELTKNRLQRLPREDRWLEENQDMMHNVATSQSVLHRWETKQKYHS
FT                   DTERKK"
FT   gap             2620770..2620883
FT                   /estimated_length=114
FT   gap             2674649..2674809
FT                   /estimated_length=161
FT   gene            complement(2678981..>2714112)
FT                   /locus_tag="mCG_113059"
FT                   /note="gene_id=mCG113059.1"
FT   mRNA            complement(join(2678981..2679235,2679250..2680001,
FT                   2681128..2681280,2685510..2685634,2686979..2687169,
FT                   2687836..2688073,2691093..2691228,2691931..2692032,
FT                   2692865..2693067,2694589..2694760,2695602..2695705,
FT                   2698707..2698779,2699215..2699362,2702606..2702771,
FT                   2703968..2704159,2705705..2705828,2709260..2709444,
FT                   2712985..2713096,2713966..>2714112))
FT                   /locus_tag="mCG_113059"
FT                   /product="mCG113059"
FT                   /note="gene_id=mCG113059.1 transcript_id=mCT114135.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(2679879..2680001,2681128..2681280,
FT                   2685510..2685634,2686979..2687169,2687836..2688073,
FT                   2691093..2691228,2691931..2692032,2692865..2693067,
FT                   2694589..2694760,2695602..2695705,2698707..2698779,
FT                   2699215..2699362,2702606..2702771,2703968..2704159,
FT                   2705705..2705828,2709260..2709444,2712985..2713096,
FT                   2713966..>2714112))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113059"
FT                   /product="mCG113059"
FT                   /note="gene_id=mCG113059.1 transcript_id=mCT114135.1
FT                   protein_id=mCP74711.1"
FT                   /protein_id="EDL00008.1"
FT                   /translation="CCSFPGPLRSVGPADMSGFSPELIDYLEGKISFEEFERRREERKT
FT                   REKKSVQEKGKSSPKENPDDSEVPSSSGIDSAKSQDKDANEGETSDGVSKSVHKVFASM
FT                   LGETEDDEEEEEEEEEEETAEQPTAGDVFVLEMVLNRETKKMMKEKRPRSKLPRALRGL
FT                   MGEANIRFARGEHEEAILMCMEIIRQAPLAYEPFSTLAMIYEDQGDMEKSLQFELIAAH
FT                   LNPSDTEEWVRLAEMSLEQDNIKQAIFCYTKALKYEPTNVRYLWERSSLYEQMGDHKMA
FT                   MDGYRRILNLLSPSDGERFMQLARDMAKSYYEANDSASAINIIEEAFSKHQGLVSMEDV
FT                   NIAAELYISNKQYDKALEVITDFSGIILEKETLEEGTSEENKAAETVTCSIPDSVPIDI
FT                   TVKLMVCLVHLNILEPLNPLLTTLVEQNPEDMGDLYLDVAEAFLDVGEYNSALPLLSAL
FT                   VCSERYNLAVVWLRHAECLKALGYMERAAESYSKVVDLAPLHLDARISLSILQQQLGRP
FT                   EKALEALEPMYDPDTLAQDANAAQQELKLLLHRSTLLFSQGKMYGYLDTLLTMLAMLLK
FT                   VAMNRAQVCLISSSKSGERHLYLIKVSRDKISDNNEQETSNYDAKAIFAVLTSVLPKED
FT                   WWNLLLKAIYTLSDLARFQEAELLVDSSLEYYSFYDDRQKRKELEYFGLSAAILDKNFR
FT                   KAYDYIRVMVMENVNKPQLWNIFNQVTMHSQDVRHHRFCLRLMLKNPDNHALCVLNGHN
FT                   AFVSGSFKHALGQYVQAFRAYPSEPLYNLCIGLTFIHMASQKYVLKRHALTVQGFSFLN
FT                   RYLSIRGPCQESFYNLGRGLHQLGLTHLAIHYYQKALALPPLVVEGIEVDQLDLRRDIA
FT                   YNMSLIYQSSGNTAMAQKLLYTYCVI"
FT   gap             2710143..2710162
FT                   /estimated_length=20
FT   gene            complement(2755700..2768608)
FT                   /locus_tag="mCG_113062"
FT                   /note="gene_id=mCG113062.1"
FT   mRNA            complement(join(2755700..2755788,2755855..2755972,
FT                   2757008..2757053,2761626..2761813,2765378..2765428,
FT                   2767231..2767366,2768411..2768608))
FT                   /locus_tag="mCG_113062"
FT                   /product="mCG113062"
FT                   /note="gene_id=mCG113062.1 transcript_id=mCT114140.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(2755862..2755972,2757008..2757053,
FT                   2761626..2761813,2765378..2765428,2767231..2767366,
FT                   2768411..2768532))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113062"
FT                   /product="mCG113062"
FT                   /note="gene_id=mCG113062.1 transcript_id=mCT114140.1
FT                   protein_id=mCP74762.1"
FT                   /protein_id="EDL00009.1"
FT                   /translation="MCFPLVSLILFLFGTCTAYWSGLLSSTSVQLLSSLWLALKRPAEL
FT                   PKDIKVMSPDLPVLTVVFLIVSWTTCGALAILLSYLYYVFKVVHLQASLTTFKNNQPVN
FT                   PKHSRRSEKKSNHHKDSAVQSLRLCANDAEDSLRMHSTVINLLTWVVLLSMPSLIYWLK
FT                   NLSYSDSRKHSHCFSKVQPLPLAVGVIAFGSSHLYRVPCFVIIPLVFHALCNFM"
FT   gap             2765909..2766131
FT                   /estimated_length=223
FT   gene            complement(<2785231..2832807)
FT                   /locus_tag="mCG_113061"
FT                   /note="gene_id=mCG113061.1"
FT   mRNA            complement(join(<2785231..2785272,2786600..2786708,
FT                   2787107..2787173,2787803..2787854,2787978..2788051,
FT                   2790022..2790097,2796477..2796554,2799501..2799552,
FT                   2800553..2800599,2803697..2803780,2805302..2805357,
FT                   2806039..2806144,2807207..2807273,2808604..2808656,
FT                   2811140..2811297,2818223..2818394,2823123..2823298,
FT                   2826161..2826314,2832620..2832807))
FT                   /locus_tag="mCG_113061"
FT                   /product="mCG113061"
FT                   /note="gene_id=mCG113061.1 transcript_id=mCT114137.1
FT                   created on 23-SEP-2002"
FT   CDS             complement(join(<2785231..2785272,2786600..2786708,
FT                   2787107..2787173,2787803..2787854,2787978..2788051,
FT                   2790022..2790097,2796477..2796554,2799501..2799552,
FT                   2800553..2800599,2803697..2803780,2805302..2805357,
FT                   2806039..2806144,2807207..2807273,2808604..2808656,
FT                   2811140..2811297,2818223..2818394,2823123..2823298,
FT                   2826161..2826314,2832620..2832766))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113061"
FT                   /product="mCG113061"
FT                   /note="gene_id=mCG113061.1 transcript_id=mCT114137.1
FT                   protein_id=mCP74739.1"
FT                   /protein_id="EDL00010.1"
FT                   /translation="MFLHSVNLWNLAFYVFMVFLATLGLWDVFFGFEENKCSMSYMFEY
FT                   PEYQKIELPKKLTKRYPAYELYLYGEGSYAEEHKILPLTGIPVLFLPGNAGSYKQVRSI
FT                   GSIALRKAEDIDFKYHFDFFSVNFNEELVALYGGSLQKQTKFVHECIKAILKLYKGQEF
FT                   APTSVAIIGHSMGGLVARALLTLKNFKQDLINLLVTQATPHVAPVMPLDRFITEFYMNV
FT                   NNYWILNARHINLTTLSVAGGFRDYQVRSGLTFLPKLSHYTSALSVVSSAVPKTWVSTD
FT                   HLSIVWCKQLQLTTIRAFFDLIDADTKQITQKPKKKLSVLNHHFIRHPAKQFEENPSII
FT                   SDLTGTSMWVPVKVSRWSYVAYNESDKIYFAFPLANHRKIYTHAYCQSTMLDTNSWIFG
FT                   CINSTSMCRQGVDLSWKAELLPTIKSLTLRLQDYPSLSHIVVYVPSVHGSKFVVDCEFF
FT                   KKEARSMQLPVTHLFSFGLSSRKVTLNTNGLYYNIELLNFGQIYQAFKVNVVSKCTGSK
FT                   EEITSIYKLHIPWSYEDSLTIAQVPSSTDISLKLHVAQPENDSHVALLKMYTSSDCQYE
FT                   VTIKTSFPQILGQV"
FT   gap             2788710..2788729
FT                   /estimated_length=20
FT   gene            2881619..2884714
FT                   /locus_tag="mCG_1035622"
FT                   /note="gene_id=mCG1035622.1"
FT   mRNA            join(2881619..2882318,2884023..2884714)
FT                   /locus_tag="mCG_1035622"
FT                   /product="mCG1035622"
FT                   /note="gene_id=mCG1035622.1 transcript_id=mCT153326.1
FT                   created on 30-OCT-2002"
FT   CDS             join(2882090..2882318,2884023..2884192)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035622"
FT                   /product="mCG1035622"
FT                   /note="gene_id=mCG1035622.1 transcript_id=mCT153326.1
FT                   protein_id=mCP74463.1"
FT                   /protein_id="EDL00011.1"
FT                   /translation="MQVYNKKEQSEEYNLKIKRNAPGNLMFEPWPVLKERKRLRKGLPW
FT                   NGVQEGNLRARPHPGKRKGLRNFQPLKSNNNDEKQLCPYDLCSPECVRRGGSIATTESK
FT                   SGSYRKHTQGEALRRRLGVGPWQTSHLI"
FT   gap             2905850..2905958
FT                   /estimated_length=109
FT   gap             2911853..2911872
FT                   /estimated_length=20
FT   gene            complement(2922602..3201965)
FT                   /locus_tag="mCG_117548"
FT                   /note="gene_id=mCG117548.1"
FT   mRNA            complement(join(2922602..2923826,2924819..2924991,
FT                   2927060..2927151,2929134..2929216,2930471..2930553,
FT                   2931052..2931197,2933007..2933090,2934310..2934397,
FT                   2936392..2936608,2938045..2938162,2939290..2939377,
FT                   2942764..2942965,2956512..2956583,2998499..2998610,
FT                   3002975..3003055,3005219..3005359,3008413..3008481,
FT                   3010481..3010598,3011715..3011797,3018799..3018913,
FT                   3028371..3028449,3037798..3038010,3039182..3039324,
FT                   3041887..3041974,3042321..3042521,3053824..3053894,
FT                   3067958..3068036,3103674..3103757,3201717..3201965))
FT                   /locus_tag="mCG_117548"
FT                   /product="mCG117548"
FT                   /note="gene_id=mCG117548.1 transcript_id=mCT118695.1
FT                   created on 25-MAR-2003"
FT   CDS             complement(join(2923668..2923826,2924819..2924991,
FT                   2927060..2927151,2929134..2929216,2930471..2930553,
FT                   2931052..2931197,2933007..2933090,2934310..2934397,
FT                   2936392..2936608,2938045..2938162,2939290..2939377,
FT                   2942764..2942965,2956512..2956583,2998499..2998610,
FT                   3002975..3003055,3005219..3005359,3008413..3008481,
FT                   3010481..3010598,3011715..3011797,3018799..3018913,
FT                   3028371..3028449,3037798..3038010,3039182..3039324,
FT                   3041887..3041974,3042321..3042521,3053824..3053894,
FT                   3067958..3068036,3103674..3103757,3201717..3201743))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117548"
FT                   /product="mCG117548"
FT                   /note="gene_id=mCG117548.1 transcript_id=mCT118695.1
FT                   protein_id=mCP74677.1"
FT                   /protein_id="EDL00012.1"
FT                   /translation="MAVLKLCEQPPLVQAIFSGDPEEIRMLIHKTEDVNALDSEKRTPL
FT                   HVAAFLGDAEIIELLILSGARVNAKDNMWLTPLHRAVASRSEEAVQVLIKHSADVNARD
FT                   KNWQTPLHVAAANKAVKCAEVIIPLLSSVNVSDRGGRTALHHAALNGHMEMVNLLLAKG
FT                   ANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGYTPLHAAASNGQISVV
FT                   KHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSGFTPLHFAAA
FT                   STHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDKDGN
FT                   TPLHVAARHGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSGQKYS
FT                   IVSLFSNEHVLSAGFEIDTPDTFGRTCLHAAAAGGNVECIKLLQSSGADFHKKDKCGRT
FT                   PLHYAAANCHFHCIKALVTTGANVNETDDWGRTALHYAAASDMDRNKMILGNAHDNSEE
FT                   LERAREVKEKDAALCLEFLLQNDANPSIRDKEGYNSIHYAAAYGHRQCLELLLERTNTG
FT                   FEESDGGALKSPLHLAAYNGHHQALEVLLQSLVDLDIRDEKGRTALYLAAFKGHTECVE
FT                   ALVNQGASIFVKDNVTKRTPLHASVINGHTLCLRLLLETADNPEVVDVKDAKGQTPLML
FT                   AVAYGHIDAVSLLLEKEANVDAVDIVGCTALHRGIMTGHEECVQMLLEQEASILCKDSR
FT                   GRTPLHYAAARGHATWLNELLQIALSEEDCCLKDNQGYTPLHWACYNGNENCIEVLLEQ
FT                   KCFRKFIGNPFTPLHCAIINGHESCASLLLGAIDPSIVSCRDDKGRTTLHAAAFGDHAE
FT                   CLQLLLRHDAQVNAVDNSGKTALMMAAENGQAGAVDILVNSAQADLTVKDKDLNTPLHL
FT                   AISKGHEKCALLILDKIQDESLINAKNSALQTPLHIAARNGLKVVVEELLAKGACVLAV
FT                   DENGHTPALACAPNKDVADCLALILATMMTFSPSSTMTAVNFVCFRKDNLSRMTHSNLG
FT                   SRQEAEMVGVEVQANCQLFGNEISIVNTVSAPSAKASRSNGPRSPPGTAVRKEE"
FT   gene            2957119..3012301
FT                   /locus_tag="mCG_117554"
FT                   /note="gene_id=mCG117554.1"
FT   mRNA            join(2957119..2957314,2992449..2992544,2992996..2993135,
FT                   3004971..3005054,3012183..3012301)
FT                   /locus_tag="mCG_117554"
FT                   /product="mCG117554"
FT                   /note="gene_id=mCG117554.1 transcript_id=mCT118701.1
FT                   created on 04-SEP-2002"
FT   gap             2985299..2985560
FT                   /estimated_length=262
FT   CDS             join(2993052..2993135,3004971..3005054,3012183..3012221)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117554"
FT                   /product="mCG117554"
FT                   /note="gene_id=mCG117554.1 transcript_id=mCT118701.1
FT                   protein_id=mCP74697.1"
FT                   /protein_id="EDL00013.1"
FT                   /translation="METVHATHHLDREKASPENYALCAAGLKISKELESLGLAALLGIE
FT                   PKSREEGDYAMVVSLRYYAYCQS"
FT   gap             3055444..3055883
FT                   /estimated_length=440
FT   gap             3058748..3059242
FT                   /estimated_length=495
FT   gap             3063223..3063335
FT                   /estimated_length=113
FT   gap             3077202..3077221
FT                   /estimated_length=20
FT   gap             3083804..3083823
FT                   /estimated_length=20
FT   gap             3108266..3108285
FT                   /estimated_length=20
FT   gap             3142122..3142302
FT                   /estimated_length=181
FT   gap             3167582..3170106
FT                   /estimated_length=2525
FT   gap             3203489..3203557
FT                   /estimated_length=69
FT   gap             3207195..3207327
FT                   /estimated_length=133
FT   gap             3223465..3223818
FT                   /estimated_length=354
FT   gap             3233437..3237621
FT                   /estimated_length=4185
FT   gap             3240977..3240996
FT                   /estimated_length=20
FT   gene            complement(3255293..3297929)
FT                   /gene="Sf3b1"
FT                   /locus_tag="mCG_117542"
FT                   /note="gene_id=mCG117542.1"
FT   mRNA            complement(join(3255293..3257613,3258060..3258276,
FT                   3260424..3260696,3264451..3264582,3265487..3265607,
FT                   3266938..3267049,3267133..3267315,3268160..3268381,
FT                   3269749..3269874,3270137..3270283,3270364..3270509,
FT                   3270766..3271036,3271134..3271220,3271505..3271684,
FT                   3273226..3273327,3273415..3273612,3275924..3276045,
FT                   3276293..3276505,3277602..3277839,3282210..3282380,
FT                   3284591..3284670,3286484..3286598,3286887..3286991,
FT                   3289339..3289505,3297789..3297929))
FT                   /gene="Sf3b1"
FT                   /locus_tag="mCG_117542"
FT                   /product="splicing factor 3b, subunit 1"
FT                   /note="gene_id=mCG117542.1 transcript_id=mCT118683.1
FT                   created on 11-JUL-2002"
FT   CDS             complement(join(3257455..3257613,3258060..3258276,
FT                   3260424..3260696,3264451..3264582,3265487..3265607,
FT                   3266938..3267049,3267133..3267315,3268160..3268381,
FT                   3269749..3269874,3270137..3270283,3270364..3270509,
FT                   3270766..3271036,3271134..3271220,3271505..3271684,
FT                   3273226..3273327,3273415..3273612,3275924..3276045,
FT                   3276293..3276505,3277602..3277839,3282210..3282380,
FT                   3284591..3284670,3286484..3286598,3286887..3286991,
FT                   3289339..3289505,3297789..3297816))
FT                   /codon_start=1
FT                   /gene="Sf3b1"
FT                   /locus_tag="mCG_117542"
FT                   /product="splicing factor 3b, subunit 1"
FT                   /note="gene_id=mCG117542.1 transcript_id=mCT118683.1
FT                   protein_id=mCP74451.1"
FT                   /db_xref="GOA:G5E866"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015016"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="MGI:MGI:1932339"
FT                   /db_xref="UniProtKB/TrEMBL:G5E866"
FT                   /protein_id="EDL00014.1"
FT                   /translation="MAKIAKTHEDIEAQIREIQGKKAALDEAQGVGLDSTGYYDQEIYG
FT                   GSDSRFAGYVTSIAATELEDDDDDYSSSTSLLGQKKPGYHAPVALLNDIPQSTEQYDPF
FT                   AEHRPPKIADREDEYKKHRRTMIISPERLDPFADGGKTPDPKMNARTYMDVMREQHLTK
FT                   EEREIRQQLAEKAKAGELKVVNGAAASQPPSKRKRRWDQTADQTPGATPKKLSSWDQAE
FT                   TPGHTPSLRWDETPGRAKGSETPGATPGSKIWDPTPSHTPAGAATPGRGDTPGHATPGH
FT                   GGATSSARKNRWDETPKTERDTPGHGSGWAETPRTDRGGDSIGETPTPGASKRKSRWDE
FT                   TPASQMGGSTPVLTPGKTPIGTPAMNMATPTPGHIMSMTPEQLQAWRWEREIDERNRPL
FT                   SDEELDAMFPEGYKVLPPPAGYVPIRTPARKLTATPTPLGGMTGFHMQTEDRTMKSVND
FT                   QPSGNLPFLKPDDIQYFDKLLVDVDESTLSPEEQKERKIMKLLLKIKNGTPPMRKAALR
FT                   QITDKAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILV
FT                   VIEPLLIDEDYYARVEGREIISNLAKAAGLATMISTMRPDIDNMDEYVRNTTARAFAVV
FT                   ASALGIPSLLPFLKAVCKSKKSWQARHTGIKIVQQIAILMGCAILPHLRSLVEIIEHGL
FT                   VDEQQKVRTISALAIAALAEAATPYGIESFDSVLKPLWKGIRQHRGKGLAAFLKAIGYL
FT                   IPLMDAEYANYYTREVMLILIREFQSPDEEMKKIVLKVVKQCCGTDGVEANYIKTEILP
FT                   PFFKHFWQHRMALDRRNYRQLVDTTVELANKVGAAEIISRIVDDLKDEAEQYRKMVMET
FT                   IEKIMGNLGAADIDHKLEEQLIDGILYAFQEQTTEDSVMLNGFGTVVNALGKRVKPYLP
FT                   QICGTVLWRLNNKSAKVRQQAADLISRTAVVMKTCQEEKLMGHLGVVLYEYLGEEYPEV
FT                   LGSILGALKAIVNVIGMHKMTPPIKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAE
FT                   YVSAREWMRICFELLELLKAHKKAIRRATVNTFGYIAKAIGPHDVLATLLNNLKVQERQ
FT                   NRVCTTVAIAIVAETCSPFTVLPALMNEYRVPELNVQNGVLKSLSFLFEYIGEMGKDYI
FT                   YAVTPLLEDALMDRDLVHRQTASAVVQHMSLGVYGFGCEDSLNHLLNYVWPNVFETSPH
FT                   VIQAVMGALEGLRVAIGPCRMLQYCLQGLFHPARKVRDVYWKIYNSIYIGSQDALIAHY
FT                   PRIYNDDKNTYIRYELDYIL"
FT   gap             3287424..3287443
FT                   /estimated_length=20
FT   gap             3291362..3291778
FT                   /estimated_length=417
FT   gap             3295008..3295582
FT                   /estimated_length=575
FT   gene            3323218..3343147
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /note="gene_id=mCG117544.1"
FT   mRNA            join(3323218..3323440,3331722..3331871,3334628..3334820,
FT                   3337944..3338045,3342083..3343147)
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /product="RIKEN cDNA 1500041J02, transcript variant
FT                   mCT118687"
FT                   /note="gene_id=mCG117544.1 transcript_id=mCT118687.1
FT                   created on 04-SEP-2002"
FT   mRNA            join(3323219..3323440,3334628..3334820,3337944..3338045,
FT                   3342083..3342400)
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /product="RIKEN cDNA 1500041J02, transcript variant
FT                   mCT172704"
FT                   /note="gene_id=mCG117544.1 transcript_id=mCT172704.0
FT                   created on 04-SEP-2002"
FT   CDS             join(3323325..3323440,3331722..3331871,3334628..3334820,
FT                   3337944..3338045,3342083..3342250)
FT                   /codon_start=1
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /product="RIKEN cDNA 1500041J02, isoform CRA_a"
FT                   /note="gene_id=mCG117544.1 transcript_id=mCT118687.1
FT                   protein_id=mCP74641.1 isoform=CRA_a"
FT                   /protein_id="EDL00015.1"
FT                   /translation="MIMAARTSQRALARVASGCHPKSTTVTEAPARGSARDVRHLAACG
FT                   VLINRTLPPCAAVLPKEICARTFFRISAPLVNKRKEYSERRILGYSMQEMYDVVSGMED
FT                   YQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKASCTDGKLFN
FT                   HLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMVAAFERRACK
FT                   LYGPETNIPRELMLHEIHHT"
FT   CDS             join(3323325..3323440,3334628..3334820,3337944..3338045,
FT                   3342083..3342250)
FT                   /codon_start=1
FT                   /gene="1500041J02Rik"
FT                   /locus_tag="mCG_117544"
FT                   /product="RIKEN cDNA 1500041J02, isoform CRA_b"
FT                   /note="gene_id=mCG117544.1 transcript_id=mCT172704.0
FT                   protein_id=mCP95623.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E8J7"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="MGI:MGI:1915126"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8J7"
FT                   /protein_id="EDL00016.1"
FT                   /translation="MIMAARTSQRALARVASGCHPKSTTVTEAPARGSARDVRYSMQEM
FT                   YDVVSGMEDYQHFVPWCKKSDIISRRSGYCKTRLEVGFPPVLERYTSIVTLVKPHLVKA
FT                   SCTDGKLFNHLETIWRFSPGLPGYPRTCTLDFSISFEFRSLLHSQLATLFFDEVVKQMV
FT                   AAFERRACKLYGPETNIPRELMLHEIHHT"
FT   gene            complement(3348277..3358559)
FT                   /locus_tag="mCG_117550"
FT                   /note="gene_id=mCG117550.1"
FT   mRNA            complement(join(3348277..3348887,3348976..3349154,
FT                   3349503..3349677,3350549..3350794,3351520..3351619,
FT                   3352107..3352275,3352505..3352598,3353514..3353609,
FT                   3354172..3354254,3354980..3355232,3357213..3357388,
FT                   3358436..3358559))
FT                   /locus_tag="mCG_117550"
FT                   /product="mCG117550, transcript variant mCT172709"
FT                   /note="gene_id=mCG117550.1 transcript_id=mCT172709.0
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(3348277..3348887,3348976..3349154,
FT                   3349503..3349677,3350549..3350794,3351520..3351619,
FT                   3352107..3352275,3352505..3352598,3353514..3353609,
FT                   3354172..3354254,3354980..3355232,3357213..3357388,
FT                   3358226..3358294))
FT                   /locus_tag="mCG_117550"
FT                   /product="mCG117550, transcript variant mCT118697"
FT                   /note="gene_id=mCG117550.1 transcript_id=mCT118697.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3348735..3348887,3348976..3349154,
FT                   3349503..3349677,3350549..3350794,3351520..3351619,
FT                   3352107..3352275,3352505..3352598,3353514..3353609,
FT                   3354172..3354254,3354980..3355232,3357213..3357386))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117550"
FT                   /product="mCG117550, isoform CRA_a"
FT                   /note="gene_id=mCG117550.1 transcript_id=mCT172709.0
FT                   protein_id=mCP95628.0 isoform=CRA_a"
FT                   /protein_id="EDL00017.1"
FT                   /translation="MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVD
FT                   LLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANN
FT                   TNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVT
FT                   TPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRG
FT                   YISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGE
FT                   ALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAH
FT                   DLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEKLNERLAKLSD
FT                   GVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPAN
FT                   EDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQSSSEVGYDAMLGDFVNMVEKG
FT                   IIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEKDPGMGAMGGMGGGMGGGMF"
FT   CDS             complement(join(3348735..3348887,3348976..3349154,
FT                   3349503..3349677,3350549..3350794,3351520..3351619,
FT                   3352107..3352275,3352505..3352598,3353514..3353609,
FT                   3354172..3354254,3354980..3355232,3357213..3357386))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117550"
FT                   /product="mCG117550, isoform CRA_a"
FT                   /note="gene_id=mCG117550.1 transcript_id=mCT118697.1
FT                   protein_id=mCP74692.1 isoform=CRA_a"
FT                   /protein_id="EDL00018.1"
FT                   /translation="MLRLPTVLRQMRPVSRALAPHLTRAYAKDVKFGADARALMLQGVD
FT                   LLADAVAVTMGPKGRTVIIEQSWGSPKVTKDGVTVAKSIDLKDKYKNIGAKLVQDVANN
FT                   TNEEAGDGTTTATVLARSIAKEGFEKISKGANPVEIRRGVMLAVDAVIAELKKQSKPVT
FT                   TPEEIAQVATISANGDKDIGNIISDAMKKVGRKGVITVKDGKTLNDELEIIEGMKFDRG
FT                   YISPYFINTSKGQKCEFQDAYVLLSEKKISSVQSIVPALEIANAHRKPLVIIAEDVDGE
FT                   ALSTLVLNRLKVGLQVVAVKAPGFGDNRKNQLKDMAIATGGAVFGEEGLNLNLEDVQAH
FT                   DLGKVGEVIVTKDDAMLLKGKGDKAHIEKRIQEITEQLDITTSEYEKEKLNERLAKLSD
FT                   GVAVLKVGGTSDVEVNEKKDRVTDALNATRAAVEEGIVLGGGCALLRCIPALDSLKPAN
FT                   EDQKIGIEIIKRALKIPAMTIAKNAGVEGSLIVEKILQSSSEVGYDAMLGDFVNMVEKG
FT                   IIDPTKVVRTALLDAAGVASLLTTAEAVVTEIPKEEKDPGMGAMGGMGGGMGGGMF"
FT   gene            3358580..3361759
FT                   /locus_tag="mCG_117539"
FT                   /note="gene_id=mCG117539.1"
FT   mRNA            join(3358580..3358859,3359498..3359662,3361160..3361249,
FT                   3361517..3361759)
FT                   /locus_tag="mCG_117539"
FT                   /product="mCG117539"
FT                   /note="gene_id=mCG117539.1 transcript_id=mCT118680.1
FT                   created on 12-JUL-2002"
FT   CDS             join(3358857..3358859,3359498..3359662,3361160..3361249,
FT                   3361517..3361567)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117539"
FT                   /product="mCG117539"
FT                   /note="gene_id=mCG117539.1 transcript_id=mCT118680.1
FT                   protein_id=mCP74437.1"
FT                   /db_xref="GOA:Q4KL76"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="MGI:MGI:104680"
FT                   /db_xref="UniProtKB/TrEMBL:Q4KL76"
FT                   /protein_id="EDL00019.1"
FT                   /translation="MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQAT
FT                   VVAVGSGGKGKSGEIEPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDSDILGKYVD"
FT   gap             3367847..3367943
FT                   /estimated_length=97
FT   gap             3374162..3374204
FT                   /estimated_length=43
FT   gap             3379788..3379950
FT                   /estimated_length=163
FT   gap             3385463..3385662
FT                   /estimated_length=200
FT   gap             3390580..3390662
FT                   /estimated_length=83
FT   gene            complement(3390663..3391373)
FT                   /pseudo
FT                   /locus_tag="mCG_117545"
FT                   /note="gene_id=mCG117545.1"
FT   mRNA            complement(join(3390663..3391131,3391246..3391373))
FT                   /pseudo
FT                   /locus_tag="mCG_117545"
FT                   /note="gene_id=mCG117545.1 transcript_id=mCT118689.0
FT                   created on 23-SEP-2002"
FT   gap             3393945..3393964
FT                   /estimated_length=20
FT   gene            <3401844..3425403
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /note="gene_id=mCG117540.2"
FT   mRNA            join(<3401844..3401943,3407190..3407252,3415637..3415737,
FT                   3418832..3418874,3419061..3419147,3420659..3421595,
FT                   3423180..3425403)
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, transcript variant
FT                   mCT189318"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT189318.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3401845..3401943,3407190..3407252,3415637..3415737,
FT                   3418832..3418874,3419061..3419147,3420659..3420742)
FT                   /codon_start=1
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT189318.0
FT                   protein_id=mCP110302.0 isoform=CRA_b"
FT                   /protein_id="EDL00021.1"
FT                   /translation="HPGTDASRPDSGTMVMAEGTAVLRRNRPGTKAQDFYNWPDESFDE
FT                   MDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSE
FT                   CHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSR"
FT   mRNA            join(3401846..3401943,3407190..3407252,3415637..3415737,
FT                   3418832..3418874,3419061..3419147,3420659..3420738,
FT                   3421484..3421595,3423180..3425402)
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, transcript variant
FT                   mCT118681"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT118681.1
FT                   created on 12-JUL-2002"
FT   mRNA            join(3401846..3401943,3407190..3407252,3415637..3415737,
FT                   3419061..3419147,3420659..3420738,3421484..3421595,
FT                   3423180..3425402)
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, transcript variant
FT                   mCT170542"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT170542.0
FT                   created on 12-JUL-2002"
FT   CDS             join(3401884..3401943,3407190..3407252,3415637..3415737,
FT                   3418832..3418874,3419061..3419147,3420659..3420738,
FT                   3421484..3421595,3423180..3423311)
FT                   /codon_start=1
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, isoform CRA_c"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT118681.1
FT                   protein_id=mCP74441.1 isoform=CRA_c"
FT                   /protein_id="EDL00022.1"
FT                   /translation="MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQ
FT                   NIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATE
FT                   QWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRI
FT                   YRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGE
FT                   SEA"
FT   CDS             join(3401884..3401943,3407190..3407252,3415637..3415737,
FT                   3419061..3419094)
FT                   /codon_start=1
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, isoform CRA_d"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT170542.0
FT                   protein_id=mCP93460.0 isoform=CRA_d"
FT                   /protein_id="EDL00023.1"
FT                   /translation="MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQ
FT                   NIRADCSNIDKILEPPEGQDEGVWKYEHLRVNAIQIPVLR"
FT   mRNA            join(<3401900..3401943,3415637..3415737,3418832..3418874,
FT                   3419061..3419147,3420659..3420738,3421484..3421595,
FT                   3423180..>3423263)
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, transcript variant
FT                   mCT189317"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT189317.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<3401902..3401943,3415637..3415737,3418832..3418874,
FT                   3419061..3419147,3420659..3420738,3421484..3421595,
FT                   3423180..>3423263)
FT                   /codon_start=1
FT                   /gene="Prei3"
FT                   /locus_tag="mCG_117540"
FT                   /product="preimplantation protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG117540.2 transcript_id=mCT189317.0
FT                   protein_id=mCP110301.0 isoform=CRA_a"
FT                   /protein_id="EDL00020.1"
FT                   /translation="TAVLRRNRPGTKAQYIQQNIRADCSNIDKILEPPEGQDEGVWKYE
FT                   HLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDG
FT                   AACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHR
FT                   FTKFVMKYNLMSKDNLIVPI"
FT   gap             3405290..3405625
FT                   /estimated_length=336
FT   gap             3422019..3422038
FT                   /estimated_length=20
FT   gene            complement(3431148..3431567)
FT                   /locus_tag="mCG_117537"
FT                   /note="gene_id=mCG117537.1"
FT   mRNA            complement(3431148..3431567)
FT                   /locus_tag="mCG_117537"
FT                   /product="mCG117537"
FT                   /note="gene_id=mCG117537.1 transcript_id=mCT118678.0
FT                   created on 14-AUG-2002"
FT   CDS             complement(3431245..3431556)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117537"
FT                   /product="mCG117537"
FT                   /note="gene_id=mCG117537.1 transcript_id=mCT118678.0
FT                   protein_id=mCP74435.1"
FT                   /protein_id="EDL00024.1"
FT                   /translation="MAKLIRNFAETAPSMVAAAVTYSKPRLATFWHYAKVELVPSTPGE
FT                   IPTAIQSVKKIIQSAKTGSFKHLTVKEAVLNGLVATEVWMWFYIGEIIGKRGIVGYEV"
FT   gene            complement(3440669..3497309)
FT                   /locus_tag="mCG_117547"
FT                   /note="gene_id=mCG117547.1"
FT   mRNA            complement(join(3440669..3442587,3455454..3455532,
FT                   3464879..3464982,3466151..3466272,3474834..3475043,
FT                   3476987..3477266,3481801..3481912,3484647..3484830,
FT                   3496649..3497308))
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, transcript variant mCT118693"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT118693.1
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(3440669..3442587,3455454..3455532,
FT                   3464879..3464982,3466151..3466272,3471996..3472073,
FT                   3474834..3475043,3476987..3477266,3496649..3497305))
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, transcript variant mCT172706"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172706.0
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(3440669..3442587,3464938..3464982,
FT                   3466151..3466272,3474834..3475043,3476987..3477266,
FT                   3481801..3481912,3484647..3484830,3496649..3497305))
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, transcript variant mCT172707"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172707.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3442315..3442587,3464938..3464982,
FT                   3466151..3466272,3474834..3475043,3476987..3477266,
FT                   3481801..3481912,3484647..3484830,3496649..3496787))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, isoform CRA_c"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172707.0
FT                   protein_id=mCP95627.0 isoform=CRA_c"
FT                   /protein_id="EDL00027.1"
FT                   /translation="MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTL
FT                   QASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSR
FT                   LKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQC
FT                   YLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQ
FT                   TERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDA
FT                   NWLELTTFYYKQGFSLIDSFVCWETPKGDQLPKSLEGFFIYEEEGSGVPGSNRRGNDAI
FT                   VVEQWTVIEGCEIKTDYGPLLHTLRKGSRLLKGEDRNKVSSRSLGLDTNASQAAGGRAP
FT                   LEEGSLSPSRECWTKEERPAQSDSFSGFSSSDSVLRELDDGQFDQEEGVTQVTCM"
FT   CDS             complement(join(3442315..3442587,3455454..3455532,
FT                   3464879..3464982,3466151..3466272,3474834..3475043,
FT                   3476987..3477266,3481801..3481912,3484647..3484830,
FT                   3496649..3496787))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, isoform CRA_d"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT118693.1
FT                   protein_id=mCP74670.1 isoform=CRA_d"
FT                   /protein_id="EDL00028.1"
FT                   /translation="MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTL
FT                   QASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSR
FT                   LKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQC
FT                   YLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQ
FT                   TERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDA
FT                   NWLELTTFYYKQGFSLIDSFVCWETPKGDQLPKSLEGFFIYEEEGSGVPGSNRRGNDAI
FT                   VVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEGNLATKQVVFLQRP
FT                   VTWNSAAQTPERKGSRLLKGEDRNKVSSRSLGLDTNASQAAGGRAPLEEGSLSPSRECW
FT                   TKEERPAQSDSFSGFSSSDSVLRELDDGQFDQEEGVTQVTCM"
FT   CDS             complement(join(3442315..3442587,3455454..3455532,
FT                   3464879..3464982,3466151..3466272,3471996..3472073,
FT                   3474834..3475043,3476987..3477266,3496649..3496681))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, isoform CRA_b"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172706.0
FT                   protein_id=mCP95626.0 isoform=CRA_b"
FT                   /protein_id="EDL00026.1"
FT                   /translation="MNTPCWTLLYKINAAAKRGMKFVGLVSQCYLPSMHCNGASHDGVA
FT                   ESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQTERNSSPSYANPKRGE
FT                   APDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDANWLELTTFYYKQGFSL
FT                   IDSFVCWETPKGLPFDCVWILFLSRYLKKYRRLIKSKGDQLPKSLEGFFIYEEEGSGVP
FT                   GSNRRGNDAIVVEQWTVIEGCEIKTDYGPLLHTLAEFGWLLTSVLPTPILRHDSEGNLA
FT                   TKQVVFLQRPVTWNSAAQTPERKGSRLLKGEDRNKVSSRSLGLDTNASQAAGGRAPLEE
FT                   GSLSPSRECWTKEERPAQSDSFSGFSSSDSVLRELDDGQFDQEEGVTQVTCM"
FT   gap             3457553..3457572
FT                   /estimated_length=20
FT   gap             3469242..3469261
FT                   /estimated_length=20
FT   mRNA            complement(join(3472303..3472865,3474834..3475043,
FT                   3476987..3477266,3481801..3481912,3484647..3484830,
FT                   3496649..3497309))
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, transcript variant mCT172705"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172705.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3472756..3472865,3474834..3475043,
FT                   3476987..3477266,3481801..3481912,3484647..3484830,
FT                   3496649..3496787))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117547"
FT                   /product="mCG117547, isoform CRA_a"
FT                   /note="gene_id=mCG117547.1 transcript_id=mCT172705.0
FT                   protein_id=mCP95625.0 isoform=CRA_a"
FT                   /protein_id="EDL00025.1"
FT                   /translation="MGCGLRKLEDPDESSPGKIFSTLKRPQVETKTEFAYEYALLDFTL
FT                   QASTNPDVIKINSVLDIVAKVEDYYLKGYVVGAIHPVIQPVGQRKHLPASHLYRAVLSR
FT                   LKLSPKHSAAGGQRRARLVMEECPLTCEAQANDAAKELMDKINAAAKRGMKFVGLVSQC
FT                   YLPSMHCNGASHDGVAESGLHVRQDSQDNCKGWNEGALGGHLSESGVEEEPQHESGQHQ
FT                   TERNSSPSYANPKRGEAPDGKLYMVFNAFEEDAASWAYQEGVLSMKVTRKGAVISALDA
FT                   NWLELTTFYYKQGFSLIDSFVCWETPKVAKLEAFQLSVSDKLPKGKQKYSFQSLSGIPA
FT                   SGLA"
FT   gap             3484178..3484197
FT                   /estimated_length=20
FT   gene            3497201..3505560
FT                   /locus_tag="mCG_117552"
FT                   /note="gene_id=mCG117552.1"
FT   mRNA            join(3497201..3497278,3499036..3499232,3504913..3505560)
FT                   /locus_tag="mCG_117552"
FT                   /product="mCG117552"
FT                   /note="gene_id=mCG117552.1 transcript_id=mCT118699.0
FT                   created on 23-SEP-2002"
FT   CDS             join(3497255..3497278,3499036..3499232,3504913..3504925)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117552"
FT                   /product="mCG117552"
FT                   /note="gene_id=mCG117552.1 transcript_id=mCT118699.0
FT                   protein_id=mCP74696.1"
FT                   /db_xref="MGI:MGI:3648163"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UY33"
FT                   /protein_id="EDL00029.1"
FT                   /translation="MRFFLFLLNGLLCCYTVAMESLLVTGTNYGIGELFIKYPLPLSSA
FT                   CHFQVLKKHWIQKMTQQEHMGRYPGWFRGIVS"
FT   gap             3497692..3497711
FT                   /estimated_length=20
FT   gap             3506095..3506151
FT                   /estimated_length=57
FT   gene            3507717..3509632
FT                   /gene="Mars2"
FT                   /locus_tag="mCG_117543"
FT                   /note="gene_id=mCG117543.1"
FT   mRNA            3507717..3509632
FT                   /gene="Mars2"
FT                   /locus_tag="mCG_117543"
FT                   /product="methionine-tRNA synthetase 2 (mitochondrial)"
FT                   /note="gene_id=mCG117543.1 transcript_id=mCT118685.1
FT                   created on 23-SEP-2002"
FT   CDS             3507754..3509514
FT                   /codon_start=1
FT                   /gene="Mars2"
FT                   /locus_tag="mCG_117543"
FT                   /product="methionine-tRNA synthetase 2 (mitochondrial)"
FT                   /note="gene_id=mCG117543.1 transcript_id=mCT118685.1
FT                   protein_id=mCP74461.1"
FT                   /db_xref="GOA:A2RT28"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="MGI:MGI:2444136"
FT                   /db_xref="UniProtKB/TrEMBL:A2RT28"
FT                   /protein_id="EDL00030.1"
FT                   /translation="MLRQCARWVLTRTRFGRGCRRYGSCSPSASGDAGEARAYFTTPIF
FT                   YVNAAPHIGHLYSALLADALCRHRRLRVPGSASTRFSTGTDEHGLKIQQAAATAGLAPI
FT                   ELCDRVSAQFLQLFREADISSTDFIRTTEARHRVAVQHFWGVLEARGLLYKGIYEGWYC
FT                   ASDECFLPEAKVTRQVGPSGDPCPVSLESGHPVSWTKEENYIFKLSQFREPLQRWLGNN
FT                   PQAITPEPFHQAVLQWLEEELPDLSVSRRSSHLHWGIPVPGDDSQTIYVWLDALVNYLT
FT                   VVGYPDADFKSWWPATSHIIGKDILKFHAIYWPALLLGAGLRPPHRIYVHSHWTVSGQK
FT                   MSKSLGNVVDPRTCLDRYTVDGFRYFLLRQGVPNWDCDYYDEKVVKLLDSELADALGGL
FT                   LNRCTAYRINPSGTYPSFCAACFPSEPGLTGPSVRVQAEDYALVTAVATLPKLVAGYYN
FT                   DFQIYKALEAVSSCVRQTNGFVQRHAPWKLNWESPEDAPWLGTVLHVALECLRVFGTLL
FT                   QPVTPNLADKLLSRLGVSTTERGLGELYFLPRFYGHPCPFEGRKLGPDTGLLFPRLDQS
FT                   RTRLVKAHRT"
FT   gap             3534356..3534384
FT                   /estimated_length=29
FT   gene            complement(<3570583..>3633973)
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /note="gene_id=mCG117546.1"
FT   mRNA            complement(join(<3570583..3570699,3575012..3575140,
FT                   3576190..3576237,3594164..3594235,3610990..3611117,
FT                   3616880..3616955,3619384..3619438,3626151..3626242,
FT                   3631119..3631262,3633802..>3633973))
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /product="bol, boule-like (Drosophila), transcript variant
FT                   mCT118691"
FT                   /note="gene_id=mCG117546.1 transcript_id=mCT118691.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3570583..3570699,3575012..3575140,
FT                   3576190..3576237,3594164..3594235,3610990..3611117,
FT                   3616880..3616955,3619384..3619438,3626151..3626242,
FT                   3631119..3631262,3633802..>3633972))
FT                   /codon_start=1
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /product="bol, boule-like (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG117546.1 transcript_id=mCT118691.1
FT                   protein_id=mCP74649.1 isoform=CRA_b"
FT                   /protein_id="EDL00032.1"
FT                   /translation="RAARPARRLRHCSRRRRRQGERVPDGRRAGSLPANAPSNLSFPRT
FT                   PEIRKMETESRAQSTNQTQTDSLSPSPNPVSPVPLNNPTSGPRYGTVIPNRIFVGGIDF
FT                   KTNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQEDAQKILQEAEKLNYKDK
FT                   KLNIGPAIRKQQVGIPRSSLMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPSWP
FT                   SRSISSSPVMVAQPVYQQPAYHYQAPAQCLPGQWQWGVPQSPASSAPFLYLQPSEVIYQ
FT                   PVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQAAYHQVYASSAIAMPAPMMQPEPIKVR
FT                   SLF"
FT   mRNA            complement(join(<3570583..3570699,3575012..3575140,
FT                   3576190..3576237,3594164..3594235,3610990..3611117,
FT                   3616880..3616955,3619384..3619438,3626151..3626242,
FT                   3631119..3631262,3632985..>3633211))
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /product="bol, boule-like (Drosophila), transcript variant
FT                   mCT172708"
FT                   /note="gene_id=mCG117546.1 transcript_id=mCT172708.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(3570583..3570699,3575012..3575140,
FT                   3576190..3576237,3594164..3594235,3610990..3611117,
FT                   3616880..3616955,3619384..3619438,3626151..3626242,
FT                   3631119..3631262,3632985..>3633200))
FT                   /codon_start=1
FT                   /gene="Boll"
FT                   /locus_tag="mCG_117546"
FT                   /product="bol, boule-like (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG117546.1 transcript_id=mCT172708.0
FT                   protein_id=mCP95624.0 isoform=CRA_a"
FT                   /protein_id="EDL00031.1"
FT                   /translation="PPLLAGLPDKISRWLAFFSLPHFGGEGGDPRVGVPVHDDPREPED
FT                   VVNPAICPIASACWPPRGRSTEAVTATQSTNQTQTDSLSPSPNPVSPVPLNNPTSGPRY
FT                   GTVIPNRIFVGGIDFKTNENDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFITFETQEDA
FT                   QKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSLMPAAGTMYLTTSTGYPYTYHNGVA
FT                   YFHTPEVTSVPPSWPSRSISSSPVMVAQPVYQQPAYHYQAPAQCLPGQWQWGVPQSPAS
FT                   SAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQAAYHQVYASSAI
FT                   AMPAPMMQPEPIKVRSLF"
FT   gene            3605920..3606313
FT                   /pseudo
FT                   /locus_tag="mCG_117538"
FT                   /note="gene_id=mCG117538.1"
FT   mRNA            3605920..3606313
FT                   /pseudo
FT                   /locus_tag="mCG_117538"
FT                   /note="gene_id=mCG117538.1 transcript_id=mCT118679.0
FT                   created on 12-JUL-2002"
FT   gap             3616433..3616452
FT                   /estimated_length=20
FT   gap             3634140..3634767
FT                   /estimated_length=628
FT   gap             3637232..3638800
FT                   /estimated_length=1569
FT   gap             3652321..3652457
FT                   /estimated_length=137
FT   gene            3676955..4022550
FT                   /locus_tag="mCG_113459"
FT                   /note="gene_id=mCG113459.1"
FT   mRNA            join(3676955..3677322,3965150..3967629,3971340..3971543,
FT                   3983022..3983097,3985095..3985204,4020885..4022550)
FT                   /locus_tag="mCG_113459"
FT                   /product="mCG113459"
FT                   /note="gene_id=mCG113459.1 transcript_id=mCT114543.1
FT                   created on 23-SEP-2002"
FT   gap             3679546..3679565
FT                   /estimated_length=20
FT   gene            3691237..3693154
FT                   /locus_tag="mCG_141415"
FT                   /note="gene_id=mCG141415.1"
FT   mRNA            3691237..3693154
FT                   /locus_tag="mCG_141415"
FT                   /product="mCG141415"
FT                   /note="gene_id=mCG141415.1 transcript_id=mCT175131.1
FT                   created on 05-MAY-2003"
FT   CDS             3692522..3692725
FT                   /codon_start=1
FT                   /locus_tag="mCG_141415"
FT                   /product="mCG141415"
FT                   /note="gene_id=mCG141415.1 transcript_id=mCT175131.1
FT                   protein_id=mCP98050.1"
FT                   /protein_id="EDL00034.1"
FT                   /translation="MGWSSNWASYWLAIPSVSAPSLIPAFIVDRINFGLKVLWVGWCSY
FT                   CPTVVPAWLQELASSGSISPVL"
FT   gap             3695675..3695694
FT                   /estimated_length=20
FT   gap             3707102..3707121
FT                   /estimated_length=20
FT   gap             3709902..3710211
FT                   /estimated_length=310
FT   gap             3713506..3713558
FT                   /estimated_length=53
FT   gene            complement(3714132..3715485)
FT                   /locus_tag="mCG_117541"
FT                   /note="gene_id=mCG117541.1"
FT   mRNA            complement(3714132..3715485)
FT                   /locus_tag="mCG_117541"
FT                   /product="mCG117541"
FT                   /note="gene_id=mCG117541.1 transcript_id=mCT118682.1
FT                   created on 12-JUL-2002"
FT   CDS             complement(3714493..3715443)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117541"
FT                   /product="mCG117541"
FT                   /note="gene_id=mCG117541.1 transcript_id=mCT118682.1
FT                   protein_id=mCP74449.1"
FT                   /protein_id="EDL00035.1"
FT                   /translation="MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDLGYRHIDC
FT                   AQVYQNEKEVGVALQEKLKEQVVKRQDLFIVSKLWCTFHDKSMVKGAFQKTLSDLQLDY
FT                   LDLYLIHWPTGFKPGPDYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKTIGVSNFN
FT                   PLQIERILNKPGLKYRPAVNQIECHPYLTQEKLIEYCHSKGIVVTAYSPLGSPDRPWAK
FT                   PEDPSLLEDPRIKAIAAKYNKTTAQVLIRFPIQRNLVVIPKSVTPVRIAENLKVFDFEL
FT                   SSEDMATLLSYNRNWRVCALMSCAKHKDYPFHAEV"
FT   gap             3717182..3717675
FT                   /estimated_length=494
FT   gap             3719923..3719942
FT                   /estimated_length=20
FT   gap             3735209..3737154
FT                   /estimated_length=1946
FT   gap             3740283..3742490
FT                   /estimated_length=2208
FT   gap             3746608..3749372
FT                   /estimated_length=2765
FT   gap             3758286..3758305
FT                   /estimated_length=20
FT   gap             3834690..3834752
FT                   /estimated_length=63
FT   gap             3851971..3851990
FT                   /estimated_length=20
FT   gap             3854285..3854804
FT                   /estimated_length=520
FT   gap             3872239..3872408
FT                   /estimated_length=170
FT   gap             3880248..3880584
FT                   /estimated_length=337
FT   gap             3885677..3886230
FT                   /estimated_length=554
FT   gap             3900303..3900367
FT                   /estimated_length=65
FT   gene            complement(3912617..3915331)
FT                   /locus_tag="mCG_146956"
FT                   /note="gene_id=mCG146956.0"
FT   mRNA            complement(join(3912617..3914038,3914304..3915331))
FT                   /locus_tag="mCG_146956"
FT                   /product="mCG146956"
FT                   /note="gene_id=mCG146956.0 transcript_id=mCT187219.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(3913978..3914038,3914304..3914509))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146956"
FT                   /product="mCG146956"
FT                   /note="gene_id=mCG146956.0 transcript_id=mCT187219.0
FT                   protein_id=mCP109555.0"
FT                   /protein_id="EDL00036.1"
FT                   /translation="MEKPCLGEKKKRQTQFYSVFLDNLLPKTQGILKIFLIRYFPHLHF
FT                   QCYPKSPPYPPPTPLPYLPTPTFWPWHSLTRDSYIRSFNLNGD"
FT   gap             3933996..3934281
FT                   /estimated_length=286
FT   gap             3948220..3948239
FT                   /estimated_length=20
FT   gap             3955523..3955621
FT                   /estimated_length=99
FT   CDS             join(3965209..3967629,3971340..3971543,3983022..3983097,
FT                   3985095..3985204,4020885..4021067)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113459"
FT                   /product="mCG113459"
FT                   /note="gene_id=mCG113459.1 transcript_id=mCT114543.1
FT                   protein_id=mCP74443.1"
FT                   /protein_id="EDL00033.1"
FT                   /translation="MPSEKKISSAHDCISFMQAGCELKKVRPNSRIYNRFFTLDTDLQA
FT                   LRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGLADQICEDCAFSILHGENYESLD
FT                   LVANSADVANIWVSGLRYLVSRSKQPLDFIEGNQNTPRFMWLKTVFEAADVDGNGIMLE
FT                   DTSVELIKQLNPTLKESKIRLKFKEIQKSKEKLTTRVTEEEFCEAFCELCTRPEVYFLL
FT                   VQISKNKEYLDANDLMLFLEAEQGVTHITEDMCLDIIRRYELSEDGRQKGFLAIDGFTQ
FT                   YLLSPECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIEDQFRGPADINGYVRALKMG
FT                   CRSIELDVSDGPDNEPILCNRNNMAMHLSFRSVLEVINKFAFVASEYPLILCLGNHCSL
FT                   PQQKVMAQQMKKVFGEKLYTEAPLSSESYLPSPEKLKNMIIVKGKKLPSESDLLEGEVT
FT                   DEDEEAEMSRRMSGDYNGEQKHIWLCRELSDLVSICKSVQHRDFELSMKTQNYWEMCSF
FT                   SETEASRIANEYPEDFVNYNKKFLSRVYPSAMRIDSSNLNPQDFWNCGCQIVAMNFQTP
FT                   GPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGIVPGVSPLVLHIKIISGQNF
FT                   PKPKGACAKGDVIDPYVCVEIHGIPADCCEQRTKTVQQNSDNPIFDETFEFQVNLPELT
FT                   MVRFVILDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVTLFVHIAITNRS
FT                   GGGKPQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDMRENMQNAIVS
FT                   VKELCGLPPIASLKQCLLTLSSRLITSDSTPSVSLVMKDCFPYLEPLGAIPDVQKRMLA
FT                   AYDLMIQESRVLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKLNKAIESFA
FT                   WNITVLKGQGDLLKNAKNEAVENIKQIQLACLSCGLSKGPGGGSEAKGKRSLEAIEEKE
FT                   SSEENGKL"
FT   gap             3977009..3977273
FT                   /estimated_length=265
FT   gap             3979238..3979257
FT                   /estimated_length=20
FT   gap             4046420..4048601
FT                   /estimated_length=2182
FT   gap             4050010..4051049
FT                   /estimated_length=1040
FT   gap             4052484..4052733
FT                   /estimated_length=250
FT   gap             4092262..4092281
FT                   /estimated_length=20
FT   gap             4120151..4120170
FT                   /estimated_length=20
FT   gap             4126778..4126797
FT                   /estimated_length=20
FT   gap             4128144..4128238
FT                   /estimated_length=95
FT   gap             4152303..4152386
FT                   /estimated_length=84
FT   gene            <4159432..4183162
FT                   /locus_tag="mCG_144504"
FT                   /note="gene_id=mCG144504.0"
FT   mRNA            join(<4159432..4159745,4168658..4169077,4182277..4183162)
FT                   /locus_tag="mCG_144504"
FT                   /product="mCG144504"
FT                   /note="gene_id=mCG144504.0 transcript_id=mCT183928.0
FT                   created on 05-JUN-2003"
FT   gap             4160456..4160475
FT                   /estimated_length=20
FT   gap             4164264..4164283
FT                   /estimated_length=20
FT   CDS             <4182441..4182737
FT                   /codon_start=1
FT                   /locus_tag="mCG_144504"
FT                   /product="mCG144504"
FT                   /note="gene_id=mCG144504.0 transcript_id=mCT183928.0
FT                   protein_id=mCP106111.0"
FT                   /protein_id="EDL00037.1"
FT                   /translation="NCYRKIIRGLKYTQFIFPPSICKNLMAFLTSRWLEICFILKRKLL
FT                   RIIKMIRSEWIRILNLQRFPECVRRLPKYHTIVCAYLLCYKKLLASKYQQVGL"
FT   gap             4193671..4194564
FT                   /estimated_length=894
FT   gene            4198470..4239389
FT                   /locus_tag="mCG_145723"
FT                   /note="gene_id=mCG145723.0"
FT   mRNA            join(4198470..4198571,4201515..4201649,4223897..4224006,
FT                   4224707..4225068,4228041..4228218,4238141..4239389)
FT                   /locus_tag="mCG_145723"
FT                   /product="mCG145723, transcript variant mCT175132"
FT                   /note="gene_id=mCG145723.0 transcript_id=mCT175132.1
FT                   created on 09-JUL-2003"
FT   gap             4215584..4215670
FT                   /estimated_length=87
FT   mRNA            join(4227965..4228218,4237576..4237713,4238141..4239389)
FT                   /locus_tag="mCG_145723"
FT                   /product="mCG145723, transcript variant mCT186563"
FT                   /note="gene_id=mCG145723.0 transcript_id=mCT186563.0
FT                   created on 09-JUL-2003"
FT   CDS             join(4228207..4228218,4237576..4237713,4238141..4238350)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145723"
FT                   /product="mCG145723, isoform CRA_b"
FT                   /note="gene_id=mCG145723.0 transcript_id=mCT186563.0
FT                   protein_id=mCP107267.0 isoform=CRA_b"
FT                   /protein_id="EDL00039.1"
FT                   /translation="MCCGKILLKTHNLTVAVAVRLSLMIFGTGFDLSEMVHVALTLSGK
FT                   EKRNKIFCISSNSTTNHEAFPEAILSTPAFLAHNTPTEEICSPFQIYCPCVNSLSGMLL
FT                   SLLRVVSASQGTTSV"
FT   CDS             join(4228207..4228218,4238141..4238350)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145723"
FT                   /product="mCG145723, isoform CRA_a"
FT                   /note="gene_id=mCG145723.0 transcript_id=mCT175132.1
FT                   protein_id=mCP98051.1 isoform=CRA_a"
FT                   /protein_id="EDL00038.1"
FT                   /translation="MCCGIFCISSNSTTNHEAFPEAILSTPAFLAHNTPTEEICSPFQI
FT                   YCPCVNSLSGMLLSLLRVVSASQGTTSV"
FT   gap             4247997..4248213
FT                   /estimated_length=217
FT   gene            4285853..4287079
FT                   /locus_tag="mCG_1035631"
FT                   /note="gene_id=mCG1035631.1"
FT   mRNA            join(4285853..4285929,4286732..4287079)
FT                   /locus_tag="mCG_1035631"
FT                   /product="mCG1035631"
FT                   /note="gene_id=mCG1035631.1 transcript_id=mCT153335.1
FT                   created on 05-SEP-2002"
FT   CDS             4286812..4286994
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035631"
FT                   /product="mCG1035631"
FT                   /note="gene_id=mCG1035631.1 transcript_id=mCT153335.1
FT                   protein_id=mCP74687.1"
FT                   /protein_id="EDL00040.1"
FT                   /translation="MPTALPSGFLLCTRRLPSAHTPAPSSVLCLHIKHEELASMAPENK
FT                   LRFNQLDTCFYYGNL"
FT   gap             4294412..4294607
FT                   /estimated_length=196
FT   gap             4313978..4313997
FT                   /estimated_length=20
FT   gap             4342411..4342506
FT                   /estimated_length=96
FT   gap             4359336..4364617
FT                   /estimated_length=5282
FT   gap             4374988..4375007
FT                   /estimated_length=20
FT   gap             4377166..4377305
FT                   /estimated_length=140
FT   gap             4405092..4406804
FT                   /estimated_length=1713
FT   gap             4419646..4419832
FT                   /estimated_length=187
FT   gap             4473295..4473314
FT                   /estimated_length=20
FT   gap             4478718..4478737
FT                   /estimated_length=20
FT   gap             4496447..4496486
FT                   /estimated_length=40
FT   gap             4540154..4540817
FT                   /estimated_length=664
FT   gap             4546002..4547810
FT                   /estimated_length=1809
FT   gap             4571098..4571117
FT                   /estimated_length=20
FT   gene            <4604885..>4733283
FT                   /locus_tag="mCG_1035540"
FT                   /note="gene_id=mCG1035540.1"
FT   mRNA            join(<4604885..4604952,4662787..4662847,4663579..4663657,
FT                   4677688..4677830,4702184..4702276,4716482..4716528,
FT                   4716727..4716784,4733185..>4733283)
FT                   /locus_tag="mCG_1035540"
FT                   /product="mCG1035540"
FT                   /note="gene_id=mCG1035540.1 transcript_id=mCT153244.0
FT                   created on 31-OCT-2002"
FT   CDS             join(4604885..4604952,4662787..4662847,4663579..4663657,
FT                   4677688..4677830,4702184..4702276,4716482..4716528,
FT                   4716727..4716784,4733185..4733283)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035540"
FT                   /product="mCG1035540"
FT                   /note="gene_id=mCG1035540.1 transcript_id=mCT153244.0
FT                   protein_id=mCP74717.0"
FT                   /protein_id="EDL00041.1"
FT                   /translation="MEPGHQGFGQTSEINMTQEEDRRNYEKLNVNITALGMNPEPATEY
FT                   EKLSRKILHVREDKAFLHRLILQAGKLAQAHFEDSIECVCSFLCTCDINGSSAGTCPIV
FT                   TQRPLYEAKVHSKQLHEYSDEVDLKAMRSSHCILMAVLQVTESKTTITGKQPFSFKMYH
FT                   NHLPVTRQNDEHKGKEERHPIDSYKVCQGPWKPSILSLCQESSQSNRAMPNN"
FT   gap             4647562..4651490
FT                   /estimated_length=3929
FT   gap             4697783..4697911
FT                   /estimated_length=129
FT   gap             4737005..4737024
FT                   /estimated_length=20
FT   gap             4766835..4766854
FT                   /estimated_length=20
FT   gap             4775911..4775930
FT                   /estimated_length=20
FT   gap             4797872..4799333
FT                   /estimated_length=1462
FT   gap             4804053..4804072
FT                   /estimated_length=20
FT   gap             4835597..4835690
FT                   /estimated_length=94
FT   gap             4845543..4845652
FT                   /estimated_length=110
FT   gap             4855452..4855471
FT                   /estimated_length=20
FT   gap             4873896..4873915
FT                   /estimated_length=20
FT   gene            complement(4901360..4902743)
FT                   /gene="Hsfy2"
FT                   /locus_tag="mCG_1035541"
FT                   /note="gene_id=mCG1035541.1"
FT   mRNA            complement(4901360..4902743)
FT                   /gene="Hsfy2"
FT                   /locus_tag="mCG_1035541"
FT                   /product="heat shock transcription factor, Y linked 2"
FT                   /note="gene_id=mCG1035541.1 transcript_id=mCT153245.1
FT                   created on 05-SEP-2002"
FT   CDS             complement(4901505..4902362)
FT                   /codon_start=1
FT                   /gene="Hsfy2"
FT                   /locus_tag="mCG_1035541"
FT                   /product="heat shock transcription factor, Y linked 2"
FT                   /note="gene_id=mCG1035541.1 transcript_id=mCT153245.1
FT                   protein_id=mCP74726.1"
FT                   /protein_id="EDL00042.1"
FT                   /translation="MKSSSRKEVLERKAPFRIFETDSMKSLVRQLNLYGFRKMRQNFQR
FT                   SASLPDFLAEEKGISASCKLQFYQNPNFLRDCPHLIERMKRRIGIKTVSRGAAPSLPDF
FT                   KNKHFRPDLVKMDDHSLGVAVQTSERNLLSSSSISNVYLRQKPSLAQGGSDTMDVIRSD
FT                   FSLATPSSFRPPEEILTHRPAPLNEVSSLCMDSQRIFTQANDSTVNFIITSITQNRGDM
FT                   SHLWNSCIEMQGEPSFQPGFPHFSSSSSTYSDSKAKGEPELPIHKERVASTTLASTSNH
FT                   HSSS"
FT   gap             4903215..4903234
FT                   /estimated_length=20
FT   gap             4913084..4913161
FT                   /estimated_length=78
FT   gap             4938226..4938245
FT                   /estimated_length=20
FT   gap             4944869..4944888
FT                   /estimated_length=20
FT   gap             4975876..4975937
FT                   /estimated_length=62
FT   gap             4980937..4986800
FT                   /estimated_length=5864
FT   gap             5019460..5019479
FT                   /estimated_length=20
FT   gap             5025872..5026171
FT                   /estimated_length=300
FT   gap             5029742..5030052
FT                   /estimated_length=311
FT   gap             5038934..5039284
FT                   /estimated_length=351
FT   gap             5051811..5052089
FT                   /estimated_length=279
FT   gene            complement(5062059..5237279)
FT                   /gene="Satb2"
FT                   /locus_tag="mCG_113907"
FT                   /note="gene_id=mCG113907.1"
FT   mRNA            complement(join(5062059..5063036,5097411..5097608,
FT                   5111682..5111837,5116277..5116489,5137365..5137837,
FT                   5157160..5157262,5163823..5163946,5164868..5164994,
FT                   5214023..5214199,5235598..5235825,5237057..5237279))
FT                   /gene="Satb2"
FT                   /locus_tag="mCG_113907"
FT                   /product="special AT-rich sequence binding protein 2"
FT                   /note="gene_id=mCG113907.1 transcript_id=mCT114996.1
FT                   created on 08-NOV-2002"
FT   CDS             complement(join(5062575..5063036,5097411..5097608,
FT                   5111682..5111837,5116277..5116489,5137365..5137837,
FT                   5157160..5157262,5163823..5163946,5164868..5164994,
FT                   5214023..5214199,5235598..5235766))
FT                   /codon_start=1
FT                   /gene="Satb2"
FT                   /locus_tag="mCG_113907"
FT                   /product="special AT-rich sequence binding protein 2"
FT                   /note="gene_id=mCG113907.1 transcript_id=mCT114996.1
FT                   protein_id=mCP74488.1"
FT                   /db_xref="GOA:Q546B3"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR003350"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="MGI:MGI:2679336"
FT                   /db_xref="UniProtKB/TrEMBL:Q546B3"
FT                   /protein_id="EDL00043.1"
FT                   /translation="MERRSESPCLRDSPDRRSGSPDVKGPPPVKVARLEQNGSPMGARG
FT                   RPNGAVAKAVGGLMIPVFCVVEQLDGSLEYDNREEHAEFVLVRKDVLFSQLVETALLAL
FT                   GYSHSSAAQAQGIIKLGRWNPLPLSYVTDAPDATVADMLQDVYHVVTLKIQLQSCSKLE
FT                   DLPAEQWNHATVRNALKELLKEMNQSTLAKECPLSQSMISSIVNSTYYANVSATKCQEF
FT                   GRWYKKYKKIKVERVERENLSDYCVLGQRPMHLPNMNQLASLGKTNEQSPHSQIHHSTP
FT                   IRNQVPALQPIMSPGLLSPQLSPQLVRQQIAMAHLINQQIAVSRLLAHQHPQAINQQFL
FT                   NHPPIPRAVKPEPTNSSVEVSPDIYQQVRDELKRASVSQAVFARVAFNRTQGLLSEILR
FT                   KEEDPRTASQSLLVNLRAMQNFLNLPEVERDRIYQDERERSMNPNVSMVSSASSSPSSS
FT                   RTPQAKTSTPTTDLPIKVDGANVNITAAIYDEIQQEMKRAKVSQALFAKVAANKSQGWL
FT                   CELLRWKENPSPENRTLWENLCTIRRFLNLPQHERDVIYEEESRHHHSERMQHVVQLPP
FT                   EPVQVLHRQQSQPTKESSPPREEAPPPPPPTEDSCAKKPRSRTKISLEALGILQSFIHD
FT                   VGLYPDQEAIHTLSAQLDLPKHTIIKFFQNQRYHVKHHGKLKEHLGSAVDVAEYKDEEL
FT                   LTESEENDSEEGSEEMYKVEAEEENADKSKAAPAETDQR"
FT   gap             5079080..5079117
FT                   /estimated_length=38
FT   gap             5092853..5092872
FT                   /estimated_length=20
FT   gap             5097750..5097808
FT                   /estimated_length=59
FT   gap             5108651..5108670
FT                   /estimated_length=20
FT   gap             5135492..5135511
FT                   /estimated_length=20
FT   gap             5158247..5158266
FT                   /estimated_length=20
FT   gap             5189444..5189531
FT                   /estimated_length=88
FT   gap             5237299..5237357
FT                   /estimated_length=59
FT   gene            <5237465..5315093
FT                   /locus_tag="mCG_141414"
FT                   /note="gene_id=mCG141414.0"
FT   mRNA            join(5237465..5237757,5267392..5267544,5269042..5269178,
FT                   5305346..5305464,5305602..5305772,5314881..5315093)
FT                   /locus_tag="mCG_141414"
FT                   /product="mCG141414, transcript variant mCT175130"
FT                   /note="gene_id=mCG141414.0 transcript_id=mCT175130.0
FT                   created on 25-MAR-2003"
FT   mRNA            join(<5237465..5237757,5267392..5267544,5269042..5269178,
FT                   5305346..5305464,5305602..5307528)
FT                   /locus_tag="mCG_141414"
FT                   /product="mCG141414, transcript variant mCT189307"
FT                   /note="gene_id=mCG141414.0 transcript_id=mCT189307.0
FT                   created on 08-MAR-2004"
FT   gap             5237985..5238055
FT                   /estimated_length=71
FT   gap             5242034..5242088
FT                   /estimated_length=55
FT   gap             5247496..5248030
FT                   /estimated_length=535
FT   gap             5253804..5254179
FT                   /estimated_length=376
FT   CDS             join(<5267398..5267544,5269042..5269178,5305346..5305439)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141414"
FT                   /product="mCG141414, isoform CRA_b"
FT                   /note="gene_id=mCG141414.0 transcript_id=mCT189307.0
FT                   protein_id=mCP110306.0 isoform=CRA_b"
FT                   /protein_id="EDL00045.1"
FT                   /translation="ALRSQKLKSTLSSCCLTIYMENSQLLLHHVCLHAATLLDTMTMDY
FT                   TSETAVKHQSLENGSETVKLPLTSPLPMPCRTSKDGLDAWKMPIHSRPVCWQMVLPQPD
FT                   SNRTVSVRPFLSEIYQEKQTH"
FT   CDS             join(5267455..5267544,5269042..5269178,5305346..5305439)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141414"
FT                   /product="mCG141414, isoform CRA_a"
FT                   /note="gene_id=mCG141414.0 transcript_id=mCT175130.0
FT                   protein_id=mCP98049.0 isoform=CRA_a"
FT                   /protein_id="EDL00044.1"
FT                   /translation="MENSQLLLHHVCLHAATLLDTMTMDYTSETAVKHQSLENGSETVK
FT                   LPLTSPLPMPCRTSKDGLDAWKMPIHSRPVCWQMVLPQPDSNRTVSVRPFLSEIYQEKQ
FT                   TH"
FT   gap             5279089..5279108
FT                   /estimated_length=20
FT   gap             5300199..5300255
FT                   /estimated_length=57
FT   gap             5315826..5315846
FT                   /estimated_length=21
FT   gap             5329171..5334112
FT                   /estimated_length=4942
FT   gap             5339590..5339610
FT                   /estimated_length=21
FT   gap             5341759..5341778
FT                   /estimated_length=20
FT   gap             5351910..5352114
FT                   /estimated_length=205
FT   gap             5373987..5374785
FT                   /estimated_length=799
FT   gap             5403435..5403454
FT                   /estimated_length=20
FT   gap             5408528..5408799
FT                   /estimated_length=272
FT   gap             5434573..5434613
FT                   /estimated_length=41
FT   gap             5457271..5457290
FT                   /estimated_length=20
FT   gene            complement(5465279..5479296)
FT                   /locus_tag="mCG_146961"
FT                   /note="gene_id=mCG146961.0"
FT   mRNA            complement(join(5465279..5467480,5469162..5469228,
FT                   5471013..5471202,5473103..5473342,5476709..5476942,
FT                   5478016..5478199,5479123..5479296))
FT                   /locus_tag="mCG_146961"
FT                   /product="mCG146961"
FT                   /note="gene_id=mCG146961.0 transcript_id=mCT187224.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(5467325..5467480,5469162..5469228,
FT                   5471013..5471152))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146961"
FT                   /product="mCG146961"
FT                   /note="gene_id=mCG146961.0 transcript_id=mCT187224.0
FT                   protein_id=mCP109560.0"
FT                   /protein_id="EDL00046.1"
FT                   /translation="MVSHSRGSLCCKEQVLDDLGIWSNGHLMTCANVSCRQQPCLPAAW
FT                   SDSCAVSQTSFRAKGFKALRFWTQGGILLQMREHPRPWWTLAMKAAACSTCLLGNNNST
FT                   RANVLFGEAMIVPLTS"
FT   gap             5469234..5469253
FT                   /estimated_length=20
FT   gap             5487858..5488012
FT                   /estimated_length=155
FT   gap             5490470..5490489
FT                   /estimated_length=20
FT   gap             5515714..5515957
FT                   /estimated_length=244
FT   gap             5531165..5531184
FT                   /estimated_length=20
FT   gap             5543598..5543617
FT                   /estimated_length=20
FT   gene            complement(5555871..5556804)
FT                   /pseudo
FT                   /locus_tag="mCG_1035543"
FT                   /note="gene_id=mCG1035543.1"
FT   mRNA            complement(5555871..5556804)
FT                   /pseudo
FT                   /locus_tag="mCG_1035543"
FT                   /note="gene_id=mCG1035543.1 transcript_id=mCT153247.1
FT                   created on 01-NOV-2002"
FT   gap             5581418..5582029
FT                   /estimated_length=612
FT   gap             5598897..5599356
FT                   /estimated_length=460
FT   gene            complement(5625182..>5642377)
FT                   /locus_tag="mCG_1035637"
FT                   /note="gene_id=mCG1035637.1"
FT   mRNA            complement(join(5625182..5625494,5627397..5627594,
FT                   5640081..5640352,5642238..>5642377))
FT                   /locus_tag="mCG_1035637"
FT                   /product="mCG1035637"
FT                   /note="gene_id=mCG1035637.1 transcript_id=mCT153341.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(5625200..>5625406)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035637"
FT                   /product="mCG1035637"
FT                   /note="gene_id=mCG1035637.1 transcript_id=mCT153341.0
FT                   protein_id=mCP74708.0"
FT                   /protein_id="EDL00047.1"
FT                   /translation="VTDGKTEIRVTCKTNKTVNGNGLNMNLHSSFYQQNGQGLNNLSEP
FT                   QFPHNESHHSICFVSNKTHNLKQ"
FT   gene            5642504..5650250
FT                   /locus_tag="mCG_113905"
FT                   /note="gene_id=mCG113905.1"
FT   mRNA            join(5642504..5642779,5647576..5650250)
FT                   /locus_tag="mCG_113905"
FT                   /product="mCG113905"
FT                   /note="gene_id=mCG113905.1 transcript_id=mCT114994.0
FT                   created on 05-SEP-2002"
FT   CDS             5647591..5648397
FT                   /codon_start=1
FT                   /locus_tag="mCG_113905"
FT                   /product="mCG113905"
FT                   /note="gene_id=mCG113905.1 transcript_id=mCT114994.0
FT                   protein_id=mCP74477.1"
FT                   /protein_id="EDL00048.1"
FT                   /translation="MTRHPENYQWENWSLENIATILARRFPNSYIWVIKCSRMHLHKFS
FT                   CYDNFVKSNMFGAPEHTPDFGAFKHLYMLLVNAFNLTQNGMLFKNRSVWNKDCKASNCE
FT                   SNPSTSNGGQKENERTCEHVDEPSMSFPPLSLDGASFTLIGFSKGCVVLNQLLFELKEA
FT                   KKDKNIDAFIKSIRTMYWLDGGHSGGSNTWVTYPEVLEEFAQTGITVHTHVTPYQVHDP
FT                   MRSWIGKEHKKFVQILRDLGMQVTSQIHFAKETPSIENHFRVHEVF"
FT   gene            complement(5653072..5671842)
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /note="gene_id=mCG113906.1"
FT   mRNA            complement(join(5653072..5653585,5655475..5655591,
FT                   5658183..5658320,5658880..5658924,5661560..5661629,
FT                   5666221..5666356,5671505..5671842))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT114995"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT114995.1
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(5653083..5653585,5655475..5655591,
FT                   5656282..5656369,5658183..5658320,5658880..5658924,
FT                   5661560..5661629,5666221..5666356,5671505..5671795))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT172695"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT172695.0
FT                   created on 05-SEP-2002"
FT   mRNA            complement(join(<5653499..5653585,5655475..5655591,
FT                   5656282..5656369,5658183..5658320,5658503..5658527,
FT                   5658880..5658924,5661560..5661629,5666221..5666356,
FT                   5671505..>5671564))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT189312"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT189312.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<5653499..5653585,5655475..5655591,
FT                   5656282..5656369,5658183..5658320,5658503..5658527,
FT                   5658880..5658924,5661560..5661629,5666221..5666356,
FT                   5671505..>5671564))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_c"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT189312.0
FT                   protein_id=mCP110294.0 isoform=CRA_c"
FT                   /db_xref="GOA:G3UW53"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="MGI:MGI:1915986"
FT                   /db_xref="UniProtKB/TrEMBL:G3UW53"
FT                   /protein_id="EDL00051.1"
FT                   /translation="PVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQ
FT                   VGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHLEKTQGS
FT                   RKNSFTGKDVADIRQQFPSLGGDITFPMFFREEQFFSSVFRISSPGLQLWTHYDVMDNF
FT                   LIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPLFPKARRYECSLEAGDV
FT                   LFIPALWFHNVVSEEFGVGVNIFWKHLPSECYD"
FT   mRNA            complement(join(5656280..5656369,5658183..5658320,
FT                   5658418..5658527,5658880..5658924,5661560..5661629,
FT                   5666221..5666356,5671505..>5671595))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT189313"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT189313.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(5658284..5658320,5658880..5658924,
FT                   5661560..5661629,5666221..5666356,5671505..5671582))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_a"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT114995.1
FT                   protein_id=mCP74481.1 isoform=CRA_a"
FT                   /protein_id="EDL00049.1"
FT                   /translation="MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWT
FT                   VDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHL
FT                   EKTQGRMLQTSDSSSHH"
FT   CDS             complement(join(5658284..5658320,5658880..5658924,
FT                   5661560..5661629,5666221..5666356,5671505..5671582))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_a"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT172695.0
FT                   protein_id=mCP95613.0 isoform=CRA_a"
FT                   /protein_id="EDL00053.1"
FT                   /translation="MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWT
FT                   VDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHL
FT                   EKTQGRMLQTSDSSSHH"
FT   mRNA            complement(join(5658458..5658924,5661560..5661629,
FT                   5666221..5666356,5671505..5671842))
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, transcript variant
FT                   mCT172694"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT172694.0
FT                   created on 05-SEP-2002"
FT   CDS             complement(join(5658461..5658527,5658880..5658924,
FT                   5661560..5661629,5666221..5666356,5671505..>5671594))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_d"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT189313.0
FT                   protein_id=mCP110295.0 isoform=CRA_d"
FT                   /protein_id="EDL00052.1"
FT                   /translation="VNFTMAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCT
FT                   SKWTVDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTT
FT                   YGHLEKTQGSRKNSFTGKVGCCCWAFPIIGL"
FT   CDS             complement(join(5658876..5658924,5661560..5661629,
FT                   5666221..5666356,5671505..5671582))
FT                   /codon_start=1
FT                   /gene="1110034B05Rik"
FT                   /locus_tag="mCG_113906"
FT                   /product="RIKEN cDNA 1110034B05, isoform CRA_b"
FT                   /note="gene_id=mCG113906.1 transcript_id=mCT172694.0
FT                   protein_id=mCP95614.0 isoform=CRA_b"
FT                   /protein_id="EDL00050.1"
FT                   /translation="MAEQRLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWT
FT                   VDYLSQVGGTKEVKIHVAAVPQMDFIKLYLLTSWSREQPKKHIKNSSFQRMRNTTYGHL
FT                   EKTQGR"
FT   gap             5669248..5669267
FT                   /estimated_length=20
FT   gene            <5671665..5681082
FT                   /locus_tag="mCG_113908"
FT                   /note="gene_id=mCG113908.1"
FT   mRNA            join(<5671665..5672343,5675033..5675104,5676846..5676972,
FT                   5678363..5678510,5680780..5681082)
FT                   /locus_tag="mCG_113908"
FT                   /product="mCG113908"
FT                   /note="gene_id=mCG113908.1 transcript_id=mCT114997.0
FT                   created on 05-SEP-2002"
FT   CDS             join(<5671882..5672343,5675033..5675104,5676846..5676972,
FT                   5678363..5678510,5680780..5680858)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113908"
FT                   /product="mCG113908"
FT                   /note="gene_id=mCG113908.1 transcript_id=mCT114997.0
FT                   protein_id=mCP74495.0"
FT                   /protein_id="EDL00054.1"
FT                   /translation="KVTNMALAARLLPLPLLSRPLPGPVTRLRTLGSTEVRLTLTEICC
FT                   LCRRRLGSSAAPIPRYTRAWTSPALRSWSSRRSLLGRVEHPPALASLPASPSRSYSTEE
FT                   QPQQRQRTRMIILGFSNPINWVRTRIYAFLIWAYFDKEFSIAEFSEGAKQAFAYVSKLL
FT                   SQCKFDLLEELVAKEVLQILKEKVTSLSDNHKNALAADIDDIVYTSTGDISIYYDEKGR
FT                   KFVNILMCFWYLTSANIPSESLSGANVFQVKLGDQSVETKQLLSASYEFQREFTQGVKP
FT                   DWTIARIEHSKLLE"
FT   gap             5697663..5699250
FT                   /estimated_length=1588
FT   gap             5704438..5705666
FT                   /estimated_length=1229
FT   gap             5707180..5707550
FT                   /estimated_length=371
FT   gap             5712460..5712546
FT                   /estimated_length=87
FT   gap             5721311..5722018
FT                   /estimated_length=708
FT   gap             5723579..5725105
FT                   /estimated_length=1527
FT   gap             5740491..5740510
FT                   /estimated_length=20
FT   gap             5766056..5766241
FT                   /estimated_length=186
FT   gap             5767315..5769604
FT                   /estimated_length=2290
FT   gap             5774893..5774957
FT                   /estimated_length=65
FT   gene            complement(<5790102..5823358)
FT                   /locus_tag="mCG_1035639"
FT                   /note="gene_id=mCG1035639.1"
FT   mRNA            complement(join(<5790102..5790228,5790945..5791069,
FT                   5799287..5799370,5801764..5801987,5802430..5802629,
FT                   5806097..5806224,5822695..5823358))
FT                   /locus_tag="mCG_1035639"
FT                   /product="mCG1035639"
FT                   /note="gene_id=mCG1035639.1 transcript_id=mCT153343.1
FT                   created on 01-NOV-2002"
FT   CDS             complement(join(5790102..5790228,5790945..5791069,
FT                   5799287..5799370,5801764..5801987,5802430..5802629,
FT                   5806097..5806224))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035639"
FT                   /product="mCG1035639"
FT                   /note="gene_id=mCG1035639.1 transcript_id=mCT153343.1
FT                   protein_id=mCP74724.1"
FT                   /protein_id="EDL00055.1"
FT                   /translation="MDLTGNSVDDRLKDDGNPWHLSSSYLWGHLNLCSHGNESLSLWWM
FT                   NKAIAQRTLRQVSTTGNQKTRECLRNLSLNYTFANCQCAWPSPKCQQLKGDPSIIPFKN
FT                   QAESATRTSLFLWQPAHAKAEADDSGEEKYKEGNEACYSCFSCTNRGNRIVEPRGWSGI
FT                   YEATKSYAHLQRAIMESVLREVILNIFVKRLGLLGVEITSVLCALSACSAYLSSNAYYS
FT                   KVQSSWFPADSGQYFRADLVFTLFESPAEGLRPLGFNLDVPATSTNLTLPMAVFALSSQ
FT                   VLCPSHLSLTSAKS"
FT   gap             5806862..5807104
FT                   /estimated_length=243
FT   gap             5869017..5869036
FT                   /estimated_length=20
FT   gap             5898437..5898617
FT                   /estimated_length=181
FT   gap             5906095..5906234
FT                   /estimated_length=140
FT   gap             5926413..5926432
FT                   /estimated_length=20
FT   gap             5970124..5970597
FT                   /estimated_length=474
FT   gap             5977367..5977386
FT                   /estimated_length=20
FT   gap             5996529..5996596
FT                   /estimated_length=68
FT   gap             5997729..5997748
FT                   /estimated_length=20
FT   gene            6038486..6211157
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /note="gene_id=mCG117473.1"
FT   mRNA            join(6038486..6038729,6063547..6063584,6096326..6096426,
FT                   6119592..6119652,6143686..6143794,6146884..6146933,
FT                   6149881..6150127,6164812..6165018,6166267..6166402,
FT                   6187560..6187618,6202108..6202217,6204569..6204671,
FT                   6207217..6207437,6210261..6211156)
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, transcript variant
FT                   mCT118614"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT118614.1
FT                   created on 05-SEP-2002"
FT   mRNA            join(6038982..6039039,6063547..6063596,6096342..6096426,
FT                   6119592..6119652,6143686..6143794,6146884..6146933,
FT                   6149881..6150127,6166267..6166402,6187560..6187618,
FT                   6202108..6202217,6204569..6204671,6207217..6207437,
FT                   6210261..6211156)
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, transcript variant
FT                   mCT172703"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT172703.0
FT                   created on 05-SEP-2002"
FT   gap             6039112..6039245
FT                   /estimated_length=134
FT   mRNA            join(<6063545..6063596,6096342..6096426,6119592..6119652,
FT                   6143686..6143794,6146884..6146933,6149881..6150127,
FT                   6164812..6165018,6166267..6166402,6187560..6187618,
FT                   6202108..6202217,6204569..6204671,6207217..6207437,
FT                   6210261..6211157)
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, transcript variant
FT                   mCT189246"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT189246.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<6063545..6063596,6096342..6096426,6119592..6119652,
FT                   6143686..6143794,6146884..6146933,6149881..6150127,
FT                   6164812..6165018,6166267..6166402,6187560..6187618,
FT                   6202108..6202217,6204569..6204671,6207217..6207437,
FT                   6210261..6210656)
FT                   /codon_start=1
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, isoform CRA_c"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT189246.0
FT                   protein_id=mCP110251.0 isoform=CRA_c"
FT                   /protein_id="EDL00058.1"
FT                   /translation="RRLQNPGCFQEHLCGFPGPVVRAASPGLSRCNYMAGTQETGASAS
FT                   KAYTPRRKMAELNTHVNIKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQAFVDGS
FT                   AIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEVGPLQPQAPLVQNGHMNG
FT                   CEKDSSSPDSTREKLALTPREKKISILEEPPRAQRGVTEGGRLLQQKMSLDGNPRAIHG
FT                   PSERSDGPQWSAGQPCNPSKPKAKTSPVKSNAPAAHLEIKPDELAKKRGPNIEKSVKDL
FT                   QRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEEAMDILT
FT                   ARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCDIEQLKA
FT                   QILICGEITHPKNSYSSRTPCSSLLPLLNTHAVASGKQGNFARKSSGHNKPSEGKAANP
FT                   KMVSGLANTADACHQTMPTNKQQNGPSSQRRRFNPQYHNRLNGPAKSQGGGNEADPMAK
FT                   SNSRHEHRRQPHNGFRPKNKGGAKNQEAPLGTKAPEAPPHSEKARRRQHAADNLEARPF
FT                   RGNVSRVSQCNLCPSRIEVSTEATVLSVPAVTLVA"
FT   gap             6073743..6073762
FT                   /estimated_length=20
FT   CDS             join(6096389..6096426,6119592..6119652,6143686..6143794,
FT                   6146884..6146933,6149881..6150127,6166267..6166402,
FT                   6187560..6187618,6202108..6202217,6204569..6204671,
FT                   6207217..6207437,6210261..6210656)
FT                   /codon_start=1
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, isoform CRA_b"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT172703.0
FT                   protein_id=mCP95621.0 isoform=CRA_b"
FT                   /protein_id="EDL00057.1"
FT                   /translation="MAGTQETGASASKAYTPRRKMAELNTHVNIKEKIYAVRSVVPNKS
FT                   NNEIVLVLQQFDFNVDKAVQAFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDA
FT                   KDKVERPEVGPLQPQAPLVQNGHMNGCEKDSSSPDSTREKLALTPREKKISILEEPPRA
FT                   QRGVTGPNIEKSVKDLQRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSL
FT                   MAEMDKVKEEAMDILTARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEE
FT                   LGKAARFSCDIEQLKAQILICGEITHPKNSYSSRTPCSSLLPLLNTHAVASGKQGNFAR
FT                   KSSGHNKPSEGKAANPKMVSGLANTADACHQTMPTNKQQNGPSSQRRRFNPQYHNRLNG
FT                   PAKSQGGGNEADPMAKSNSRHEHRRQPHNGFRPKNKGGAKNQEAPLGTKAPEAPPHSEK
FT                   ARRRQHAADNLEARPFRGNVSRVSQCNLCPSRIEVSTEATVLSVPAVTLVA"
FT   gap             6099725..6100008
FT                   /estimated_length=284
FT   mRNA            join(6109843..6109955,6119592..6119652,6143686..6143794,
FT                   6146884..6146933,6149881..6150127,6164812..6165018,
FT                   6166267..6166402,6187560..6187618,6202108..6202217,
FT                   6204569..6204671,6207217..6207437,6210264..6211157)
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, transcript variant
FT                   mCT172702"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT172702.0
FT                   created on 05-SEP-2002"
FT   CDS             join(6119614..6119652,6143686..6143794,6146884..6146933,
FT                   6149881..6150127,6164812..6165018,6166267..6166402,
FT                   6187560..6187618,6202108..6202217,6204569..6204671,
FT                   6207217..6207437,6210261..6210656)
FT                   /codon_start=1
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, isoform CRA_d"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT118614.1
FT                   protein_id=mCP74446.1 isoform=CRA_d"
FT                   /protein_id="EDL00059.1"
FT                   /translation="MAELNTHVNIKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQ
FT                   AFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEVGPLQPQAPLVQ
FT                   NGHMNGCEKDSSSPDSTREKLALTPREKKISILEEPPRAQRGVTEGGRLLQQKMSLDGN
FT                   PRAIHGPSERSDGPQWSAGQPCNPSKPKAKTSPVKSNAPAAHLEIKPDELAKKRGPNIE
FT                   KSVKDLQRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEE
FT                   AMDILTARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCD
FT                   IEQLKAQILICGEITHPKNSYSSRTPCSSLLPLLNTHAVASGKQGNFARKSSGHNKPSE
FT                   GKAANPKMVSGLANTADACHQTMPTNKQQNGPSSQRRRFNPQYHNRLNGPAKSQGGGNE
FT                   ADPMAKSNSRHEHRRQPHNGFRPKNKGGAKNQEAPLGTKAPEAPPHSEKARRRQHAADN
FT                   LEARPFRGNVSRVSQCNLCPSRIEVSTEATVLSVPAVTLVA"
FT   CDS             join(6119614..6119652,6143686..6143794,6146884..6146933,
FT                   6149881..6150127,6164812..6165018,6166267..6166402,
FT                   6187560..6187618,6202108..6202217,6204569..6204671,
FT                   6207217..6207437,6210264..6210656)
FT                   /codon_start=1
FT                   /gene="2810022L02Rik"
FT                   /locus_tag="mCG_117473"
FT                   /product="RIKEN cDNA 2810022L02, isoform CRA_a"
FT                   /note="gene_id=mCG117473.1 transcript_id=mCT172702.0
FT                   protein_id=mCP95622.0 isoform=CRA_a"
FT                   /protein_id="EDL00056.1"
FT                   /translation="MAELNTHVNIKEKIYAVRSVVPNKSNNEIVLVLQQFDFNVDKAVQ
FT                   AFVDGSAIQVLKEWNMTGKKKNNKRKRSKSKQHQGNKDAKDKVERPEVGPLQPQAPLVQ
FT                   NGHMNGCEKDSSSPDSTREKLALTPREKKISILEEPPRAQRGVTEGGRLLQQKMSLDGN
FT                   PRAIHGPSERSDGPQWSAGQPCNPSKPKAKTSPVKSNAPAAHLEIKPDELAKKRGPNIE
FT                   KSVKDLQRCTVSLTRYRVMIKEEVDSSVKKIKAAFAELHNCIIDKEVSLMAEMDKVKEE
FT                   AMDILTARQKKAEELKRLTDLASQMAEMQLAELRAEIKHFVSERKYDEELGKAARFSCD
FT                   IEQLKAQILICGEITHPKNSYSSRTPCSSLLPLLNTHAVASGKQGNFARKSSGHNKPSE
FT                   GKAANPKMVSGLANTADACHQTMPTNKQNGPSSQRRRFNPQYHNRLNGPAKSQGGGNEA
FT                   DPMAKSNSRHEHRRQPHNGFRPKNKGGAKNQEAPLGTKAPEAPPHSEKARRRQHAADNL
FT                   EARPFRGNVSRVSQCNLCPSRIEVSTEATVLSVPAVTLVA"
FT   gap             6133396..6133415
FT                   /estimated_length=20
FT   gene            complement(6219453..>6283035)
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /note="gene_id=mCG117471.1"
FT   mRNA            complement(join(6219453..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229522..6229733,
FT                   6231690..6231916,6267031..6267085,6277671..6277744,
FT                   6279703..6283035))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT118612"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT118612.1
FT                   created on 11-APR-2003"
FT   mRNA            complement(join(6219453..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229522..6229733,
FT                   6231690..6231916,6234214..6234249))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT172699"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT172699.0
FT                   created on 11-APR-2003"
FT   mRNA            complement(join(6220265..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229544..6229733,
FT                   6231690..6231916,6267031..6267085,6277671..6277744,
FT                   6279703..>6283035))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT189244"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT189244.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6220521..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229522..6229733,
FT                   6231690..6231882))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_a"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT172699.0
FT                   protein_id=mCP95618.0 isoform=CRA_a"
FT                   /db_xref="GOA:E0CZ26"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="MGI:MGI:3603813"
FT                   /db_xref="UniProtKB/TrEMBL:E0CZ26"
FT                   /protein_id="EDL00060.1"
FT                   /translation="MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFK
FT                   DSMLASMFSGRFPLKTDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEAD
FT                   YFGIPYPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSG
FT                   ASCESRIIGVYATKTDGTDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMM
FT                   DAFDAWEGKGVSYWRVPHELIECWTLEERPLHGSLRHMAPIRKRRLIALREEDEGVNCK
FT                   TGPKPVRFLGPSTSTQIKVKNSASVRVSPANAAQISSQATANRSHRGSCGKAAQCSVAT
FT                   GASGHAPASPDAQSSENQATHPPPAKVLLSEKKSPPPRVIKLRRTPLRGGPSLPTASAG
FT                   GQACFPQPPSLEASSSLGVQMETRKDQPDG"
FT   CDS             complement(join(6220521..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229522..6229733,
FT                   6231690..6231882))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_a"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT118612.1
FT                   protein_id=mCP74859.1 isoform=CRA_a"
FT                   /db_xref="GOA:E0CZ26"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR003131"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="MGI:MGI:3603813"
FT                   /db_xref="UniProtKB/TrEMBL:E0CZ26"
FT                   /protein_id="EDL00063.1"
FT                   /translation="MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFK
FT                   DSMLASMFSGRFPLKTDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEAD
FT                   YFGIPYPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSG
FT                   ASCESRIIGVYATKTDGTDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMM
FT                   DAFDAWEGKGVSYWRVPHELIECWTLEERPLHGSLRHMAPIRKRRLIALREEDEGVNCK
FT                   TGPKPVRFLGPSTSTQIKVKNSASVRVSPANAAQISSQATANRSHRGSCGKAAQCSVAT
FT                   GASGHAPASPDAQSSENQATHPPPAKVLLSEKKSPPPRVIKLRRTPLRGGPSLPTASAG
FT                   GQACFPQPPSLEASSSLGVQMETRKDQPDG"
FT   CDS             complement(join(6220521..6221013,6223336..6223438,
FT                   6226094..6226188,6227261..6227454,6229544..>6229564))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_c"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT189244.0
FT                   protein_id=mCP110249.0 isoform=CRA_c"
FT                   /protein_id="EDL00062.1"
FT                   /translation="DGDIFFKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGV
FT                   YATKTDGTDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMMDAFDAWEGKG
FT                   VSYWRVPHELIECWTLEERPLHGSLRHMAPIRKRRLIALREEDEGVNCKTGPKPVRFLG
FT                   PSTSTQIKVKNSASVRVSPANAAQISSQATANRSHRGSCGKAAQCSVATGASGHAPASP
FT                   DAQSSENQATHPPPAKVLLSEKKSPPPRVIKLRRTPLRGGPSLPTASAGGQACFPQPPS
FT                   LEASSSLGVQMETRKDQPDG"
FT   mRNA            complement(join(6224247..6226188,6227261..6227454,
FT                   6229522..6229733,6231690..6231916,6234214..6234246))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT181812"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT181812.0
FT                   created on 11-APR-2003"
FT   CDS             complement(join(6226083..6226188,6227261..6227454,
FT                   6229522..6229733,6231690..6231882))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_d"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT181812.0
FT                   protein_id=mCP104734.0 isoform=CRA_d"
FT                   /protein_id="EDL00064.1"
FT                   /translation="MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFK
FT                   DSMLASMFSGRFPLKTDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEAD
FT                   YFGIPYPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSG
FT                   ASCESRIIGVYATKTDGTDAIDKQLGGRIHSKSIFKREAGNNVQYIWSYYSVAELKKMM
FT                   DAFDAWEGKGMG"
FT   mRNA            complement(join(6227757..6229733,6231690..6231916,
FT                   6234214..6234273))
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, transcript variant mCT181813"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT181813.0
FT                   created on 11-APR-2003"
FT   CDS             complement(join(6229453..6229733,6231690..6231882))
FT                   /codon_start=1
FT                   /gene="Kctd18"
FT                   /locus_tag="mCG_117471"
FT                   /product="potassium channel tetramerisation domain
FT                   containing 18, isoform CRA_b"
FT                   /note="gene_id=mCG117471.1 transcript_id=mCT181813.0
FT                   protein_id=mCP104735.0 isoform=CRA_b"
FT                   /protein_id="EDL00061.1"
FT                   /translation="MLKAELQASKGAMAGHEAEDVLDILRLNVGGCIYTARRESLCRFK
FT                   DSMLASMFSGRFPLKTDESGACIINRDGHLFKYILDYLHGEVQTPSDEQTRAALQEEAD
FT                   YFGIPYPYSLSDHLANEMETYSLRSNIELKKVLAFSQVSKYIFIMYKAICCFA"
FT   gene            6260188..>6279863
FT                   /locus_tag="mCG_117470"
FT                   /note="gene_id=mCG117470.1"
FT   mRNA            join(6260188..6260502,6262259..6262384,6264127..6264302,
FT                   6265382..6265459,6267058..6267143,6277584..6277819,
FT                   6279436..>6279863)
FT                   /locus_tag="mCG_117470"
FT                   /product="mCG117470"
FT                   /note="gene_id=mCG117470.1 transcript_id=mCT118611.1
FT                   created on 06-SEP-2002"
FT   gap             6260979..6261059
FT                   /estimated_length=81
FT   CDS             join(6262261..6262384,6264127..6264302,6265382..6265459,
FT                   6267058..6267143,6277584..6277819,6279436..>6279863)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117470"
FT                   /product="mCG117470"
FT                   /note="gene_id=mCG117470.1 transcript_id=mCT118611.1
FT                   protein_id=mCP74856.1"
FT                   /protein_id="EDL00065.1"
FT                   /translation="MEYPGIKVDTVTSGIQRRVKGRIAKTNLNVSLASKIKAKILNNSS
FT                   IFKISLKHNNRALARALSKEKENSRRITTEKMQLQKEVEKLNFENTFLRLKLNTLNKKL
FT                   VEIESHVSNDLLTAIEISSLSEFHQGSFLLSATKKQRNSKQCKPAHLPYARVLLTSEND
FT                   DDDGADDKWQTKCNNRTISKTSPDSTSSVSRQPSSLHQCNLKAFPPKEDNQKTCGSGHL
FT                   EHTSSVDILPNESHSDQSPKSSLSEMKTAPSPSLRREKLSHGNVTMRKKCVSSTPDILY
FT                   VTDLDHQPTSSPGSNWNNEIHGHTNETSNNTQRNAECFLDLPSESSSEPDAKRMELVQK
FT                   NTDSFHFQKTVYDAADMELTATDIGKIVAVSKSKKN"
FT   gap             6276117..6276136
FT                   /estimated_length=20
FT   gene            <6281004..6289975
FT                   /locus_tag="mCG_145852"
FT                   /note="gene_id=mCG145852.0"
FT   mRNA            join(<6281004..6282060,6283666..6283825,6288865..6289975)
FT                   /locus_tag="mCG_145852"
FT                   /product="mCG145852"
FT                   /note="gene_id=mCG145852.0 transcript_id=mCT185960.0
FT                   created on 03-JUL-2003"
FT   CDS             join(<6281004..6282060,6283666..6283825,6288865..6288868)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145852"
FT                   /product="mCG145852"
FT                   /note="gene_id=mCG145852.0 transcript_id=mCT185960.0
FT                   protein_id=mCP107692.0"
FT                   /protein_id="EDL00066.1"
FT                   /translation="KSEMLLGLKKHDPNMQPACQDDSKAGKKLRQKVNRKTEIISKITQ
FT                   IHENDRGSTHDSLNKKLCQKVNISKIISQMNQIYETINEDGNGFKSSIKDCEDIKSCDF
FT                   GEINSNKKENYDPIQDPCTLVKKTKRKGSCKAGSSLAGAKNRCGLQLTDSSQVQSVPLD
FT                   SGLRHHPNEADSGPGEQTNLPKMQKQSAGRSLGDAFSVSLGKEGSRPAKAVSKMTPKSK
FT                   KRKLPLGCSPETHGTVEITPNTDLAKAVDSQQTEKENYLEKEKIAKRKPDFCTKVLKPL
FT                   SETCSSNIKNSSLDSMCKSSLPLSISSRKTLMLEESSSLESTCIFQVGDAAHEKITTGT
FT                   RNPHHRTQKSTPGSRTSLVLVDTSSVSDTNPANPENESEGQSSHPMRRKRQCVPLNLTE
FT                   PSLRRQV"
FT   gene            6294046..6370613
FT                   /gene="Aox1"
FT                   /locus_tag="mCG_117465"
FT                   /note="gene_id=mCG117465.1"
FT   mRNA            join(6294046..6294135,6305482..6305539,6307588..6307684,
FT                   6311181..6311289,6313409..6313535,6317710..6317771,
FT                   6318694..6318783,6320260..6320340,6321460..6321604,
FT                   6322178..6322270,6323081..6323232,6323425..6323518,
FT                   6325242..6325351,6326178..6326362,6327418..6327580,
FT                   6329320..6329412,6332472..6332641,6332934..6333048,
FT                   6334243..6334365,6337380..6337476,6340266..6340390,
FT                   6341645..6341778,6342628..6342715,6345705..6345791,
FT                   6346214..6346405,6349637..6349864,6356697..6356792,
FT                   6358624..6358752,6359358..6359432,6361163..6361215,
FT                   6362069..6362183,6366788..6366853,6368522..6368710,
FT                   6369168..6369335,6370231..6370613)
FT                   /gene="Aox1"
FT                   /locus_tag="mCG_117465"
FT                   /product="aldehyde oxidase 1"
FT                   /note="gene_id=mCG117465.1 transcript_id=mCT118606.1
FT                   created on 12-JUL-2002"
FT   CDS             join(6294094..6294135,6305482..6305539,6307588..6307684,
FT                   6311181..6311289,6313409..6313535,6317710..6317771,
FT                   6318694..6318783,6320260..6320340,6321460..6321604,
FT                   6322178..6322270,6323081..6323232,6323425..6323518,
FT                   6325242..6325351,6326178..6326362,6327418..6327580,
FT                   6329320..6329412,6332472..6332641,6332934..6333048,
FT                   6334243..6334365,6337380..6337476,6340266..6340390,
FT                   6341645..6341778,6342628..6342715,6345705..6345791,
FT                   6346214..6346405,6349637..6349864,6356697..6356792,
FT                   6358624..6358752,6359358..6359432,6361163..6361215,
FT                   6362069..6362183,6366788..6366853,6368522..6368710,
FT                   6369168..6369335,6370231..6370281)
FT                   /codon_start=1
FT                   /gene="Aox1"
FT                   /locus_tag="mCG_117465"
FT                   /product="aldehyde oxidase 1"
FT                   /note="gene_id=mCG117465.1 transcript_id=mCT118606.1
FT                   protein_id=mCP74785.1"
FT                   /db_xref="GOA:G3X8P9"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014313"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016208"
FT                   /db_xref="InterPro:IPR022407"
FT                   /db_xref="MGI:MGI:88035"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8P9"
FT                   /protein_id="EDL00067.1"
FT                   /translation="MDPIQLLFYVNGQKVVEKNVDPEMMLLPYLRKNLRLTGTKYGCGG
FT                   GGCGACTVMISRYNPSTKAIRHHPVNACLTPICSLHGTAVTTVEGLGNTRTRLHPIQER
FT                   IAKCHGTQCGFCTPGMVMSMYALLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDACKTF
FT                   CKASGCCQSKENGVCCLDQEINGLAESQEEDKTSPELFSEEEFLPLDPTQELIFPPELM
FT                   RIAEKQPPKTRVFYGERVTWISPVTLKELVEAKFKYPQAPIVMGYTSVGPEVKFKGVFH
FT                   PIIISPDRIEELGVISQARDGLTLGAGLSLDQVKDILADIVQKLPEEKTQTYRALLKHL
FT                   RTLAGSQIRNMASLGGHIVSRHLDSDLNPLLAVGNCTLNLLSKDGERRIPLSEEFLRKC
FT                   PEADLKPQEVLVSVNIPWSRKWEFVSAFRQAQRQQNALAIVNSGMRVLFREGGGVIEEL
FT                   SILYGGVGSTIISAKNSCQRLIGRPWNEGMLDTACRLVLDEVTLAASAPGGKVEFKRTL
FT                   IISFLFKFYLEVSQGLKREDPGHSPSLAGNHESALDDLHSKHPWRTLTHQNVDPAQLPQ
FT                   DPIGRPIMHLSGIKHATGEAIYCDDMPAVDRELFLTFVTSSRAHAKIVSIDLSEALSLP
FT                   GVVDIITADHLQEANTFGTETFLATDEVHCVGHLVCAVIADSETRAKQAAKQVKVVYQD
FT                   LAPLILTIEEAIQHKSFFKSERKLECGNVDEAFKIVDQILEGEIHIGGQEHFYMETQSM
FT                   LVVPKGEDGEIDIYVSTQFPKYIQDIVAATLKLSANKVMCHVRRVGGAFGGKVGKTSIL
FT                   AAITAFAASKHGRAVRCILERGEDMLITGGRHPYLGKYKAGFMNDGRILALDVEHYCNG
FT                   GCSLDESLWVIEMGLLKLDNAYKFPNLRCRGWACRTNLPSNTALRGFGFPQAGLVTEAC
FT                   ITEVAIKCGLSPEQVRTINMYKHVDTTHYKQEFSAKALSECWRECMAKCSYFERKAAIG
FT                   KFNAENSWKKRGMAVIPLKFPVGIGSVAMGQAAALVHIYLDGSALVSHGGIEMGQGVHT
FT                   KMIQVVSRELRMPMSSVHLRGTSTETVPNTNASGGSVVADLNGLAVKDACQTLLKRLEP
FT                   IISKNPQGTWKDWAQTAFDQSISLSAVGYFRGYESNIDWEKGEGHPFEYFVFGAACSEV
FT                   EIDCLTGDHKNIRTNIVMDVGHSINPALDIGQVEGAFIQGMGLYTIEELSYSPQGTLYS
FT                   RGPNQYKIPAICDIPTEMHISFLPPSEHSNTLYSSKGLGESGVFLGCSVFFAIHDAVKA
FT                   ARQERGISGPWKLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNIPV"
FT   gap             6303977..6304093
FT                   /estimated_length=117
FT   gap             6331700..6331719
FT                   /estimated_length=20
FT   gap             6371158..6371272
FT                   /estimated_length=115
FT   gene            6377370..6465000
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /note="gene_id=mCG117463.1"
FT   mRNA            join(6377370..6377546,6379105..6379162,6382832..6382928,
FT                   6383715..6383823,6385212..6385338,6389252..6389313,
FT                   6391861..6391941,6402449..6402529,6405584..6405728,
FT                   6406526..6406618,6410280..6410431,6411050..6411143,
FT                   6414151..6414260,6416414..6416598,6416881..6417043,
FT                   6417340..6417432,6422320..6422489,6423024..6423138,
FT                   6423756..6423878,6427468..6427564,6429934..6430058,
FT                   6431700..6431833,6434081..6434168,6434960..6435046,
FT                   6436045..6436236,6436424..6436651,6440777..6440872,
FT                   6441822..6441950,6443620..6443694,6444909..6444961,
FT                   6447769..6447883,6450580..6450645,6452638..6452826,
FT                   6458929..6459096,6464473..6465000)
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /product="aldehyde oxidase 3, transcript variant mCT118604"
FT                   /note="gene_id=mCG117463.1 transcript_id=mCT118604.1
FT                   created on 12-JUL-2002"
FT   CDS             join(6377493..6377546,6379105..6379162,6382832..6382928,
FT                   6383715..6383823,6385212..6385338,6389252..6389313,
FT                   6391861..6391941,6402449..6402529,6405584..6405728,
FT                   6406526..6406618,6410280..6410431,6411050..6411143,
FT                   6414151..6414260,6416414..6416598,6416881..6417043,
FT                   6417340..6417432,6422320..6422489,6423024..6423138,
FT                   6423756..6423878,6427468..6427564,6429934..6430058,
FT                   6431700..6431833,6434081..6434168,6434960..6435046,
FT                   6436045..6436236,6436424..6436651,6440777..6440872,
FT                   6441822..6441950,6443620..6443694,6444909..6444961,
FT                   6447769..6447883,6450580..6450645,6452638..6452826,
FT                   6458929..6459096,6464473..6464526)
FT                   /codon_start=1
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /product="aldehyde oxidase 3, isoform CRA_a"
FT                   /note="gene_id=mCG117463.1 transcript_id=mCT118604.1
FT                   protein_id=mCP74731.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3X982"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR014313"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016208"
FT                   /db_xref="MGI:MGI:1918974"
FT                   /db_xref="PDB:3ZYV"
FT                   /db_xref="UniProtKB/Swiss-Prot:G3X982"
FT                   /protein_id="EDL00068.1"
FT                   /translation="MSPSKESDELIFFVNGKKVTERNADPEVNLLFYLRKVIRLTGTKY
FT                   GCGGGDCGACTVMISRYDPISKRISHFSATACLVPICSLHGAAVTTVEGIGSTKTRIHP
FT                   VQERIAKGHGTQCGFCTPGMVMSIYTLLRNHPEPSTEQIMETLGGNLCRCTGYRPIVES
FT                   AKSFCPSSTCCQMNGEGKCCLDEEKNEPERKNSVCTKLYEKKEFQPLDPTQELIFPPEL
FT                   MRMAEESQNTVLTFRGERTTWIAPGTLNDLLELKMKHPSAPLVIGNTYLGLHMKFTDVS
FT                   YPIIISPARILELFVVTNTKQGLTLGAGLSLTQVKNVLSDVVSRLPKEKTQIYCALLKQ
FT                   LKTLAGQQIRNVASLGGHIISRLPTSDLNPILGIGNCILNVASTEGIQQIPLNDHFLAG
FT                   VPDAILKPEQVLISVFVPRSSKWEFVSAFRQAPRQQNAFATVNAGMKVVFKEDTNTITD
FT                   LGILYGGIGATVISADKSCRQLIGRCWDEEMLDDAGKMICEEVSLLMAAPGGMEEYRKT
FT                   LAISFLFMFYLDVLKQLKTRDPHKYPDISQKLLHILEDFPLTMPYGMQSFQDVDFQQPL
FT                   QDPIGRPIMHQSGIKHATGEAVFCDDMSVLPGELFLAVVTSSKSHAKIISLDASEALAS
FT                   LGVVDVVTARDVPGDNGREEESLYAQDEVICVGQIVCAVAADSYAHAQQAAKKVKIVYQ
FT                   DIEPMIVTVQDALQYESFIGPERKLEQGNVEEAFQCADQILEGEVHLGGQEHFYMETQS
FT                   VRVVPKGEDKEMDIYVSSQDAAFTQEMVARTLGIPKNRINCHVKRVGGAFGGKASKPGL
FT                   LASVAAVAAQKTGRPIRFILERRDDMLITGGRHPLLGKYKIGFMNNGKIKAADIQLYIN
FT                   GGCTPDDSELVIEYALLKLENAYKIPNLRVRGRVCKTNLPSNTAFRGFGFPQGAFVTET
FT                   CMSAVAAKCRLPPEKVRELNMYRTIDRTIHNQEFDPTNLLQCWEACVENSSYYNRKKAV
FT                   DEFNQQRFWKKRGIAIIPMKFSVGFPKTFYYQAAALVQIYTDGSVLVAHGGVELGQGIN
FT                   TKMIQVASRELKIPMSYIHLDEMSTVTVPNTVTTGASTGADVNGRAVQNACQILMKRLE
FT                   PIIKQNPSGTWEEWVKEAFVQSISLSATGYFRGYQADMDWEKGEGDIFPYFVFGAACSE
FT                   VEIDCLTGAHKNIRTDIVMDGSFSINPAVDIGQIEGAFVQGLGLYTLEELKYSPEGVLY
FT                   TRGPHQYKIASVTDIPEEFHVSLLTPTPNPKAIYSSKGLGEAGTFLGCSVFFAIAAAVA
FT                   AAREERGLSPIWAINSPATAEVIRMACEDQFTNLVPQTDSKCCKPWSIPVA"
FT   mRNA            join(<6386475..6386579,6389252..6389313,6391861..6391941,
FT                   6402449..6402529,6405584..6405728,6406526..6406618,
FT                   6410280..6410431,6411050..6411143,6414151..6414260,
FT                   6416414..6416598,6416881..6417043,6417340..6417432,
FT                   6422320..6422489,6423024..6423138,6423756..6423878,
FT                   6427468..6427564,6429934..6430058,6431700..6431833,
FT                   6434081..6434168,6434960..6435046,6436045..6436236,
FT                   6436424..6436651,6440777..6440872,6441822..6441950,
FT                   6443620..6443694,6444909..6444961,6447769..6447883,
FT                   6450580..6450645,6452638..6452826,6458929..6459096,
FT                   6464473..6464598)
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /product="aldehyde oxidase 3, transcript variant mCT189277"
FT                   /note="gene_id=mCG117463.1 transcript_id=mCT189277.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<6386561..6386579,6389252..6389313,6391861..6391941,
FT                   6402449..6402529,6405584..6405728,6406526..6406618,
FT                   6410280..6410431,6411050..6411143,6414151..6414260,
FT                   6416414..6416598,6416881..6417043,6417340..6417432,
FT                   6422320..6422489,6423024..6423138,6423756..6423878,
FT                   6427468..6427564,6429934..6430058,6431700..6431833,
FT                   6434081..6434168,6434960..6435046,6436045..6436236,
FT                   6436424..6436651,6440777..6440872,6441822..6441950,
FT                   6443620..6443694,6444909..6444961,6447769..6447883,
FT                   6450580..6450645,6452638..6452826,6458929..6459096,
FT                   6464473..6464526)
FT                   /codon_start=1
FT                   /gene="Aox3"
FT                   /locus_tag="mCG_117463"
FT                   /product="aldehyde oxidase 3, isoform CRA_b"
FT                   /note="gene_id=mCG117463.1 transcript_id=mCT189277.0
FT                   protein_id=mCP110246.0 isoform=CRA_b"
FT                   /protein_id="EDL00069.1"
FT                   /translation="ADAELPGNLCRCTGYRPIVESAKSFCPSSTCCQMNGEGKCCLDEE
FT                   KNEPERKNSVCTKLYEKKEFQPLDPTQELIFPPELMRMAEESQNTVLTFRGERTTWIAP
FT                   GTLNDLLELKMKHPSAPLVIGNTYLGLHMKFTDVSYPIIISPARILELFVVTNTKQGLT
FT                   LGAGLSLTQVKNVLSDVVSRLPKEKTQIYCALLKQLKTLAGQQIRNVASLGGHIISRLP
FT                   TSDLNPILGIGNCILNVASTEGIQQIPLNDHFLAGVPDAILKPEQVLISVFVPRSSKWE
FT                   FVSAFRQAPRQQNAFATVNAGMKVVFKEDTNTITDLGILYGGIGATVISADKSCRQLIG
FT                   RCWDEEMLDDAGKMICEEVSLLMAAPGGMEEYRKTLAISFLFMFYLDVLKQLKTRDPHK
FT                   YPDISQKLLHILEDFPLTMPYGMQSFQDVDFQQPLQDPIGRPIMHQSGIKHATGEAVFC
FT                   DDMSVLPGELFLAVVTSSKSHAKIISLDASEALASLGVVDVVTARDVPGDNGREEESLY
FT                   AQDEVICVGQIVCAVAADSYAHAQQAAKKVKIVYQDIEPMIVTVQDALQYESFIGPERK
FT                   LEQGNVEEAFQCADQILEGEVHLGGQEHFYMETQSVRVVPKGEDKEMDIYVSSQDAAFT
FT                   QEMVARTLGIPKNRINCHVKRVGGAFGGKASKPGLLASVAAVAAQKTGRPIRFILERRD
FT                   DMLITGGRHPLLGKYKIGFMNNGKIKAADIQLYINGGCTPDDSELVIEYALLKLENAYK
FT                   IPNLRVRGRVCKTNLPSNTAFRGFGFPQGAFVTETCMSAVAAKCRLPPEKVRELNMYRT
FT                   IDRTIHNQEFDPTNLLQCWEACVENSSYYNRKKAVDEFNQQRFWKKRGIAIIPMKFSVG
FT                   FPKTFYYQAAALVQIYTDGSVLVAHGGVELGQGINTKMIQVASRELKIPMSYIHLDEMS
FT                   TVTVPNTVTTGASTGADVNGRAVQNACQILMKRLEPIIKQNPSGTWEEWVKEAFVQSIS
FT                   LSATGYFRGYQADMDWEKGEGDIFPYFVFGAACSEVEIDCLTGAHKNIRTDIVMDGSFS
FT                   INPAVDIGQIEGAFVQGLGLYTLEELKYSPEGVLYTRGPHQYKIASVTDIPEEFHVSLL
FT                   TPTPNPKAIYSSKGLGEAGTFLGCSVFFAIAAAVAAAREERGLSPIWAINSPATAEVIR
FT                   MACEDQFTNLVPQTDSKCCKPWSIPVA"
FT   gap             6406118..6406137
FT                   /estimated_length=20
FT   gap             6419000..6419019
FT                   /estimated_length=20
FT   gap             6429251..6429277
FT                   /estimated_length=27
FT   gap             6432566..6432585
FT                   /estimated_length=20
FT   gene            6474760..6532977
FT                   /gene="Aox4"
FT                   /locus_tag="mCG_117466"
FT                   /note="gene_id=mCG117466.1"
FT   mRNA            join(6474760..6474937,6477331..6477388,6481755..6481851,
FT                   6484299..6484407,6486140..6486266,6488478..6488539,
FT                   6492388..6492471,6493175..6493255,6495404..6495548,
FT                   6495780..6495872,6498137..6498288,6499407..6499500,
FT                   6500981..6501093,6503431..6503615,6504995..6505157,
FT                   6509374..6509466,6510115..6510284,6510553..6510667,
FT                   6511520..6511642,6513162..6513258,6514449..6514573,
FT                   6516379..6516512,6518558..6518735,6519879..6520106,
FT                   6521620..6521715,6523447..6523575,6526970..6527044,
FT                   6527726..6527778,6528217..6528331,6528725..6528790,
FT                   6529342..6529527,6531011..6531178,6532143..6532977)
FT                   /gene="Aox4"
FT                   /locus_tag="mCG_117466"
FT                   /product="aldehyde oxidase 4"
FT                   /note="gene_id=mCG117466.1 transcript_id=mCT118607.1
FT                   created on 12-JUL-2002"
FT   CDS             join(6474884..6474937,6477331..6477388,6481755..6481851,
FT                   6484299..6484407,6486140..6486266,6488478..6488539,
FT                   6492388..6492471,6493175..6493255,6495404..6495548,
FT                   6495780..6495872,6498137..6498288,6499407..6499500,
FT                   6500981..6501093,6503431..6503615,6504995..6505157,
FT                   6509374..6509466,6510115..6510284,6510553..6510667,
FT                   6511520..6511642,6513162..6513258,6514449..6514573,
FT                   6516379..6516512,6518558..6518735,6519879..6520106,
FT                   6521620..6521715,6523447..6523575,6526970..6527044,
FT                   6527726..6527778,6528217..6528331,6528725..6528790,
FT                   6529342..6529527,6531011..6531178,6532143..6532196)
FT                   /codon_start=1
FT                   /gene="Aox4"
FT                   /locus_tag="mCG_117466"
FT                   /product="aldehyde oxidase 4"
FT                   /note="gene_id=mCG117466.1 transcript_id=mCT118607.1
FT                   protein_id=mCP74816.1"
FT                   /protein_id="EDL00070.1"
FT                   /translation="MPSVSESDELIFFVNGKKVIEKNPDPEKNLLFYTRKVLNLTGTKY
FT                   SCGTGGCGACTVMVSRYNPKTRKIHHYPATACLVPICWLHGAAITTVEGVGSIKKRVHP
FT                   VQERLAKCHGTQCGFCSPGMVMSIYTLLRNHPEPTPDQITEALGGNLCRCTGYRPIVES
FT                   GKTFSQKSTVCQMKGSGKCCMDPDEKCLESREKKMCTKLYNEDEFQPFDPSQEPIFPPE
FT                   LIRMAEDPNKRRLTFQGKRTTWIIPVTLNDLLELKASYPEAPLVMGNTTVGPGIKFNDE
FT                   FYPVFISPLGVPELNLMDTTNNGVTIGAGYSLAQLKDTLDFLVSEQPKEKTKTFHALQK
FT                   HLRTLAGPQIRNMATLGGHTASRPNFSDLNPILAAGNATINVVSREGKDRQLPLNGPFL
FT                   EKLPEADLKPEEVILSIFIPYTAQWQFVSGLRLAQRQENAFAIVNAGMSVEFEEGTNTI
FT                   KDLKMFFGSVAPTVVSASQTCKQLIGRQWDDQMLSDACQLVLQEIRIPPDAEGGMVEYR
FT                   RTLIISLLFKFYLKVQRWLNEMDPQKFPDIPGKFVSALDDFPIETPQGIQMFQCVDPKQ
FT                   PQKDPVGHPIMHQSGIKHATGEAIFIDDMPPIDQELCLAVVTSTRAHAKITSLDVSEAL
FT                   ACPGVVDVITAEDVPGENDHNGEILYAQSEVICVGQIICTVAADTYIHAKEAAKRVKIA
FT                   YDDIEPTIITIEEALEHNSFLSPEKKIEQGNVDYAFKHVDQIVEGEIHVEGQEHFYMET
FT                   QTILAIPQTEDKEMVLHLGTQFPTHVQEFVSAALNVPRSRIACHMKRAGGAFGGKVTKP
FT                   ALLGAVCAVAANNVLKSENTYHIPNFRCRGRACKTNLPSNTAFRGFGFPQATVVVEAYI
FT                   AAVASKCNLLPEEVREINMYKKTSKTAYKQTFNPEPLRRCWKECLEKSSFFARKKAAEE
FT                   FNGNNYWKKRGLAVVPMKFSVAVPIAFYNQAAALVHIFLDGSVLLTHGGCELGQGLHTK
FT                   MIQVASRELNVPKSYVHFSETSTTTVPNSAFTAGSMGADINGKAVQNACQILMDRLRPI
FT                   IRKNPKGKWEEWIKMAFEESISLSATGYFKGYQTNMDWKKEEGDPYPYYVYGAACSEVE
FT                   VDCLTGAHKLLRTDIFVDAAFSINPALDIGQVEGAFIQGMGFYTTEELKYSPKGVLYSR
FT                   GPEDYKIPTITEIPEEFYVTLVHSRNPIAIYSSKGLGEAGMFLGSSVLFAIYDAVTTAR
FT                   KERGLSDIFPLNSPATPEVIRMACTDQFTEMIPRDDPSTFTPWSIHVS"
FT   gap             6500548..6500596
FT                   /estimated_length=49
FT   gap             6517215..6518557
FT                   /estimated_length=1343
FT   gene            6547080..6648449
FT                   /gene="Aox3l1"
FT                   /locus_tag="mCG_117469"
FT                   /note="gene_id=mCG117469.1"
FT   mRNA            join(6547080..6547171,6547896..6548004,6549979..6550105,
FT                   6552081..6552142,6556587..6556667,6558691..6558835,
FT                   6564143..6564294,6564995..6565088,6568768..6568877,
FT                   6569670..6569854,6570445..6570631,6574108..6574277,
FT                   6575230..6575344,6577524..6577646,6587955..6588051,
FT                   6599816..6599940,6601589..6601722,6603726..6603813,
FT                   6605852..6605938,6606697..6606888,6608822..6609049,
FT                   6613019..6613114,6615584..6615712,6619670..6619722,
FT                   6620588..6620702,6623743..6623931,6628351..6628518,
FT                   6645427..6645501,6647845..6648449)
FT                   /gene="Aox3l1"
FT                   /locus_tag="mCG_117469"
FT                   /product="aldehyde oxidase 3-like 1"
FT                   /note="gene_id=mCG117469.1 transcript_id=mCT118610.1
FT                   created on 23-SEP-2002"
FT   CDS             join(6547134..6547171,6547896..6548004,6549979..6550105,
FT                   6552081..6552142,6556587..6556667,6558691..6558835,
FT                   6564143..6564294,6564995..6565088,6568768..6568877,
FT                   6569670..6569854,6570445..6570631,6574108..6574277,
FT                   6575230..6575344,6577524..6577646,6587955..6588051,
FT                   6599816..6599940,6601589..6601722,6603726..6603813,
FT                   6605852..6605938,6606697..6606888,6608822..6609049,
FT                   6613019..6613114,6615584..6615712,6619670..6619722,
FT                   6620588..6620702,6623743..6623931,6628351..6628518,
FT                   6645427..6645480)
FT                   /codon_start=1
FT                   /gene="Aox3l1"
FT                   /locus_tag="mCG_117469"
FT                   /product="aldehyde oxidase 3-like 1"
FT                   /note="gene_id=mCG117469.1 transcript_id=mCT118610.1
FT                   protein_id=mCP74582.1"
FT                   /protein_id="EDL00071.1"
FT                   /translation="MVSQHDPVCKKTRHFSVMACLVPLCSLHGAAVTTVEGVGSIKTRL
FT                   HPVQERIAKSHGTQCGFCTPGMVMSIYTLLRNHPQPSEEQLMEALGGNLCRCTGYRPIL
FT                   ESGRTFCMICTKLFVKDEFQPLDPTQELIFPPELLRMAENPEKQTLTFYGERITWIAPG
FT                   TLQELLVLKAKYPEAPLISGNTALGLTIGACCSLAQVKDILAESISELPQEKTQTYRAL
FT                   LKHLRSLAGQQIRNMASLGGHVISRHCYSDLNPILSVGNTTLNLLSEEGPRQIPLSGHF
FT                   LAGLASADLKPEEILGSVYIPHSQKREFVSAFRQAQCHQNALPDVNAGMRVLFREGTDV
FT                   IEELSIAYGGVGPTTVSAQRSCQQLLGRRWNALMLDEACRLLLDEVSLPGSALGGKVEF
FT                   RRTLIVSLFFKFYLEVLQELKADQKLPPESTRVDSHQPLQDPVGRPIMHLSGLKHATGE
FT                   AVFCDDIPRVDKELFMALVTSTRAHARIISIDSSEVLDLPGVVDVITAEDIPGNNGEED
FT                   DKLLAVDKVLCVGQVICAVVAETDVQAKRATEKIKITYEDLKPVIFTIEDAIKHNSFLC
FT                   PEKKLEQGNIEEAFENVDQVAEGTVHVGGQEHFYMETQRVLVIPKTEDKELDMYVSTQD
FT                   PAHVQKTVSSTLNIPISRITCHVKRVGGGFGGKVGRPAVFGAIAAVGAVKTGHPIRLVL
FT                   DREDDMLITGGRHPLFAKYKVGFMNSGRIKALDIECYINGGCTLDDSELVTEFLVLKLE
FT                   NAYKIRNLRLRGRACMTNLPSNTAFRGFGFPQGALVTESCITAVAAKCGLPPEKIREKN
FT                   MYKTVDKTIYKQAFNPDPLIRCWNECLDKSSFHIRRTRVDEFNKKSYWKKRGIAIVPMK
FT                   FSVGFAATSYHQAAALVHIYTDGSVLVAHGGNELGQGIHTKMLQVASRELKIPLSYLHI
FT                   CETSTTTVPNTIATAASVGADVNGRAVQIEAAFEKRISLSATGYFRGYKAFMDWEKGEG
FT                   DPFPYYVYGAACSEVEIDCLTGAHKIEGAFIQGMGLYTTEELLYSPEGVLYSRSPDKYK
FT                   IPTVTDVPEQFNVSLLPSSQTPLTLYSSKGLGESGMFLGSSVFFAIVDAVAAARRQRDI
FT                   AEDFTVKSPATPEWVRMACADRFTDMIPRDDPKTFKPWSIPIA"
FT   gap             6550929..6550948
FT                   /estimated_length=20
FT   gap             6566333..6566352
FT                   /estimated_length=20
FT   gap             6584250..6586084
FT                   /estimated_length=1835
FT   gap             6586854..6587694
FT                   /estimated_length=841
FT   gap             6588886..6588905
FT                   /estimated_length=20
FT   gap             6590022..6590041
FT                   /estimated_length=20
FT   gap             6591080..6597884
FT                   /estimated_length=6805
FT   gap             6605473..6605597
FT                   /estimated_length=125
FT   gap             6618954..6619591
FT                   /estimated_length=638
FT   gap             6631017..6631528
FT                   /estimated_length=512
FT   gap             6633836..6633859
FT                   /estimated_length=24
FT   gap             6634945..6635567
FT                   /estimated_length=623
FT   gap             6647663..6647682
FT                   /estimated_length=20
FT   gap             6649320..6649937
FT                   /estimated_length=618
FT   gene            complement(6653771..>6661879)
FT                   /locus_tag="mCG_144886"
FT                   /note="gene_id=mCG144886.0"
FT   mRNA            complement(join(6653771..6655073,6657127..6657943,
FT                   6661552..>6661879))
FT                   /locus_tag="mCG_144886"
FT                   /product="mCG144886"
FT                   /note="gene_id=mCG144886.0 transcript_id=mCT184310.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(6654397..>6654837)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144886"
FT                   /product="mCG144886"
FT                   /note="gene_id=mCG144886.0 transcript_id=mCT184310.0
FT                   protein_id=mCP106116.0"
FT                   /protein_id="EDL00072.1"
FT                   /translation="PTERDAHEHTRSLQNSKKTGPEKKFFLSYNNQNTKCTKQRMLKAV
FT                   REKGQVIYKGRPIRILPDFSSETMKARRSWADVIQTLREHKCQPRLLYSAKVSITIDGK
FT                   NKIFHDKTKFTQYLSINPTLQRIKDGKHQHKEGKCTPEKARN"
FT   gap             6659831..6659982
FT                   /estimated_length=152
FT   gap             6662120..6662393
FT                   /estimated_length=274
FT   gene            6662929..6676090
FT                   /locus_tag="mCG_117467"
FT                   /note="gene_id=mCG117467.1"
FT   mRNA            join(6662929..6663003,6666412..6666588,6667738..6667832,
FT                   6668813..6668878,6669441..6669576,6669848..6669957,
FT                   6670075..6670245,6671621..6671767,6672349..6672487,
FT                   6672968..6673090,6673771..6676090)
FT                   /locus_tag="mCG_117467"
FT                   /product="mCG117467"
FT                   /note="gene_id=mCG117467.1 transcript_id=mCT118608.1
FT                   created on 12-JUL-2002"
FT   CDS             join(6662940..6663003,6666412..6666588,6667738..6667832,
FT                   6668813..6668878,6669441..6669576,6669848..6669957,
FT                   6670075..6670245,6671621..6671767,6672349..6672487,
FT                   6672968..6673090,6673771..6673802)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117467"
FT                   /product="mCG117467"
FT                   /note="gene_id=mCG117467.1 transcript_id=mCT118608.1
FT                   protein_id=mCP74852.1"
FT                   /protein_id="EDL00073.1"
FT                   /translation="MNNQKQQKPTLSGQRFKTRKRDEKERFDPTQFQDCIIQGLTETGT
FT                   DLEAVAKFLDASGAKLDYRRYAETLFDILVAGGMLAPGGTLADDMMRTDVCVFAAQEDL
FT                   ETMQAFAQVFNKLIRRYKYLEKGFEDEVKKLLLFLKGFSESERNKLAMLTGVLLANGTL
FT                   NASILNSLYNENLVKEGVSAAFAVKLFKSWINEKDINAVAASLRKVSMDNRLMELFPAN
FT                   KQSVEHFTKYFTEAGLKELSEYVRNQQTIGARKELQKELQEQMSRGDPFKDIILYVKEE
FT                   MKKNNIPEPVVIGIVWSSVMSTVEWNKKEELVAEQAIKHLKQYSPLLAAFTTQGQSELT
FT                   LLLKIQEYCYDNIHFMKAFQKIVVLFYKAEVLSEEPILKWYKDAHVAKGKSVFLEQMKK
FT                   FVEWLKNAEEESESEAEEGD"
FT   gap             6663580..6663825
FT                   /estimated_length=246
FT   gene            complement(6680736..6692710)
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /note="gene_id=mCG117461.1"
FT   mRNA            complement(join(6680736..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6685760..6685926,6686014..6686130,
FT                   6688411..6688477,6688872..6688962,6689835..6690060,
FT                   6690525..6690685,6692606..6692710))
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, transcript variant mCT118602"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT118602.1
FT                   created on 13-AUG-2002"
FT   mRNA            complement(join(6680740..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6686014..6686130,6688411..6688477,
FT                   6689835..6690060,6690525..6690685,6692606..6692710))
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, transcript variant mCT171970"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT171970.0
FT                   created on 13-AUG-2002"
FT   mRNA            complement(join(6680740..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6685760..6685926,6686014..6686130,
FT                   6688411..6688477,6689835..6690060,6690525..6690685,
FT                   6692606..6692710))
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, transcript variant mCT170541"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT170541.0
FT                   created on 13-AUG-2002"
FT   CDS             complement(join(6680941..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6685760..6685926,6686014..6686130,
FT                   6688411..6688477,6688872..6688962,6689835..6690060,
FT                   6690525..6690685))
FT                   /codon_start=1
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, isoform CRA_a"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT118602.1
FT                   protein_id=mCP74714.1 isoform=CRA_a"
FT                   /db_xref="GOA:P22518"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR002290"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="MGI:MGI:107403"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22518"
FT                   /protein_id="EDL00074.1"
FT                   /translation="MRHSKRTYCPDWDERDWDYGTWRSSSSHKRKKRSHSSAREQKRCR
FT                   YDHSKTTDSYYLESRSINEKAYHSRRYVDEYRNDYMGYEPGHPYGEPGSRYQMHSSKSS
FT                   GRSGRSSYKSKHRSRHHTSQHHSHGKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIV
FT                   DTLGEGAFGKVVECIDHKVGGRRVAVKIVKNVDRYCEAAQSEIQVLEHLNTTDPHSTFR
FT                   CVQMLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQICKSVNFLHSN
FT                   KLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDIKVVDFGSATYDDEHHSTLVS
FT                   TRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPK
FT                   HMIQKTRKRRYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLE
FT                   YDPAKRITLKEALKHPFFYPLKKHT"
FT   CDS             complement(join(6680941..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683428,6685760..6685913))
FT                   /codon_start=1
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, isoform CRA_b"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT170541.0
FT                   protein_id=mCP93459.0 isoform=CRA_b"
FT                   /protein_id="EDL00075.1"
FT                   /translation="MLEWFEHRGHICIVFELLGLSTYDFIKENSFLPFRMDHIRKMAYQ
FT                   ICKSVNFLHSNKLTHTDLKPENILFVKSDYTEAYNPKMKRDERTIVNPDIKVVDFGSAT
FT                   YDDEHHSTLVSTRHYRAPEVILALGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLA
FT                   MMERILGPLPKHMIQKTRKRRYFHHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHE
FT                   LLFDLIGKMLEYDPAKRITLKEALKHPFFYPLKKHT"
FT   CDS             complement(join(6680941..6681084,6681391..6681481,
FT                   6681691..6681770,6682134..6682216,6683116..6683245,
FT                   6683334..6683336))
FT                   /codon_start=1
FT                   /gene="Clk1"
FT                   /locus_tag="mCG_117461"
FT                   /product="CDC-like kinase 1, isoform CRA_c"
FT                   /note="gene_id=mCG117461.1 transcript_id=mCT171970.0
FT                   protein_id=mCP94889.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q3UKA7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="MGI:MGI:107403"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UKA7"
FT                   /protein_id="EDL00076.1"
FT                   /translation="MKRDERTIVNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILA
FT                   LGWSQPCDVWSIGCILIEYYLGFTVFPTHDSREHLAMMERILGPLPKHMIQKTRKRRYF
FT                   HHDRLDWDEHSSAGRYVSRRCKPLKEFMLSQDAEHELLFDLIGKMLEYDPAKRITLKEA
FT                   LKHPFFYPLKKHT"
FT   gap             6691063..6691082
FT                   /estimated_length=20
FT   gap             6693216..6693328
FT                   /estimated_length=113
FT   gene            complement(6699759..6714113)
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /note="gene_id=mCG117472.1"
FT   mRNA            complement(join(6699759..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713261,6713954..6714113))
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   transcript variant mCT118613"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT118613.1
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(6699760..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713261,6713768..>6714056))
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   transcript variant mCT189245"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT189245.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(6699762..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713261,6713433..6714051))
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   transcript variant mCT172701"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT172701.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(6699969..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..>6713252))
FT                   /codon_start=1
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT189245.0
FT                   protein_id=mCP110250.0 isoform=CRA_c"
FT                   /protein_id="EDL00080.1"
FT                   /translation="KIKQCFLEPSRRKMSVTLHTDVGDIKIEVFCERTPKTCENFLALC
FT                   ASNYYNGCVFHRNIKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMAN
FT                   NGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIK
FT                   DITIHANPFAQ"
FT   CDS             complement(join(6699969..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713213))
FT                   /codon_start=1
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT118613.1
FT                   protein_id=mCP74865.1 isoform=CRA_a"
FT                   /protein_id="EDL00077.1"
FT                   /translation="MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRN
FT                   IKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFIT
FT                   YGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ"
FT   CDS             complement(join(6699969..6700095,6703096..6703214,
FT                   6706986..6707053,6709486..6709579,6711167..6711241,
FT                   6713211..6713213))
FT                   /codon_start=1
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT172701.0
FT                   protein_id=mCP95620.0 isoform=CRA_a"
FT                   /protein_id="EDL00079.1"
FT                   /translation="MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRN
FT                   IKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFIT
FT                   YGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFAQ"
FT   mRNA            complement(join(6702552..6703214,6706986..6707053,
FT                   6709486..6709579,6711167..6711241,6713211..6713261,
FT                   6713768..6714090))
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   transcript variant mCT172700"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT172700.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(6703092..6703214,6706986..6707053,
FT                   6709486..6709579,6711167..6711241,6713211..6713213))
FT                   /codon_start=1
FT                   /gene="Ppil3"
FT                   /locus_tag="mCG_117472"
FT                   /product="peptidylprolyl isomerase (cyclophilin)-like 3,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG117472.1 transcript_id=mCT172700.0
FT                   protein_id=mCP95619.0 isoform=CRA_b"
FT                   /protein_id="EDL00078.1"
FT                   /translation="MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCVFHRN
FT                   IKGFMVQTGDPTGTGRGGSSIWAKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFIT
FT                   YGKQPHLDMKYTVFGK"
FT   gap             6704161..6704180
FT                   /estimated_length=20
FT   gene            6713773..6750462
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /note="gene_id=mCG117462.1"
FT   mRNA            join(6713773..6714257,6716257..6716712,6719010..6719172,
FT                   6720712..6720838,6724206..6724344,6726387..6726470,
FT                   6749634..6750462)
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   transcript variant mCT170703"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT170703.0
FT                   created on 15-JUL-2002"
FT   mRNA            join(6713773..6714257,6716257..6716712,6719010..6719172,
FT                   6720712..6720838,6724206..6724344,6726387..6726470,
FT                   6729749..6731147)
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   transcript variant mCT118603"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT118603.1
FT                   created on 15-JUL-2002"
FT   mRNA            join(<6713907..6714068,6719026..6719172,6720712..6720838,
FT                   6724206..>6724282)
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   transcript variant mCT170702"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT170702.0
FT                   created on 15-JUL-2002"
FT   CDS             join(<6713935..6714068,6719026..6719172,6720712..6720838,
FT                   6724206..>6724282)
FT                   /codon_start=1
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT170702.0
FT                   protein_id=mCP93621.0 isoform=CRA_a"
FT                   /protein_id="EDL00081.1"
FT                   /translation="DSEDHAPHPSAPESSTHNLTKKQNPLSPSNFIQRPGVGSRTHRTK
FT                   PIHPSRAPDYPTEGAHRLEFSVNRSQDLDKVMSTLRGVGGVSVTSFPARCDGEEQTRIS
FT                   LNCTQKTLMQVLAFLSQDRQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLAIMIER"
FT   CDS             join(6716280..6716712,6719010..6719172,6720712..6720838,
FT                   6724206..6724344,6726387..6726470,6749634..6749677)
FT                   /codon_start=1
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT170703.0
FT                   protein_id=mCP93620.0 isoform=CRA_c"
FT                   /db_xref="GOA:D3Z0G0"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR017222"
FT                   /db_xref="MGI:MGI:1929485"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z0G0"
FT                   /protein_id="EDL00083.1"
FT                   /translation="MLSSAHLVPTSVQRAQSWICRSSRSFMDLKALLSSLNDFASLSFA
FT                   ESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMDEALQKKADFILSYHPPIFRPMKHITW
FT                   KTWKECLVIRALENRVAVYSPHTAYDAAPQGVNSWLAKGLGTCTTRPIHPSRAPDYPTE
FT                   GAHRLEFSVNRSQDLDKVMSTLRGVGGVSVTSFPARCDGEEQTRISLNCTQKTLMQVLA
FT                   FLSQDRQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLAIMIERIKTHLKLSHLRLAL
FT                   GVGRTLESQVKVVALCAGSGGSVLQGVEADLYLTGSVSLETGAGRSLF"
FT   CDS             join(6716280..6716712,6719010..6719172,6720712..6720838,
FT                   6724206..6724344,6726387..6726470,6729749..6729933)
FT                   /codon_start=1
FT                   /gene="Nif3l1"
FT                   /locus_tag="mCG_117462"
FT                   /product="Ngg1 interacting factor 3-like 1 (S. pombe),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG117462.1 transcript_id=mCT118603.1
FT                   protein_id=mCP74722.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q9EQ80"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR017222"
FT                   /db_xref="MGI:MGI:1929485"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQ80"
FT                   /protein_id="EDL00082.1"
FT                   /translation="MLSSAHLVPTSVQRAQSWICRSSRSFMDLKALLSSLNDFASLSFA
FT                   ESWDNVGLLVEPSPPHTVNTLFLTNDLTEEVMDEALQKKADFILSYHPPIFRPMKHITW
FT                   KTWKECLVIRALENRVAVYSPHTAYDAAPQGVNSWLAKGLGTCTTRPIHPSRAPDYPTE
FT                   GAHRLEFSVNRSQDLDKVMSTLRGVGGVSVTSFPARCDGEEQTRISLNCTQKTLMQVLA
FT                   FLSQDRQLYQKTEILSLEKPLLLHTGMGRLCTLDESVSLAIMIERIKTHLKLSHLRLAL
FT                   GVGRTLESQVKVVALCAGSGGSVLQGVEADLYLTGEMSHHDVLDAASKGINVILCEHSN
FT                   TERGFLSELQEMLGVHFENKINIILSETDRDPLRVV"
FT   gene            complement(6731378..6773289)
FT                   /gene="Orc2l"
FT                   /locus_tag="mCG_117464"
FT                   /note="gene_id=mCG117464.1"
FT   mRNA            complement(join(6731378..6732898,6734603..6734721,
FT                   6736200..6736261,6738305..6738476,6739577..6739723,
FT                   6740937..6741033,6743457..6743589,6745082..6745191,
FT                   6748899..6748997,6749608..6749801,6752351..6752411,
FT                   6761403..6761434,6762207..6762296,6765704..6765793,
FT                   6768569..6768712,6769650..6769753,6770169..6770217,
FT                   6773111..6773289))
FT                   /gene="Orc2l"
FT                   /locus_tag="mCG_117464"
FT                   /product="origin recognition complex, subunit 2-like (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG117464.1 transcript_id=mCT118605.1
FT                   created on 15-JUL-2002"
FT   CDS             complement(join(6732812..6732898,6734603..6734721,
FT                   6736200..6736261,6738305..6738476,6739577..6739723,
FT                   6740937..6741033,6743457..6743589,6745082..6745191,
FT                   6748899..6748997,6749608..6749801,6752351..6752411,
FT                   6761403..6761434,6762207..6762296,6765704..6765793,
FT                   6768569..6768712,6769650..6769743))
FT                   /codon_start=1
FT                   /gene="Orc2l"
FT                   /locus_tag="mCG_117464"
FT                   /product="origin recognition complex, subunit 2-like (S.
FT                   cerevisiae)"
FT                   /note="gene_id=mCG117464.1 transcript_id=mCT118605.1
FT                   protein_id=mCP74768.1"
FT                   /db_xref="GOA:Q543F8"
FT                   /db_xref="InterPro:IPR007220"
FT                   /db_xref="MGI:MGI:1328306"
FT                   /db_xref="UniProtKB/TrEMBL:Q543F8"
FT                   /protein_id="EDL00084.1"
FT                   /translation="MSTLQLKETKVPSVQFVGDDDVLSHILDREGGTKLKKEKAQLLVN
FT                   PQKVIKKADCELEKSDLEVLEDQNYVKVLGRNIQESLGNGSAKDGRNKVYSFQQRKHPE
FT                   EMTKLALELAKTSGKKDPLDSNDPEITKNIAQKSKGHSTSEKAPLVNNNKTEFLSTQPH
FT                   NLRKRIIASRSHYDSESEYSASSSEDDEEATKDEEEDTNVARLSQKSQGQNRLLPAPVS
FT                   KETLPKKKKRDKASDLVEEYFEAHSSSKVLTSDRTLQRLRRARVDQKTLHNLLRKFVPS
FT                   FSAEIERLNQQHEKLFHKWMLQLHLGFNIVLYGLGSKRDLLEKFRTTMLQDSIHVVING
FT                   YFPGVSVKSILNSITEDVLSHVGTFQSVLDQRDWIINRFKEDSSLELFLLIHNLDSQML
FT                   RGDNSQQILGQLSSLHNVYLIASIDHLNAPLMWDHAKQSLYNWLWYETTTYSPYTEETS
FT                   YENSLLVKQSGSLPLSSLIHVLRSLTPNARGIFRLLMKFQLDNQDSPSYIGLSFQDFYQ
FT                   QCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDSGILADFLEKEEEEA
FT                   "
FT   gap             6735402..6735490
FT                   /estimated_length=89
FT   gap             6737292..6737535
FT                   /estimated_length=244
FT   gap             6751100..6751293
FT                   /estimated_length=194
FT   gap             6757634..6757738
FT                   /estimated_length=105
FT   gene            <6773492..6791569
FT                   /locus_tag="mCG_144897"
FT                   /note="gene_id=mCG144897.0"
FT   mRNA            join(<6773492..6773570,6778910..6780605,6784051..6784116,
FT                   6785402..6785508,6785964..6786104,6788774..6789087,
FT                   6791358..6791569)
FT                   /locus_tag="mCG_144897"
FT                   /product="mCG144897"
FT                   /note="gene_id=mCG144897.0 transcript_id=mCT184321.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<6786101..6786104,6788774..6789087,6791358..6791501)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144897"
FT                   /product="mCG144897"
FT                   /note="gene_id=mCG144897.0 transcript_id=mCT184321.0
FT                   protein_id=mCP106126.0"
FT                   /protein_id="EDL00085.1"
FT                   /translation="TGHKRNTSETELEASPLLPSFYRPGRCYTGCWGELSPTDAIGFSM
FT                   LLSWPGWHTSCGYWCNSGMTDTEVTNNFLMVFVPVPWKKTHILTVNLVKSLWLERFAGL
FT                   CEIFTSSTVTHFTFQQSTASIHSIRQDNGSHAPVHKILNVHFGFFFLQL"
FT   gene            complement(6795593..6856254)
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /note="gene_id=mCG117468.1"
FT   mRNA            complement(join(6795593..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825564..6825686,6826290..6826370,6834166..6834263,
FT                   6856168..6856254))
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, transcript variant
FT                   mCT118609"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT118609.1
FT                   created on 23-SEP-2002"
FT   mRNA            complement(join(6795597..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825585..6825686,6826290..6826370,6834166..6834263,
FT                   6856168..>6856225))
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, transcript variant
FT                   mCT189283"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT189283.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(6797422..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825585..6825686,6826290..6826370,6834166..6834263,
FT                   6856063..>6856111))
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, transcript variant
FT                   mCT189284"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT189284.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6797997..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825585..6825686,6826290..>6826346))
FT                   /codon_start=1
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, isoform CRA_b"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT189283.0
FT                   protein_id=mCP110247.0 isoform=CRA_b"
FT                   /protein_id="EDL00087.1"
FT                   /translation="RKMLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYK
FT                   VIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRLTVSRDRQSNGCIE
FT                   ALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVV
FT                   YSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHE
FT                   KQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVA
FT                   NAMKNSLPFDAPDSSQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGLNGG
FT                   EESLNMNDADEGFSSGASLSSQPHGTKPPSSSQRGSLRKVATGRSAKDKETALAIKSNE
FT                   SPRDSVVGKQFVQQQADLSIDSVELTPMKKHLSLPAGQVVPKTNSLSLIRTASASSSKS
FT                   FDYVNGGQASTSIGVGTEGVTNLAATNANRYSTISLQEDRLGHAGEGKELLSPGAPLTK
FT                   QSRSPSFNMQLISQV"
FT   CDS             complement(join(6797997..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825585..6825686,6826290..>6826346))
FT                   /codon_start=1
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, isoform CRA_b"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT189284.0
FT                   protein_id=mCP110248.0 isoform=CRA_b"
FT                   /protein_id="EDL00088.1"
FT                   /translation="RKMLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYK
FT                   VIQDSNNELLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRLTVSRDRQSNGCIE
FT                   ALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHDLIRVV
FT                   YSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGFPRQHE
FT                   KQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQPLLVA
FT                   NAMKNSLPFDAPDSSQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAEGLNGG
FT                   EESLNMNDADEGFSSGASLSSQPHGTKPPSSSQRGSLRKVATGRSAKDKETALAIKSNE
FT                   SPRDSVVGKQFVQQQADLSIDSVELTPMKKHLSLPAGQVVPKTNSLSLIRTASASSSKS
FT                   FDYVNGGQASTSIGVGTEGVTNLAATNANRYSTISLQEDRLGHAGEGKELLSPGAPLTK
FT                   QSRSPSFNMQLISQV"
FT   CDS             complement(join(6797997..6798598,6803729..6803888,
FT                   6807870..6807957,6808445..6808561,6812978..6813073,
FT                   6814418..6814533,6816952..6817032,6820463..6820642,
FT                   6825564..6825686,6826290..6826340))
FT                   /codon_start=1
FT                   /gene="BC049806"
FT                   /locus_tag="mCG_117468"
FT                   /product="cDNA sequence BC049806, isoform CRA_a"
FT                   /note="gene_id=mCG117468.1 transcript_id=mCT118609.1
FT                   protein_id=mCP74862.1 isoform=CRA_a"
FT                   /protein_id="EDL00086.1"
FT                   /translation="MLGSERAVVEEWLSEFKALPDTQITSYAATLHRKKALVPALYKVI
FT                   QDSNNEVGKLIRKLLEPVCHQLFELYRSSEVRLKRFTLQFLPELIWVYLRLTVSRDRQS
FT                   NGCIEALLLGIYNLEIADKDGNNKVLSFTIPSLSKPSIYHEPSTIGSMALTEGALCQHD
FT                   LIRVVYSDLHPQRETFTAQNRFEVLSFLMLCYNSAIVYMPASSYQSLCRMGSRVCVSGF
FT                   PRQHEKQWKELCGRIVLDPEFMVQLLTGVYYAMYNGQWDLGQEVLDDIIYRAQLELFSQ
FT                   PLLVANAMKNSLPFDAPDSSQEGQKVLKVEVTPTVPRISRTAITTASIRRHRWRREGAE
FT                   GLNGGEESLNMNDADEGFSSGASLSSQPHGTKPPSSSQRGSLRKVATGRSAKDKETALA
FT                   IKSNESPRDSVVGKQFVQQQADLSIDSVELTPMKKHLSLPAGQVVPKTNSLSLIRTASA
FT                   SSSKSFDYVNGGQASTSIGVGTEGVTNLAATNANRYSTISLQEDRLGHAGEGKELLSPG
FT                   APLTKQSRSPSFNMQLISQV"
FT   gap             6845421..6845440
FT                   /estimated_length=20
FT   gap             6846598..6846812
FT                   /estimated_length=215
FT   gap             6854099..6854121
FT                   /estimated_length=23
FT   gene            6856367..6865863
FT                   /locus_tag="mCG_117842"
FT                   /note="gene_id=mCG117842.1"
FT   mRNA            join(6856367..6856632,6861060..6861219,6865564..6865863)
FT                   /locus_tag="mCG_117842"
FT                   /product="mCG117842"
FT                   /note="gene_id=mCG117842.1 transcript_id=mCT118988.1
FT                   created on 15-JUL-2002"
FT   CDS             join(6861062..6861219,6865564..6865720)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117842"
FT                   /product="mCG117842"
FT                   /note="gene_id=mCG117842.1 transcript_id=mCT118988.1
FT                   protein_id=mCP74698.1"
FT                   /protein_id="EDL00089.1"
FT                   /translation="MAAGHGHEHGHEHGHGHGKMELPDYRQWKIEGTPLETVQKKLAAR
FT                   GLRDPWARNEAWRYMGGFAGNITFPSVILKGFKWGFAAFVVALGAEYFLDSQNGDKKHH
FT                   "
FT   gap             6864031..6864050
FT                   /estimated_length=20
FT   gap             6869690..6869709
FT                   /estimated_length=20
FT   gap             6900325..6900344
FT                   /estimated_length=20
FT   gap             6908312..6908382
FT                   /estimated_length=71
FT   gene            6915993..6917654
FT                   /locus_tag="mCG_117845"
FT                   /note="gene_id=mCG117845.1"
FT   mRNA            6915993..6917654
FT                   /locus_tag="mCG_117845"
FT                   /product="mCG117845"
FT                   /note="gene_id=mCG117845.1 transcript_id=mCT118991.1
FT                   created on 15-JUL-2002"
FT   CDS             6916058..6916579
FT                   /codon_start=1
FT                   /locus_tag="mCG_117845"
FT                   /product="mCG117845"
FT                   /note="gene_id=mCG117845.1 transcript_id=mCT118991.1
FT                   protein_id=mCP74703.0"
FT                   /protein_id="EDL00090.1"
FT                   /translation="MGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFT
FT                   DADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKP
FT                   RGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLT
FT                   WHSCPEDEAQ"
FT   gap             6918497..6918516
FT                   /estimated_length=20
FT   gene            <6921886..6924891
FT                   /locus_tag="mCG_1035646"
FT                   /note="gene_id=mCG1035646.1"
FT   mRNA            join(<6921886..6922026,6924282..6924891)
FT                   /locus_tag="mCG_1035646"
FT                   /product="mCG1035646"
FT                   /note="gene_id=mCG1035646.1 transcript_id=mCT153350.1
FT                   created on 08-NOV-2002"
FT   CDS             join(6921886..6922026,6924282..6924290)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035646"
FT                   /product="mCG1035646"
FT                   /note="gene_id=mCG1035646.1 transcript_id=mCT153350.1
FT                   protein_id=mCP74506.1"
FT                   /protein_id="EDL00091.1"
FT                   /translation="MPARAQRCCACCHVCFRFLGVSILGSLRHAAKSLRPEPLKRPLRG
FT                   RQRR"
FT   gene            complement(6927453..6965341)
FT                   /locus_tag="mCG_117851"
FT                   /note="gene_id=mCG117851.1"
FT   mRNA            complement(join(6927453..6927767,6928333..6928442,
FT                   6928560..6928649,6936161..6936265,6937064..6937163,
FT                   6938763..6938815,6945908..6945969,6947665..6947758,
FT                   6949243..6949376,6960292..6960337,6961084..6961161,
FT                   6961680..6961824,6965281..6965336))
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, transcript variant mCT118997"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT118997.1
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(6927458..6927767,6928333..6928442,
FT                   6928560..6928649,6930735..6930797,6936162..6936265,
FT                   6937064..6937163,6938763..6938815,6939705..6939802,
FT                   6945908..6945969,6947665..6947758,6949243..6949376,
FT                   6960292..6960337,6961084..6961161,6961680..6961824,
FT                   6965281..>6965336))
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, transcript variant mCT189250"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT189250.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(6927761..6927767,6928333..6928442,
FT                   6928560..6928649,6930735..6930797,6936162..6936265,
FT                   6937064..6937163,6938763..6938815,6939705..6939802,
FT                   6945908..6945969,6947665..6947758,6949243..6949376,
FT                   6960292..6960337,6961084..6961161,6961680..6961824,
FT                   6965281..>6965314))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, isoform CRA_c"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT189250.0
FT                   protein_id=mCP110257.0 isoform=CRA_c"
FT                   /protein_id="EDL00094.1"
FT                   /translation="LEGEFLLKGLSGAPGLARLPCTMDPNPFIYCTCCDCCKLGQPKLI
FT                   KTPYPLPKHPTGKFKPVLPPPISKEHNSLLSQPGKSTVSPRDKVQSGNTESSKAPSEVI
FT                   QVSPGYTLIRNREQISVTLGDEMFNRKKHLESDVLSKVKFSRTDIISDLQEQIAELMAI
FT                   IEQMNRDQQSALKLLSKDLDLRCSNMKQKFETESRELKETHREELERLENNYKEALKAE
FT                   KALAEEKLDKMSKEYKYLKSMFHVFQDSIYEEMEDKWLRRKAEWEKDEKMEREKILLQQ
FT                   KCRIIKKFELQSEEKKKKMNESISAVSDNFAREKEELLRQHDEDILQIQELRKSKEILE
FT                   AELRAQATVLETLNTNLFQCQKELERQKTIAANLEKLFQTKLAEAEEKHKYNIKTPTEE
FT                   NNCLRC"
FT   mRNA            complement(join(6936230..6936265,6937064..6937163,
FT                   6938763..6939802,6945908..6945969,6947665..6947758,
FT                   6949243..6949376,6960292..6960337,6961084..6961161,
FT                   6961680..6961824,6965096..6965341))
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, transcript variant mCT172710"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT172710.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(6938812..6938815,6945908..6945969,
FT                   6947665..6947758,6949243..6949376,6960292..6960337,
FT                   6961084..6961161,6961680..6961792))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, isoform CRA_a"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT118997.1
FT                   protein_id=mCP74489.1 isoform=CRA_a"
FT                   /protein_id="EDL00092.1"
FT                   /translation="MDPNPFIYCTCCDCCKLGQPKLIKTPYPLPKHPTGKFKPVLPPPI
FT                   SKEHNSLLSQPGKSTVSPRDKVQSGNTESSKAPSEVIQVSPGYTLIRNREQISVTLGDE
FT                   MFNRKKHLESDVLSKVKFSRTDIISDLQEQIAELMAIIEQMNRDQQSALKLLSKDLDLR
FT                   CSNMKQKFETESR"
FT   CDS             complement(join(6939592..6939802,6945908..6945969,
FT                   6947665..6947758,6949243..6949376,6960292..6960337,
FT                   6961084..6961161,6961680..6961792))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117851"
FT                   /product="mCG117851, isoform CRA_b"
FT                   /note="gene_id=mCG117851.1 transcript_id=mCT172710.0
FT                   protein_id=mCP95629.0 isoform=CRA_b"
FT                   /protein_id="EDL00093.1"
FT                   /translation="MDPNPFIYCTCCDCCKLGQPKLIKTPYPLPKHPTGKFKPVLPPPI
FT                   SKEHNSLLSQPGKSTVSPRDKVQSGNTESSKAPSEVIQVSPGYTLIRNREQISVTLGDE
FT                   MFNRKKHLESDVLSKVKFSRTDIISDLQEQIAELMAIIEQMNRDQQSALKLLSKDLDLR
FT                   CSNMKQKFETESRELKETHREELERLENNYKEALKAEKALAEEKLGTVGPWGDAGRKVD
FT                   SLPWHPYSHGLAQPDVQHFPSEA"
FT   gap             6945512..6945576
FT                   /estimated_length=65
FT   gap             6966165..6966231
FT                   /estimated_length=67
FT   gene            6980846..7024600
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /note="gene_id=mCG117843.2"
FT   mRNA            join(6980846..6980922,6982910..6982998,6995749..6996175,
FT                   6998499..6998604,7000595..7000730,7001696..7002669)
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator,
FT                   transcript variant mCT170704"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT170704.0
FT                   created on 15-JUL-2002"
FT   mRNA            join(6980883..6980922,6995749..6996175,6998499..6998604,
FT                   7000595..7000730,7001696..7001769,7005101..7005155,
FT                   7009706..7009755,7010408..7010489,7021785..7022292,
FT                   7023230..7024590)
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator,
FT                   transcript variant mCT118989"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT118989.1
FT                   created on 15-JUL-2002"
FT   gap             6982279..6982506
FT                   /estimated_length=228
FT   mRNA            join(<6982656..6982998,6995749..6996175,6998499..6998604,
FT                   7000595..7000730,7001696..7001769,7005101..7005155,
FT                   7009706..7009755,7010408..7010489,7021785..7022292,
FT                   7023230..7024600)
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator,
FT                   transcript variant mCT189293"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT189293.0
FT                   created on 08-MAR-2004"
FT   gap             6993937..6994021
FT                   /estimated_length=85
FT   CDS             join(<6995802..6996175,6998499..6998604,7000595..7000730,
FT                   7001696..7001769,7005101..7005155,7009706..7009755,
FT                   7010408..7010489,7021785..7022292,7023230..7023368)
FT                   /codon_start=1
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT189293.0
FT                   protein_id=mCP110252.0 isoform=CRA_c"
FT                   /protein_id="EDL00097.1"
FT                   /translation="CWLLVVPRALLNGWRLDENLAAVVLNMAQSPVSAEVIHQVEECLD
FT                   EDEKEMMLFLCRDVTENLAAPNVRDLLDSLSERGQLSFATLAELLYRVRRFDLLKRILK
FT                   TDKATVEDHLRRNPHLVSDYRVLLMEIGESLDQNDVSSLVFLTRDYTGRGKIAKDKSFL
FT                   DLVIELEKLNLIASDQLNLLEKCLKNIHRIDLNTKIQKYTQSSQGARSNMNTLQASLPK
FT                   LSIKYNSRLQNGRSKEPRFVEYRDSQRTLVKTSIQESGAFLPPHIREETYRMQSKPLGI
FT                   CLIIDCIGNDTKYLQETFTSLGYHIQLFLFPKSHDITQIVRRYASMAQHQDYDSFACVL
FT                   VSLGGSQSMMGRDQVHSGFSLDHVKNMFTGDTCPSLRGKPKLFFIQNYESLGSQLEDSS
FT                   LEVDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADVSHLEKPSSSSSVYLQKLSQQL
FT                   KQGRRRPLVDLHVELMDKVYAWNSGVSSKEKYSLSLQHTLRKKLILAPT"
FT   CDS             join(6995880..6996175,6998499..6998604,7000595..7000730,
FT                   7001696..7001769,7005101..7005155,7009706..7009755,
FT                   7010408..7010489,7021785..7022292,7023230..7023368)
FT                   /codon_start=1
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT118989.1
FT                   protein_id=mCP74701.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q812G4"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001875"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="MGI:MGI:1336166"
FT                   /db_xref="UniProtKB/TrEMBL:Q812G4"
FT                   /protein_id="EDL00095.1"
FT                   /translation="MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDL
FT                   LDSLSERGQLSFATLAELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLME
FT                   IGESLDQNDVSSLVFLTRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKN
FT                   IHRIDLNTKIQKYTQSSQGARSNMNTLQASLPKLSIKYNSRLQNGRSKEPRFVEYRDSQ
FT                   RTLVKTSIQESGAFLPPHIREETYRMQSKPLGICLIIDCIGNDTKYLQETFTSLGYHIQ
FT                   LFLFPKSHDITQIVRRYASMAQHQDYDSFACVLVSLGGSQSMMGRDQVHSGFSLDHVKN
FT                   MFTGDTCPSLRGKPKLFFIQNYESLGSQLEDSSLEVDGPSIKNVDSKPLQPRHCTTHPE
FT                   ADIFWSLCTADVSHLEKPSSSSSVYLQKLSQQLKQGRRRPLVDLHVELMDKVYAWNSGV
FT                   SSKEKYSLSLQHTLRKKLILAPT"
FT   CDS             join(6995880..6996175,6998499..6998604,7000595..7000730,
FT                   7001696..7001805)
FT                   /codon_start=1
FT                   /gene="Cflar"
FT                   /locus_tag="mCG_117843"
FT                   /product="CASP8 and FADD-like apoptosis regulator, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG117843.2 transcript_id=mCT170704.0
FT                   protein_id=mCP93622.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q5U4G3"
FT                   /db_xref="InterPro:IPR001875"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="MGI:MGI:1336166"
FT                   /db_xref="UniProtKB/TrEMBL:Q5U4G3"
FT                   /protein_id="EDL00096.1"
FT                   /translation="MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDL
FT                   LDSLSERGQLSFATLAELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLME
FT                   IGESLDQNDVSSLVFLTRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKN
FT                   IHRIDLNTKIQKYTQSSQGARSNMNTLQASLPKLSIKYNSRVSLEPVYGVPA"
FT   gene            7026304..7028306
FT                   /locus_tag="mCG_146943"
FT                   /note="gene_id=mCG146943.0"
FT   mRNA            7026304..7028306
FT                   /locus_tag="mCG_146943"
FT                   /product="mCG146943"
FT                   /note="gene_id=mCG146943.0 transcript_id=mCT187206.0
FT                   created on 13-JAN-2004"
FT   CDS             7026587..7026709
FT                   /codon_start=1
FT                   /locus_tag="mCG_146943"
FT                   /product="mCG146943"
FT                   /note="gene_id=mCG146943.0 transcript_id=mCT187206.0
FT                   protein_id=mCP109542.0"
FT                   /protein_id="EDL00098.1"
FT                   /translation="MAQWVRAPDCSSKGPEFKSQQPHGGSQPSVTRSDSLFWSV"
FT   gap             7036818..7036837
FT                   /estimated_length=20
FT   gap             7041243..7041268
FT                   /estimated_length=26
FT   gap             7046344..7046363
FT                   /estimated_length=20
FT   gene            7064821..7116397
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /note="gene_id=mCG117855.1"
FT   mRNA            join(7064821..7065133,7091232..7091347,7093300..7093632,
FT                   7096592..7096697,7098258..7098396,7098481..7098534,
FT                   7100991..7101052,7103018..7103159,7113729..7114230,
FT                   7116007..7116397)
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /product="caspase 8, transcript variant mCT173675"
FT                   /note="gene_id=mCG117855.1 transcript_id=mCT173675.0
FT                   created on 23-SEP-2002"
FT   mRNA            join(7064821..7065133,7093300..7093632,7096592..7096697,
FT                   7098258..7098396,7098481..7098534,7100991..7101052,
FT                   7103018..7103159,7113729..7114230,7116007..7116397)
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /product="caspase 8, transcript variant mCT119001"
FT                   /note="gene_id=mCG117855.1 transcript_id=mCT119001.1
FT                   created on 23-SEP-2002"
FT   gap             7065665..7065841
FT                   /estimated_length=177
FT   gene            <7067270..7071110
FT                   /locus_tag="mCG_146949"
FT                   /note="gene_id=mCG146949.0"
FT   mRNA            <7067270..7071110
FT                   /locus_tag="mCG_146949"
FT                   /product="mCG146949"
FT                   /note="gene_id=mCG146949.0 transcript_id=mCT187212.0
FT                   created on 13-JAN-2004"
FT   CDS             7067270..7067506
FT                   /codon_start=1
FT                   /locus_tag="mCG_146949"
FT                   /product="mCG146949"
FT                   /note="gene_id=mCG146949.0 transcript_id=mCT187212.0
FT                   protein_id=mCP109548.0"
FT                   /protein_id="EDL00101.1"
FT                   /translation="MLLGASFSSLSCEVGALYSESLHSILGSRKHSFKVLFFFFSLTPE
FT                   NILTNSQQGAYVFVHRFAHTMKDPGFASLGSLL"
FT   gap             7076022..7076041
FT                   /estimated_length=20
FT   CDS             join(7093328..7093632,7096592..7096697,7098258..7098396,
FT                   7098481..7098534,7100991..7101052,7103018..7103159,
FT                   7113729..7114230,7116007..7116139)
FT                   /codon_start=1
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /product="caspase 8, isoform CRA_a"
FT                   /note="gene_id=mCG117855.1 transcript_id=mCT173675.0
FT                   protein_id=mCP96594.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U607"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001875"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="MGI:MGI:1261423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U607"
FT                   /protein_id="EDL00099.1"
FT                   /translation="MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLF
FT                   LRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVM
FT                   LFKLSEEVSELELRSFKFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSI
FT                   CDQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESR
FT                   TSDKVYQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHF
FT                   EIVSYDDCTANEIHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTS
FT                   YFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEA
FT                   DFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDR
FT                   RNKGKQMPQPTFTLRKKLFFPP"
FT   CDS             join(7093328..7093632,7096592..7096697,7098258..7098396,
FT                   7098481..7098534,7100991..7101052,7103018..7103159,
FT                   7113729..7114230,7116007..7116139)
FT                   /codon_start=1
FT                   /gene="Casp8"
FT                   /locus_tag="mCG_117855"
FT                   /product="caspase 8, isoform CRA_a"
FT                   /note="gene_id=mCG117855.1 transcript_id=mCT119001.1
FT                   protein_id=mCP74626.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3U607"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR001875"
FT                   /db_xref="InterPro:IPR002138"
FT                   /db_xref="InterPro:IPR011029"
FT                   /db_xref="InterPro:IPR011600"
FT                   /db_xref="InterPro:IPR015917"
FT                   /db_xref="InterPro:IPR016129"
FT                   /db_xref="MGI:MGI:1261423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U607"
FT                   /protein_id="EDL00100.1"
FT                   /translation="MDFQSCLYAIAEELGSEDLAALKFLCLDYIPHKKQETIEDAQKLF
FT                   LRLREKGMLEEGNLSFLKELLFHISRWDLLVNFLDCNREEMVRELRDPDNAQISPYRVM
FT                   LFKLSEEVSELELRSFKFLLNNEIPKCKLEDDLSLLEIFVEMEKRTMLAENNLETLKSI
FT                   CDQVNKSLLGKIEDYERSSTERRMSLEGREELPPSVLDEMSLKMAELCDSPREQDSESR
FT                   TSDKVYQMKNKPRGYCLIINNHDFSKAREDITQLRKMKDRKGTDCDKEALSKTFKELHF
FT                   EIVSYDDCTANEIHEILEGYQSADHKNKDCFICCILSHGDKGVVYGTDGKEASIYDLTS
FT                   YFTGSKCPSLSGKPKIFFIQACQGSNFQKGVPDEAGFEQQNHTLEVDSSSHKNYIPDEA
FT                   DFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDR
FT                   RNKGKQMPQPTFTLRKKLFFPP"
FT   gap             7128960..7128979
FT                   /estimated_length=20
FT   gene            complement(7130603..7165265)
FT                   /locus_tag="mCG_117856"
FT                   /note="gene_id=mCG117856.1"
FT   mRNA            complement(join(7130603..7130813,7145090..7145151,
FT                   7145798..7145891,7147504..7147637,7160917..7160947,
FT                   7162060..7162204,7165210..7165265))
FT                   /locus_tag="mCG_117856"
FT                   /product="mCG117856"
FT                   /note="gene_id=mCG117856.1 transcript_id=mCT119002.1
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(7130699..7130813,7145090..7145151,
FT                   7145798..7145891,7147504..7147637,7160917..7160947,
FT                   7162060..7162172))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117856"
FT                   /product="mCG117856"
FT                   /note="gene_id=mCG117856.1 transcript_id=mCT119002.1
FT                   protein_id=mCP74635.1"
FT                   /protein_id="EDL00102.1"
FT                   /translation="MDPNPFIYCTCCDYCKLGPTKLIKTPYPLPKTPTGKFKPVLPLPV
FT                   SKEEVIQVSPGYTLIQNQEQISVTLGDEMFNRKKHLESDVLSKVKYSRTDIISDLQEQI
FT                   AELMAIIEQMNRDQQSALKLLSKEMDLCCSNMKQKFETKSRELKETHREELERLENNYK
FT                   EALKAEKALAEEKLGTVRP"
FT   gap             7146435..7146535
FT                   /estimated_length=101
FT   gap             7155174..7155193
FT                   /estimated_length=20
FT   gap             7156379..7156398
FT                   /estimated_length=20
FT   gap             7158970..7158998
FT                   /estimated_length=29
FT   gap             7160853..7160905
FT                   /estimated_length=53
FT   gap             7164581..7164792
FT                   /estimated_length=212
FT   gene            complement(7169853..>7239571)
FT                   /gene="Trak2"
FT                   /locus_tag="mCG_117853"
FT                   /note="gene_id=mCG117853.1"
FT   mRNA            complement(join(7169853..7173585,7176109..7176214,
FT                   7177926..7178192,7179353..7179651,7181039..7181239,
FT                   7181589..7181665,7185109..7185246,7188195..7188269,
FT                   7188644..7188774,7190497..7190575,7191103..7191312,
FT                   7192945..7193061,7196074..7196150,7212350..7212638,
FT                   7239338..>7239571))
FT                   /gene="Trak2"
FT                   /locus_tag="mCG_117853"
FT                   /product="trafficking protein, kinesin binding 2"
FT                   /note="gene_id=mCG117853.1 transcript_id=mCT118999.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(7172907..7173585,7176109..7176214,
FT                   7177926..7178192,7179353..7179651,7181039..7181239,
FT                   7181589..7181665,7185109..7185246,7188195..7188269,
FT                   7188644..7188774,7190497..7190575,7191103..7191312,
FT                   7192945..7193061,7196074..7196150,7212350..>7212506))
FT                   /codon_start=1
FT                   /gene="Trak2"
FT                   /locus_tag="mCG_117853"
FT                   /product="trafficking protein, kinesin binding 2"
FT                   /note="gene_id=mCG117853.1 transcript_id=mCT118999.1
FT                   protein_id=mCP74509.1"
FT                   /protein_id="EDL00103.1"
FT                   /translation="WISFPAIHTKAAPFNQSRKGFCMSQSQNAIFKSRTGEANLMSSNH
FT                   RDSESITVLGTDRVEQMTKTYNDIDMVTHLLAERDRDLELAARIGQALLKRNHVLSEQN
FT                   EALEEQLGQAFDQVNQLQHELSKKDELLRIVSIASEESETDSSCSTPLRFNESFSLSQG
FT                   LLQLDMLHEKLRELEEENMALRSKACHIKTETFTYEEKEQQLVNDCVKELRETNAQMSR
FT                   MTEELSGKSDELLRYQEEISSLLSQIVDLQHKLKEHVIEKEELRLHLQASKDAQRQLTM
FT                   ELHELQDRNMECLGMLHESQEEIKELRSKSGPSAHLCFSQSYGVFTGESLAAEIEGTMR
FT                   KKLSLDEESVSKQKAQQKRVFDTVKVANDTRGRSVTFPVLLPIPGSNRSSVIMTAKPFE
FT                   SGVQPAEDKTLLSPGGSTEVPGNSQPTNPPGSPEDSDLATALHRLSLRRQNYLSEKQFF
FT                   AEEWERKIQILAEQEEEVSSCDAPTENLASVCTDQSETTDLGSASCLRGFMPEKLQIVK
FT                   PLEGSQTLHHWQQLAQPNLGTILDPRPGVITKGFTQVPKDVVYHISDLEEDEEEGITFQ
FT                   VQQPLQLEQKPALPTPVTGIFLPPMTSAGGPGTVATSNPGKCLSFTNSTFTFTTCRILH
FT                   PSDITQVTPSSGFPSLACGSSASSSSNTAVNSPAASYRLSIGESITNRRDSTITFSSTR
FT                   SLAKLLQERGISAKVYHSPASENPLLQPCPKALATPSTPPNSPAQSPCSSPLPFEPRVH
FT                   VSENFLASRPAETFLQEMYGLRPSRAPPDVGQLKMNLVDRLKRLGIARVVKTPDPQENG
FT                   KSREAEMGLQKPDPAVYLNSGGSLLCGLRRNQSLPVMMGSFGAPVCTTSPKMGILKED"
FT   gap             7199463..7199482
FT                   /estimated_length=20
FT   gap             7201228..7207016
FT                   /estimated_length=5789
FT   gene            <7239699..7261791
FT                   /locus_tag="mCG_117847"
FT                   /note="gene_id=mCG117847.2"
FT   mRNA            join(<7239699..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257238,7258306..7258477,7258753..7258857,
FT                   7258995..7259239,7259658..7259700,7260369..7261791)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT189302"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189302.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<7239699..7239951,7243061..7243167,7246036..7246116,
FT                   7246509..7246675,7251391..7251490,7254608..7254729,
FT                   7255792..7255900,7257115..7257238,7258306..7258477,
FT                   7258753..7258857,7258995..7259239,7259658..7259700,
FT                   7260369..7261189)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT189301"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189301.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(7239721..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257238,7258306..7258477,7258753..7258857,
FT                   7258995..7259239,7259658..7259700,7260369..7260780,
FT                   7260926..7261195)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT118993"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT118993.1
FT                   created on 24-SEP-2002"
FT   mRNA            join(7239721..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257238,7258753..7258857,7258995..7259239,
FT                   7259658..7259700,7260369..7260780,7260926..7261195)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT173668"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT173668.0
FT                   created on 24-SEP-2002"
FT   mRNA            join(7239722..7239951,7243061..7243167,7246036..7246116,
FT                   7246509..7246680,7251391..7251490,7254608..7254729,
FT                   7255792..7255900,7257115..7257238,7258306..7258477,
FT                   7258753..7258857,7258995..7259239,7259658..7259700,
FT                   7260369..7260780,7260926..7261195)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT173667"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT173667.0
FT                   created on 24-SEP-2002"
FT   mRNA            join(<7239741..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257614)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT189300"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189300.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<7239905..7239951,7243061..7243167,7246036..7246116,
FT                   7251391..7251490,7254608..7254729,7255792..7255900,
FT                   7257115..7257238,7258753..7258857,7258995..7259239,
FT                   7259658..7259700,7260369..7261195)
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, transcript variant mCT189299"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189299.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<7243147..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257238,
FT                   7258306..7258477,7258753..7258857,7258995..7259239,
FT                   7259658..7259700,7260369..7260512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_g"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189302.0
FT                   protein_id=mCP110256.0 isoform=CRA_g"
FT                   /protein_id="EDL00110.1"
FT                   /translation="SDSMSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPP
FT                   SARASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERL
FT                   KALQRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETL
FT                   IRNILFGAVQGLNYLHQNGCIHRSFKASHILISGDGLVTLSGLSHLHSLLKHGQRHRAV
FT                   FDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLL
FT                   QKLKGPPYSPLDVSIFPQSDSRMRNSQSGVDSGIGESVLVSTGTHTVNSDRLHTPSTKT
FT                   FSPAFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILPLLPPAYNRPSASLQ
FT                   PVSPWSELEFQFPDDKDPVWEF"
FT   CDS             join(<7243147..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257238,
FT                   7258753..7258774)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_d"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189299.0
FT                   protein_id=mCP110253.0 isoform=CRA_d"
FT                   /protein_id="EDL00107.1"
FT                   /translation="SDSMSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPP
FT                   SARASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERL
FT                   KALQRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETL
FT                   IRNILFGAVQGLNYLHQNGCIHRIYMDIM"
FT   CDS             join(<7243147..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257320)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_e"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189300.0
FT                   protein_id=mCP110254.0 isoform=CRA_e"
FT                   /protein_id="EDL00108.1"
FT                   /translation="SDSMSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPP
FT                   SARASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERL
FT                   KALQRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETL
FT                   IRNILFGAVQGLNYLHQNGCIHRYLLIYSLHKRKNFKEVIQRNFCKDKC"
FT   CDS             join(7243156..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257238,
FT                   7258306..7258477,7258753..7258857,7258995..7259239,
FT                   7259658..7259700,7260369..7260512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_a"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT118993.1
FT                   protein_id=mCP74458.1 isoform=CRA_a"
FT                   /protein_id="EDL00104.1"
FT                   /translation="MSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPPSAR
FT                   ASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERLKAL
FT                   QRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETLIRN
FT                   ILFGAVQGLNYLHQNGCIHRSFKASHILISGDGLVTLSGLSHLHSLLKHGQRHRAVFDF
FT                   PQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKL
FT                   KGPPYSPLDVSIFPQSDSRMRNSQSGVDSGIGESVLVSTGTHTVNSDRLHTPSTKTFSP
FT                   AFFSLVQLCLQQDPEKRPSASSLLSHVFFKQMKEESQDSILPLLPPAYNRPSASLQPVS
FT                   PWSELEFQFPDDKDPVWEF"
FT   CDS             join(7243156..7243167,7246036..7246116,7251391..7251490,
FT                   7254608..7254729,7255792..7255900,7257115..7257238,
FT                   7258753..7258774)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_c"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT173668.0
FT                   protein_id=mCP96587.0 isoform=CRA_c"
FT                   /protein_id="EDL00106.1"
FT                   /translation="MSLLDCFCASRTRVESLRPEKQSETSIHQYLVDESAISRPPPSAR
FT                   ASEVICSTDVSHYELQVEIGRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERLKAL
FT                   QRAVILSHFFQHPNITTYWTVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETLIRN
FT                   ILFGAVQGLNYLHQNGCIHRIYMDIM"
FT   CDS             join(7246645..7246680,7251391..7251490,7254608..7254729,
FT                   7255792..7255900,7257115..7257238,7258306..7258477,
FT                   7258753..7258857,7258995..7259239,7259658..7259700,
FT                   7260369..7260512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_b"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT173667.0
FT                   protein_id=mCP96586.0 isoform=CRA_b"
FT                   /protein_id="EDL00105.1"
FT                   /translation="MPTHATLKPTGKVDESAISRPPPSARASEVICSTDVSHYELQVEI
FT                   GRGFDNLTSVHLARHTPTGTLVTVKITNLESCTEERLKALQRAVILSHFFQHPNITTYW
FT                   TVFTVGSWLWVISPFMAYGSASQLLRTYFPDGMSETLIRNILFGAVQGLNYLHQNGCIH
FT                   RSFKASHILISGDGLVTLSGLSHLHSLLKHGQRHRAVFDFPQFSTSVQPWLSPELLRQD
FT                   LHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDVSIFPQSDSR
FT                   MRNSQSGVDSGIGESVLVSTGTHTVNSDRLHTPSTKTFSPAFFSLVQLCLQQDPEKRPS
FT                   ASSLLSHVFFKQMKEESQDSILPLLPPAYNRPSASLQPVSPWSELEFQFPDDKDPVWEF
FT                   "
FT   CDS             join(<7246667..7246675,7251391..7251490,7254608..7254729,
FT                   7255792..7255900,7257115..7257238,7258306..7258477,
FT                   7258753..7258857,7258995..7259239,7259658..7259700,
FT                   7260369..7260512)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117847"
FT                   /product="mCG117847, isoform CRA_f"
FT                   /note="gene_id=mCG117847.2 transcript_id=mCT189301.0
FT                   protein_id=mCP110255.0 isoform=CRA_f"
FT                   /protein_id="EDL00109.1"
FT                   /translation="SQPVDESAISRPPPSARASEVICSTDVSHYELQVEIGRGFDNLTS
FT                   VHLARHTPTGTLVTVKITNLESCTEERLKALQRAVILSHFFQHPNITTYWTVFTVGSWL
FT                   WVISPFMAYGSASQLLRTYFPDGMSETLIRNILFGAVQGLNYLHQNGCIHRSFKASHIL
FT                   ISGDGLVTLSGLSHLHSLLKHGQRHRAVFDFPQFSTSVQPWLSPELLRQDLHGYNVKSD
FT                   IYSVGITACELASGQVPFQDMHRTQMLLQKLKGPPYSPLDVSIFPQSDSRMRNSQSGVD
FT                   SGIGESVLVSTGTHTVNSDRLHTPSTKTFSPAFFSLVQLCLQQDPEKRPSASSLLSHVF
FT                   FKQMKEESQDSILPLLPPAYNRPSASLQPVSPWSELEFQFPDDKDPVWEF"
FT   gene            complement(7263196..7273394)
FT                   /locus_tag="mCG_117846"
FT                   /note="gene_id=mCG117846.1"
FT   mRNA            complement(join(7263196..7263677,7269557..7273394))
FT                   /locus_tag="mCG_117846"
FT                   /product="mCG117846"
FT                   /note="gene_id=mCG117846.1 transcript_id=mCT118992.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(7263339..7263677,7269557..7272871))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117846"
FT                   /product="mCG117846"
FT                   /note="gene_id=mCG117846.1 transcript_id=mCT118992.1
FT                   protein_id=mCP74704.1"
FT                   /protein_id="EDL00111.1"
FT                   /translation="MSSNPKLSRDPSIISGMSSDPKLSRDPSIISAKSSDPNKLSHDPS
FT                   IISGMSSNPNKLSHDPSIISMKLSDMSKLSRESSINASKSSDTNQLSYDPNIISAKSLD
FT                   SNNSSASSSPTVNSDTTTNAAEPSGTKNMLDPVVSTIDSSDKQSKLEWLPNVQGASSVT
FT                   ENINTHRSSNSVNFTSDIDILKQSIVLKSILSKNLQDLSDELFSKSELYTNDEGYSPPP
FT                   SVHSRPSDSTDDRVLGKVQDLNSWRSSKDLLNSQVLLSPVVKNSPQDLLPEGEPGKSSD
FT                   IEDYVSEKLLEAAGRNFPMNRKSSFKKKHLVSEESSSEHVLSGSIYEYVIKQIFTAPIF
FT                   SQLGIGIKSSSEARMDSQNQLLTPWERSVTSHIINYEEKDSDVNLSQSKSIISQIIQSF
FT                   PVNTLLESGVIKVIELDKEHQNSLLDSQTTSSTEQYSDSRSQIKLLSRQNTSSINPLDS
FT                   SVSGAEYTEDCQSISTQESKYPVRDTKSDSPNDTEEMELDSNLESSSSSLDKVKDTDTA
FT                   KLKNILKNIFSIFFKYNQSERRQQPEKDSESLIKHSSSSGSEHLEKTQENFNKADKKVD
FT                   RKPILNPKLRMFLEKLSETEVKNLKSELSKHIQHYLVERLTESGHITKEDLPTIYHKLY
FT                   LMNEKVELKEQTPFQEKYSETVKEIMSFVNNFNHHFIDKHLETKLRGFLSEILQNYFLK
FT                   NLSVSNLFNETDAMALHASMSPVRSKSELGQDIADGNFGSSLKINMQYPVTKSLQHYLQ
FT                   DLSENELLSLKTDLSKYLQVLFIEKLYKSGLVSERQLKGISQEIISLHSPSIPLKHIKT
FT                   NLPFRNESYFMREDSEEQMKYLKNGQNAALHVLLKDKCGETELSRKKERESSFSQILKE
FT                   NLPAIWEQKNIYTREEETLNLIQMQSFLNKNNQANPLTRSPERPSDISLKKQKKDHGFM
FT                   QFTQVEGSVYKTEIQDPYSWDSRSKTIQSKPCLEKTLKMKLLDKRENNNFYKLTAQEKL
FT                   DTEFSSYLKLPNCKIPKEKEPISRLSFPTWKTNTFIHVKPEIGEQSKLDHYYQRLKGNN
FT                   NNNKKHLVTFAQFKNEMETLYRNPYEACNEKRAKISESQSFKYKEKEKSSRPFFFPEDC
FT                   LDRFDDLHAPTVKCPKKSKSGARLLGKSPEDSHNQAKHCARPYTAPEPNKRRESAAWKF
FT                   ASPRMVSAGLLHLYVTPAYGIRKVRSKRKLKEDIEKRPLISEIIQMLDNAE"
FT   gap             7267720..7267946
FT                   /estimated_length=227
FT   gap             7273417..7273436
FT                   /estimated_length=20
FT   gap             7275556..7275844
FT                   /estimated_length=289
FT   gene            complement(7317366..7318145)
FT                   /locus_tag="mCG_141137"
FT                   /note="gene_id=mCG141137.0"
FT   mRNA            complement(7317366..7318145)
FT                   /locus_tag="mCG_141137"
FT                   /product="mCG141137"
FT                   /note="gene_id=mCG141137.0 transcript_id=mCT173263.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(7317783..7317992)
FT                   /codon_start=1
FT                   /locus_tag="mCG_141137"
FT                   /product="mCG141137"
FT                   /note="gene_id=mCG141137.0 transcript_id=mCT173263.0
FT                   protein_id=mCP96182.0"
FT                   /protein_id="EDL00112.1"
FT                   /translation="MPHLPKTSEPEDRPHEERKSIVFSSDEELMPKHPSILKISSSQQE
FT                   VKLRHLPISPERIRRRNLGFSPAE"
FT   gene            complement(7327418..7361566)
FT                   /gene="Als2cr11"
FT                   /locus_tag="mCG_141138"
FT                   /note="gene_id=mCG141138.0"
FT   mRNA            complement(join(7327418..7327523,7329242..7329376,
FT                   7341843..7341988,7343517..7343568,7344731..7344817,
FT                   7361162..7361566))
FT                   /gene="Als2cr11"
FT                   /locus_tag="mCG_141138"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   chromosome region, candidate 11 (human)"
FT                   /note="gene_id=mCG141138.0 transcript_id=mCT173264.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(7329326..7329376,7341843..7341988,
FT                   7343517..7343568,7344731..7344817,7361162..7361524))
FT                   /codon_start=1
FT                   /gene="Als2cr11"
FT                   /locus_tag="mCG_141138"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   chromosome region, candidate 11 (human)"
FT                   /note="gene_id=mCG141138.0 transcript_id=mCT173264.0
FT                   protein_id=mCP96183.0"
FT                   /protein_id="EDL00113.1"
FT                   /translation="MELPPPGNRRVSINNPQETSGRVPTTSAGFPTQSSKISLKRSTYA
FT                   YRPSMMSNRSSGGQSLLPSSILQKTSLNPPGSLQSKPSNLSSVHYADEEGKPLTDKNKD
FT                   KDKGRGKGKGTGTRLLTMLRKTLQGSQSDEMAIANQTPNLIPFGDVVGCLAIHIKSCRQ
FT                   FSQRFLGQQRFNLFMRVSINNIVKCTKIRHLKAVNNEKNLVLRFGEMKYFSVQKCYYSA
FT                   TSRIPGILIP"
FT   gap             7357981..7358000
FT                   /estimated_length=20
FT   gene            complement(7367257..7387012)
FT                   /locus_tag="mCG_117850"
FT                   /note="gene_id=mCG117850.1"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386933..7387012))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT118996"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT118996.1
FT                   created on 24-SEP-2002"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382541,7383455..7383525,
FT                   7384590..7384621,7386933..7386998))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT173672"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173672.0
FT                   created on 24-SEP-2002"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386612..7386727))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT173670"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173670.0
FT                   created on 24-SEP-2002"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386567..7386677))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT173671"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173671.0
FT                   created on 24-SEP-2002"
FT   mRNA            complement(join(7367257..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386318..7386419))
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, transcript variant mCT173673"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173673.0
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386933..7386974))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_d"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT118996.1
FT                   protein_id=mCP74480.1 isoform=CRA_d"
FT                   /protein_id="EDL00117.1"
FT                   /translation="MRDDSGPPLEEDQARPPRALPPVPSFIDDIPLSHPKKKKSRTKSS
FT                   LATASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETSLTERPSS
FT                   PSLLRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDEQSTLEHH
FT                   SRFTAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALSVH
FT                   RAFRMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQSLLYLLLA
FT                   LSTVSAFDRTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRIHLYEPSV
FT                   NGSLWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSDVDEHPET
FT                   GTKASP"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382541,7383455..7383525,
FT                   7384590..7384621,7386933..7386974))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_b"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173672.0
FT                   protein_id=mCP96591.0 isoform=CRA_b"
FT                   /protein_id="EDL00115.1"
FT                   /translation="MRDDSGPPLEEDQARPPRALPPVPSHLVCSSFVENNSRMDQQDDL
FT                   VGEDDIPLSHPKKKKSRTKSSLATASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPR
FT                   RQKKIRPPPELETSLTERPSSPSLLRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYA
FT                   SELGVEDEDILTDEQSTLEHHSRFTAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTEN
FT                   IDVSMDVKPSWTTRDVALSVHRAFRMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSN
FT                   LLQQYKPLAYPFQSLLYLLLALSTVSAFDRTDFAKISVAIRNFLALEPTALASFLYFTA
FT                   LILSLSQQMTSDRIHLYEPSVNGSLWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYR
FT                   PGMDLSEELMFFSDVDEHPETGTKASP"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386612..7386629))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_e"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173670.0
FT                   protein_id=mCP96590.0 isoform=CRA_e"
FT                   /protein_id="EDL00118.1"
FT                   /translation="MTSRETRPPRALPPVPSFIDDIPLSHPKKKKSRTKSSLATASSEG
FT                   HAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETSLTERPSSPSLLRNEN
FT                   GIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDEQSTLEHHSRFTAPTG
FT                   VSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALSVHRAFRMVGL
FT                   FSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQSLLYLLLALSTVSAFD
FT                   RTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRIHLYEPSVNGSLWAAE
FT                   AEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSDVDEHPETGTKASP"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386567..7386629))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_a"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173671.0
FT                   protein_id=mCP96592.0 isoform=CRA_a"
FT                   /protein_id="EDL00114.1"
FT                   /translation="MTSRETVGEPPPLLGTPADAERPPRALPPVPSFIDDIPLSHPKKK
FT                   KSRTKSSLATASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETS
FT                   LTERPSSPSLLRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDE
FT                   QSTLEHHSRFTAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTR
FT                   DVALSVHRAFRMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQS
FT                   LLYLLLALSTVSAFDRTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRI
FT                   HLYEPSVNGSLWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSD
FT                   VDEHPETGTKASP"
FT   CDS             complement(join(7367801..7367862,7372233..7372354,
FT                   7373231..7373321,7374141..7374214,7374725..7374916,
FT                   7375362..7375485,7375726..7375883,7376675..7376792,
FT                   7380693..7380830,7382485..7382549,7384590..7384621,
FT                   7386318..7386350))
FT                   /codon_start=1
FT                   /locus_tag="mCG_117850"
FT                   /product="mCG117850, isoform CRA_c"
FT                   /note="gene_id=mCG117850.1 transcript_id=mCT173673.0
FT                   protein_id=mCP96589.0 isoform=CRA_c"
FT                   /protein_id="EDL00116.1"
FT                   /translation="MGKKQVVSEPQRPPRALPPVPSFIDDIPLSHPKKKKSRTKSSLAT
FT                   ASSEGHAEPVVNRRAEGSEPPAAELKEHPEAPAPRRQKKIRPPPELETSLTERPSSPSL
FT                   LRNENGIDAEPREEAVIPKPRRKAKKTQPAEPQYASELGVEDEDILTDEQSTLEHHSRF
FT                   TAPTGVSQPVGKVFVEKSRRFQAADRSELIKTTENIDVSMDVKPSWTTRDVALSVHRAF
FT                   RMVGLFSHGFLAGCAVWNTVVIYVLAGDQLSNVSNLLQQYKPLAYPFQSLLYLLLALST
FT                   VSAFDRTDFAKISVAIRNFLALEPTALASFLYFTALILSLSQQMTSDRIHLYEPSVNGS
FT                   LWAAEAEEPILVPWIIVNLVVALLVGLSWLFLSYRPGMDLSEELMFFSDVDEHPETGTK
FT                   ASP"
FT   gap             7371005..7371024
FT                   /estimated_length=20
FT   gene            complement(7387551..>7428176)
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /note="gene_id=mCG117852.2"
FT   mRNA            complement(join(7387551..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403505..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7411458,7412950..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7425195..>7425284))
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), transcript variant mCT189255"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189255.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(7387551..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403505..7403529,
FT                   7406432..7406470,7410364..7410428,7411262..7411458,
FT                   7412950..7413021,7413356..7413441,7415623..7415704,
FT                   7416130..7416261,7417080..7417160,7418268..7418345,
FT                   7423983..7424104,7425195..>7425279))
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), transcript variant mCT189253"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189253.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(7387558..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403505..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7413021,7413356..7413441,7415623..7415704,
FT                   7416130..7416261,7417080..7417160,7418268..7418345,
FT                   7423983..7424104,7424367..7424448,7425195..7425284,
FT                   7428141..>7428176))
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), transcript variant mCT189254"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189254.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(7387558..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403509..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7411458,7412950..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7425195..7425284,
FT                   7428141..7428175))
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), transcript variant mCT118998"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT118998.1
FT                   created on 24-SEP-2002"
FT   CDS             complement(join(7387868..7388059,7390121..7390255,
FT                   7391292..7391400,7392184..7392277,7395593..7395673,
FT                   7396593..7396763,7398590..7398631,7403509..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7411458,7412950..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7425195..7425270))
FT                   /codon_start=1
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), isoform CRA_a"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT118998.1
FT                   protein_id=mCP74497.1 isoform=CRA_a"
FT                   /protein_id="EDL00119.1"
FT                   /translation="MRQSDRGAELTNEDRALPTPPDPENGLSGILRLLLQELSLFYSRD
FT                   VNGLCLLYDLLHSPWLQALLKVYDCLQRFKEKKLVPDTTHAQILACEVLELLPKASGSP
FT                   EIQELRQVLQAPHCKALLSAHDTVAQKDFEPLLPPLPDNIPDSEEAMRIVCLVKNQQPL
FT                   GATIKRHEITGDILVARVIHGGLVERSGLLYAGDKLVEVNGVSVEGLDPEQVIHILAMS
FT                   CGTIMFKVIPVSAPPVSSQKMVYVRAMIDYWPQEDPDIPCMDAGLPFLKGDILQIVDQN
FT                   DALWWQARKISDLTICAGLIPSNHLLKRKQREFWWSQPYQPHTCLKSTRALSMEEEDSM
FT                   KIDEKCVEADEETFESAKDEFVGDGQKFFIAGFRRSMRLCRRKSHFSQLHASLCCSCSC
FT                   YSAVGAPYEEVVRYQRQPADKHRLIVLVGPSGVGVNELRRQLIGCNPSCFQSAVPHTTR
FT                   FPKSYEMDGREYHYVSRETFESLMYGHKMLEYGEYKGHLYGTSVNAVHAVLDEGKICIM
FT                   DLEPQDIQSARTRDLKPYVIFIKPPNTSSMRHSRKNAKITTDYYVDMKFKDEDLQEMEE
FT                   LAQKMESQFGQFFDHVIVNDNLQDACGQLLSAIQKAQEELQWVPEAWVSPDTES"
FT   gap             7388919..7389210
FT                   /estimated_length=292
FT   CDS             complement(join(7398628..7398631,7403505..7403529,
FT                   7406432..7406470,7407614..7407631,7410364..7410428,
FT                   7411262..7411458,7412950..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7425195..>7425282))
FT                   /codon_start=1
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), isoform CRA_d"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189255.0
FT                   protein_id=mCP110260.0 isoform=CRA_d"
FT                   /protein_id="EDL00122.1"
FT                   /translation="PAGRMRQSDRGAELTNEDRALPTPPDPENGLSGILRLLLQELSLF
FT                   YSRDVNGLCLLYDLLHSPWLQALLKVYDCLQRFKEKKLVPDTTHAQILACEVLELLPKA
FT                   SGSPEIQELRQVLQAPHCKALLSAHDTVAQKDFEPLLPPLPDNIPDSEEAMRIVCLVKN
FT                   QQPLGATIKRHEITGDILVARVIHGGLVERSGLLYAGDKLVEVNGVSVEGLDPEQVIHI
FT                   LAMSCGTIMFKVIPVSAPPVSSQKMVYVRAMIDYWPQEDPDIPCMDAGLPFLKGDILQI
FT                   VDQNDALWWQARKISDLTICAGLIPSNHLLKRKQREFWWSQPYQPHTCLKSTRALSMEE
FT                   EDSMKIDEKCVEADEETFESGN"
FT   CDS             complement(join(7398628..7398631,7403505..7403529,
FT                   7406432..7406470,7410364..7410428,7411262..7411458,
FT                   7412950..7413021,7413356..7413441,7415623..7415704,
FT                   7416130..7416261,7417080..7417160,7418268..7418345,
FT                   7423983..7424104,7425195..>7425279))
FT                   /codon_start=1
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), isoform CRA_b"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189253.0
FT                   protein_id=mCP110258.0 isoform=CRA_b"
FT                   /protein_id="EDL00120.1"
FT                   /translation="AGRMRQSDRGAELTNEDRALPTPPDPENGLSGILRLLLQELSLFY
FT                   SRDVNGLCLLYDLLHSPWLQALLKVYDCLQRFKEKKLVPDTTHAQILACEVLELLPKAS
FT                   GSPEIQELRQVLQAPHCKALLSAHDTVAQKDFEPLLPPLPDNIPDSEEAMRIVCLVKNQ
FT                   QPLGATIKRHEITGDILVARVIHGGLVERSGLLYAGDKLVEVNGVSVEGLDPEQVIHIL
FT                   AMSCGTIMFKVIPVSAPPVSSQKMVYVRAMIDYWPQEDPDIPCMDAGLPFLKGDILQIV
FT                   DQNDALWWQARKISDLTICAGLIPSNHLLKRKQREFWWSQPYQPHTCLKSTREDSMKID
FT                   EKCVEADEETFESGN"
FT   CDS             complement(join(7412773..7413021,7413356..7413441,
FT                   7415623..7415704,7416130..7416261,7417080..7417160,
FT                   7418268..7418345,7423983..7424104,7424367..7424448,
FT                   7425195..>7425239))
FT                   /codon_start=1
FT                   /gene="Mpp4"
FT                   /locus_tag="mCG_117852"
FT                   /product="membrane protein, palmitoylated 4 (MAGUK p55
FT                   subfamily member 4), isoform CRA_c"
FT                   /note="gene_id=mCG117852.2 transcript_id=mCT189254.0
FT                   protein_id=mCP110259.0 isoform=CRA_c"
FT                   /protein_id="EDL00121.1"
FT                   /translation="PMRTELFPRHLILRMNEQNQLCLTWRRKVLETPAWFRDKFPPGLS
FT                   GILRLLLQELSLFYSRDVNGLCLLYDLLHSPWLQALLKVYDCLQRFKEKKLVPDTTHAQ
FT                   ILACEVLELLPKASGSPEIQELRQVLQAPHCKALLSAHDTVAQKDFEPLLPPLPDNIPD
FT                   SEEAMRIVCLVKNQQPLGATIKRHEITGDILVARVIHGGLVERSGLLYAGDKLVEVNGV
FT                   SVEGLDPEQVIHILAMSCGTIMFKVIPVSAPPVSSQKMVRTHSNSMVYNNPSYYSVLDK
FT                   GSVFRLFHSADDLKWRVGKGTQQREWGHHAIKMLHQE"
FT   gene            complement(7429534..7503920)
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /note="gene_id=mCG117848.1"
FT   mRNA            complement(join(7429534..7430824,7433810..7433906,
FT                   7434090..7434239,7434778..7434839,7435016..7435061,
FT                   7436464..7436640,7437064..7437186,7439783..7439940,
FT                   7441552..7441669,7445169..7445336,7445697..7445830,
FT                   7446743..7446820,7447186..7447297,7449801..7449965,
FT                   7450419..7450517,7451907..7451972,7452091..7452293,
FT                   7452706..7452772,7453150..7453220,7454015..7454143,
FT                   7454429..7454560,7458583..7458745,7460727..7460792,
FT                   7462885..7463065,7465714..7465885,7469631..7469813,
FT                   7473235..7473312,7474476..7474572,7475665..7475833,
FT                   7477847..7478204,7481798..7482717,7484623..7484777,
FT                   7487071..7487148,7503842..7503920))
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   homolog (human), transcript variant mCT118994"
FT                   /note="gene_id=mCG117848.1 transcript_id=mCT118994.1
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(7430666..7430824,7433810..7433906,
FT                   7434090..7434239,7434778..7434839,7435016..7435061,
FT                   7436464..7436640,7437064..7437186,7439783..7439940,
FT                   7441552..7441669,7445169..7445336,7445697..7445830,
FT                   7446743..7446820,7447186..7447297,7449801..7449965,
FT                   7450419..7450517,7451907..7451972,7452091..7452293,
FT                   7452706..7452772,7453150..7453220,7454015..7454143,
FT                   7454429..7454560,7458583..7458745,7460727..7460792,
FT                   7462885..7463065,7465714..7465885,7469631..7469813,
FT                   7473235..7473312,7474476..7474572,7475665..7475833,
FT                   7477847..7478204,7481798..7482717,7484623..7484777,
FT                   7487071..7487148,7503535..>7503782))
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   homolog (human), transcript variant mCT189305"
FT                   /note="gene_id=mCG117848.1 transcript_id=mCT189305.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(7430786..7430824,7433810..7433906,
FT                   7434090..7434239,7434778..7434839,7435016..7435061,
FT                   7436464..7436640,7437064..7437186,7439783..7439940,
FT                   7441552..7441669,7445169..7445336,7445697..7445830,
FT                   7446743..7446820,7447186..7447297,7449801..7449965,
FT                   7450419..7450517,7451907..7451972,7452091..7452293,
FT                   7452706..7452772,7453150..7453220,7454015..7454143,
FT                   7454429..7454560,7458583..7458745,7460727..7460792,
FT                   7462885..7463065,7465714..7465885,7469631..7469813,
FT                   7473235..7473312,7474476..7474572,7475665..7475833,
FT                   7477847..7478204,7481798..7482717,7484623..7484777,
FT                   7487071..>7487093))
FT                   /codon_start=1
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   homolog (human), isoform CRA_a"
FT                   /note="gene_id=mCG117848.1 transcript_id=mCT189305.0
FT                   protein_id=mCP110303.0 isoform=CRA_a"
FT                   /protein_id="EDL00123.1"
FT                   /translation="PMDSKKKSSTEAEGSKERGLVHVWQAGSFSLTPERLPGWGGKTVL
FT                   QAALGVRHGVLLTEDGEVYSFGTLPWKSESAEICPSSPLLESALVGHHVITVATGSFHS
FT                   GAVTESGVVYMWGENAAGQCAVANQQYVPEPSPVSISDSETSPSLAVRILQLACGEEHT
FT                   LALSLSREIWAWGTGCQLGLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLP
FT                   PQDLKPVPERCNQCSQLLITMTDKEDHVIISDSHCCPLGVTLSESQAEKHASPAPSPHP
FT                   EALDEQGEVFENTVVEAELNMGSSQTTSGSAISTQQNVVGTAEVSSARTAPSYPDTHAV
FT                   TAYLQKLSEHSMRENHEPGEKPPQVQPLVEEAVPDLHSPPTTSTSALNSLVVSCASAVG
FT                   VRVAATYEAGALSLKKVMNFYSTAPCETAAQSGSASTGPESLKDLREEQVKQESLQGKK
FT                   SSSLMDIREEELEGGSRRLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLP
FT                   SLRTEVWTWGKGKEGQLGHGDVLPRLQPLCVKCLDGKEVIHLEAGGSHSLALTAKSQVY
FT                   SWGSNTFGQLGHSEFPTTVPRLSKVSSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGR
FT                   QDRAEGDTLPENPSGTKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELA
FT                   STERRFYSKLSEIKSQILRPLLSLENLGTVTTVQLLQEVASRFSKLCYLIGQHGASLSS
FT                   YLQGMKEASSLVIMKHSSLFLDSYTEYCTSVSNFLVMGGFQLLAKPAIDFLNKNQELLQ
FT                   DLSEVNDENTQLMEILNMLFFLPIRRLHNYAKVLLKLATCFEVTSPEYQKLQDSSSCYE
FT                   SLALHLGKKRKEAEYTLSFWKTFPGKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNW
FT                   FILFNDALVHAQFSTHHVFPLATLWAEPLSEEAGSVNGLKITTPEEQFTLISSTPQEKT
FT                   KWLRAISQAVDQALRGTSDFPLYGGGSSVQRQEPPISRSAKYTFYKDTRLKDATYDGRW
FT                   LSGKPHGRGVLKWPDGKMYSGMFRNGLEDGYGEYRIPNKALNKEDHYVGHWKEGKMCGQ
FT                   GVYSYASGEVFEGCFQDNMRHGHGLLRSGKLTSSSPSMFIGQWVMDKKAGYGVFDDITR
FT                   GEKYMGMWQDDVCQGNGVVVTQFGLYYEGNFHLNKMMGNGVLLSEDDTIYEGEFSDDWT
FT                   LSGKGTLTMPHGDYIEGYFSGEWGSGIKITGTYFKPSLYESDKDKPKAFRKLGNLAVAA
FT                   DEKWRAVFEECWRQLGCESPGQGEVWKAWDNIAVALTTNRRQHKDSPEILSRSQTQTLE
FT                   SLEYIPQHIGAFSVEKYDDIKKYLIKACDTPLHPLGRLVETLVAVYRMTYVGVGANRRL
FT                   LQEAVKEIKSYLKRIFQLVRFLFPELPEEGSTIPLSAPLPTGRRSFCTGKSDSRSESPE
FT                   PGYVVTSSGLLLPVLLPRLYPPLFMLYALDNDREEDIYWECVLRLNKQPDIALLGFLGV
FT                   QKKFWPATLSILGESKKVLSTTKDACFASAVECLQQISTTFTPSDKLKVIQQTFEEISQ
FT                   SVLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIEDLMDPFLQHGEQGIMFTT
FT                   LKACYFQIQREKLN"
FT   CDS             complement(join(7430786..7430824,7433810..7433906,
FT                   7434090..7434239,7434778..7434839,7435016..7435061,
FT                   7436464..7436640,7437064..7437186,7439783..7439940,
FT                   7441552..7441669,7445169..7445336,7445697..7445830,
FT                   7446743..7446820,7447186..7447297,7449801..7449965,
FT                   7450419..7450517,7451907..7451972,7452091..7452293,
FT                   7452706..7452772,7453150..7453220,7454015..7454143,
FT                   7454429..7454560,7458583..7458745,7460727..7460792,
FT                   7462885..7463065,7465714..7465885,7469631..7469813,
FT                   7473235..7473312,7474476..7474572,7475665..7475833,
FT                   7477847..7478204,7481798..7482717,7484623..7484777,
FT                   7487071..7487090))
FT                   /codon_start=1
FT                   /gene="Als2"
FT                   /locus_tag="mCG_117848"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   homolog (human), isoform CRA_b"
FT                   /note="gene_id=mCG117848.1 transcript_id=mCT118994.1
FT                   protein_id=mCP74460.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q920R0"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR003123"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1921268"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q920R0"
FT                   /protein_id="EDL00124.1"
FT                   /translation="MDSKKKSSTEAEGSKERGLVHVWQAGSFSLTPERLPGWGGKTVLQ
FT                   AALGVRHGVLLTEDGEVYSFGTLPWKSESAEICPSSPLLESALVGHHVITVATGSFHSG
FT                   AVTESGVVYMWGENAAGQCAVANQQYVPEPSPVSISDSETSPSLAVRILQLACGEEHTL
FT                   ALSLSREIWAWGTGCQLGLITTTFPVTKPQKVEHLAGRVVLQVACGAFHSLALVQCLPP
FT                   QDLKPVPERCNQCSQLLITMTDKEDHVIISDSHCCPLGVTLSESQAEKHASPAPSPHPE
FT                   ALDEQGEVFENTVVEAELNMGSSQTTSGSAISTQQNVVGTAEVSSARTAPSYPDTHAVT
FT                   AYLQKLSEHSMRENHEPGEKPPQVQPLVEEAVPDLHSPPTTSTSALNSLVVSCASAVGV
FT                   RVAATYEAGALSLKKVMNFYSTAPCETAAQSGSASTGPESLKDLREEQVKQESLQGKKS
FT                   SSLMDIREEELEGGSRRLSLPGLLSQVSPRLLRKAARVKTRTVVLTPTYSGEADALLPS
FT                   LRTEVWTWGKGKEGQLGHGDVLPRLQPLCVKCLDGKEVIHLEAGGSHSLALTAKSQVYS
FT                   WGSNTFGQLGHSEFPTTVPRLSKVSSENGVWSVAAGQDYSLFLVDTEDFQPGLYYSGRQ
FT                   DRAEGDTLPENPSGTKTPVLLSCSKLGYISRVTAGKDSYLALVDKNIMGYIASLHELAS
FT                   TERRFYSKLSEIKSQILRPLLSLENLGTVTTVQLLQEVASRFSKLCYLIGQHGASLSSY
FT                   LQGMKEASSLVIMKHSSLFLDSYTEYCTSVSNFLVMGGFQLLAKPAIDFLNKNQELLQD
FT                   LSEVNDENTQLMEILNMLFFLPIRRLHNYAKVLLKLATCFEVTSPEYQKLQDSSSCYES
FT                   LALHLGKKRKEAEYTLSFWKTFPGKMTDSLRKPERRLLCESSNRALSLQHAGRFSVNWF
FT                   ILFNDALVHAQFSTHHVFPLATLWAEPLSEEAGSVNGLKITTPEEQFTLISSTPQEKTK
FT                   WLRAISQAVDQALRGTSDFPLYGGGSSVQRQEPPISRSAKYTFYKDTRLKDATYDGRWL
FT                   SGKPHGRGVLKWPDGKMYSGMFRNGLEDGYGEYRIPNKALNKEDHYVGHWKEGKMCGQG
FT                   VYSYASGEVFEGCFQDNMRHGHGLLRSGKLTSSSPSMFIGQWVMDKKAGYGVFDDITRG
FT                   EKYMGMWQDDVCQGNGVVVTQFGLYYEGNFHLNKMMGNGVLLSEDDTIYEGEFSDDWTL
FT                   SGKGTLTMPHGDYIEGYFSGEWGSGIKITGTYFKPSLYESDKDKPKAFRKLGNLAVAAD
FT                   EKWRAVFEECWRQLGCESPGQGEVWKAWDNIAVALTTNRRQHKDSPEILSRSQTQTLES
FT                   LEYIPQHIGAFSVEKYDDIKKYLIKACDTPLHPLGRLVETLVAVYRMTYVGVGANRRLL
FT                   QEAVKEIKSYLKRIFQLVRFLFPELPEEGSTIPLSAPLPTGRRSFCTGKSDSRSESPEP
FT                   GYVVTSSGLLLPVLLPRLYPPLFMLYALDNDREEDIYWECVLRLNKQPDIALLGFLGVQ
FT                   KKFWPATLSILGESKKVLSTTKDACFASAVECLQQISTTFTPSDKLKVIQQTFEEISQS
FT                   VLASLQEDFLWSMDDLFPVFLYVVLRARIRNLGSEVHLIEDLMDPFLQHGEQGIMFTTL
FT                   KACYFQIQREKLN"
FT   gap             7451007..7451222
FT                   /estimated_length=216
FT   gap             7466423..7466442
FT                   /estimated_length=20
FT   gap             7479959..7480008
FT                   /estimated_length=50
FT   gap             7510032..7510051
FT                   /estimated_length=20
FT   gap             7519277..7519388
FT                   /estimated_length=112
FT   gap             7520974..7521100
FT                   /estimated_length=127
FT   gene            7525338..7620174
FT                   /locus_tag="mCG_117849"
FT                   /note="gene_id=mCG117849.1"
FT   mRNA            join(7525338..7525478,7526225..7526319,7533122..7533201,
FT                   7548087..7548181,7548927..7548989,7555280..7555403,
FT                   7557177..7557297,7568687..7568780,7578291..7578354,
FT                   7611944..7612062,7619897..7620174)
FT                   /locus_tag="mCG_117849"
FT                   /product="mCG117849, transcript variant mCT118995"
FT                   /note="gene_id=mCG117849.1 transcript_id=mCT118995.1
FT                   created on 24-SEP-2002"
FT   mRNA            join(7525338..7525478,7526225..7526319,7533122..7533201,
FT                   7548087..7548181,7548927..7548989,7555280..7555403,
FT                   7557177..7557297,7568687..7568780,7578291..7578354,
FT                   7598382..7598561,7611944..7612062,7619897..7620076)
FT                   /locus_tag="mCG_117849"
FT                   /product="mCG117849, transcript variant mCT173669"
FT                   /note="gene_id=mCG117849.1 transcript_id=mCT173669.0
FT                   created on 24-SEP-2002"
FT   CDS             join(7533159..7533201,7548087..7548181,7548927..7548989,
FT                   7555280..7555403,7557177..7557297,7568687..7568780,
FT                   7578291..7578354,7598382..7598561,7611944..7612053)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117849"
FT                   /product="mCG117849, isoform CRA_b"
FT                   /note="gene_id=mCG117849.1 transcript_id=mCT173669.0
FT                   protein_id=mCP96588.0 isoform=CRA_b"
FT                   /protein_id="EDL00126.1"
FT                   /translation="MNAEEGVPFTAIREASLLKGLKHANIVLLHDIVHTKETLTFVFEY
FT                   MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQRVLHRDLKPQNLLLSHLGELK
FT                   LADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQP
FT                   LFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPAASRETISSFHFSRLGGVPEA
FT                   EDLASQMLKGFPRDRVSAQEALVHDYFSVLPSQLYQLPDEESLFAVSGVKLKPEMCDLS
FT                   ASYRKRHHLVGVNKCW"
FT   CDS             join(7533159..7533201,7548087..7548181,7548927..7548989,
FT                   7555280..7555403,7557177..7557297,7568687..7568780,
FT                   7578291..7578354,7611944..7612053)
FT                   /codon_start=1
FT                   /locus_tag="mCG_117849"
FT                   /product="mCG117849, isoform CRA_a"
FT                   /note="gene_id=mCG117849.1 transcript_id=mCT118995.1
FT                   protein_id=mCP74473.1 isoform=CRA_a"
FT                   /protein_id="EDL00125.1"
FT                   /translation="MNAEEGVPFTAIREASLLKGLKHANIVLLHDIVHTKETLTFVFEY
FT                   MHTDLAQYMSQHPGGLHPHNVRLFMFQLLRGLAYIHHQRVLHRDLKPQNLLLSHLGELK
FT                   LADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFQGQP
FT                   LFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEESLFAVSGVKLKPEMCDLSA
FT                   SYRKRHHLVGVNKCW"
FT   gap             7565627..7565646
FT                   /estimated_length=20
FT   gap             7569717..7569762
FT                   /estimated_length=46
FT   gap             7586816..7586936
FT                   /estimated_length=121
FT   gap             7603170..7603189
FT                   /estimated_length=20
FT   gap             7609285..7609503
FT                   /estimated_length=219
FT   gap             7615238..7615350
FT                   /estimated_length=113
FT   gap             7658416..7658634
FT                   /estimated_length=219
FT   gap             7668204..7668391
FT                   /estimated_length=188
FT   gap             7673510..7673529
FT                   /estimated_length=20
FT   gap             7675921..7676148
FT                   /estimated_length=228
FT   gap             7686321..7686340
FT                   /estimated_length=20
FT   gap             7692667..7692902
FT                   /estimated_length=236
FT   gap             7705607..7705626
FT                   /estimated_length=20
FT   gap             7714128..7714258
FT                   /estimated_length=131
FT   gap             7721556..7721808
FT                   /estimated_length=253
FT   gap             7724997..7725016
FT                   /estimated_length=20
FT   gap             7739723..7739742
FT                   /estimated_length=20
FT   gene            7748699..7753544
FT                   /locus_tag="mCG_117844"
FT                   /note="gene_id=mCG117844.2"
FT   mRNA            7748699..7753544
FT                   /locus_tag="mCG_117844"
FT                   /product="mCG117844"
FT                   /note="gene_id=mCG117844.2 transcript_id=mCT118990.2
FT                   created on 24-NOV-2004"
FT   CDS             7749557..7751275
FT                   /codon_start=1
FT                   /locus_tag="mCG_117844"
FT                   /product="mCG117844"
FT                   /note="gene_id=mCG117844.2 transcript_id=mCT118990.2
FT                   protein_id=mCP74702.2"
FT                   /db_xref="GOA:Q61090"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026552"
FT                   /db_xref="MGI:MGI:108570"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61090"
FT                   /protein_id="EDL00127.1"
FT                   /translation="MRGPGTAASHSPLGLCALVLALLGALPTDTRAQPYHGEKGISVPD
FT                   HGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCS
FT                   MYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQ
FT                   NTSDGSGGAGGSPTAYPTAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRF
FT                   LGERDCGAPCEPGRANGLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFS
FT                   YPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMV
FT                   LYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQ
FT                   VDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTK
FT                   TEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGH
FT                   FSPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV"
FT   gap             7754999..7755018
FT                   /estimated_length=20
FT   gene            complement(<7755096..7759221)
FT                   /locus_tag="mCG_146947"
FT                   /note="gene_id=mCG146947.0"
FT   mRNA            complement(join(<7755096..7758322,7758862..7759221))
FT                   /locus_tag="mCG_146947"
FT                   /product="mCG146947"
FT                   /note="gene_id=mCG146947.0 transcript_id=mCT187210.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<7755096..7755492)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146947"
FT                   /product="mCG146947"
FT                   /note="gene_id=mCG146947.0 transcript_id=mCT187210.0
FT                   protein_id=mCP109547.0"
FT                   /protein_id="EDL00128.1"
FT                   /translation="MFSVFVPYLGIYKLLPMFFLNSIYAPLQTLSLYGVSAKMQFLKKT
FT                   HGVSKILRQWLTSQGMLVGTERNERFLLTRAGRDFFTCCVCVCSRVRDQASSITLSCEL
FT                   QGGEMFLGAALRIPLERPKCLSQLFTIR"
FT   gap             7774025..7774044
FT                   /estimated_length=20
FT   gene            complement(7799578..>7815440)
FT                   /locus_tag="mCG_145853"
FT                   /note="gene_id=mCG145853.0"
FT   mRNA            complement(join(7799578..7799829,7809086..7809196,
FT                   7815338..>7815440))
FT                   /locus_tag="mCG_145853"
FT                   /product="mCG145853"
FT                   /note="gene_id=mCG145853.0 transcript_id=mCT185961.0
FT                   created on 03-JUL-2003"
FT   CDS             complement(join(7799812..7799829,7809086..7809196,
FT                   7815338..>7815421))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145853"
FT                   /product="mCG145853"
FT                   /note="gene_id=mCG145853.0 transcript_id=mCT185961.0
FT                   protein_id=mCP107686.0"
FT                   /protein_id="EDL00129.1"
FT                   /translation="SDLFGVRDPSEGGGSKTPAGWIITQQRKVLPSLRLLAQAAGWQPA
FT                   LPWRCPVITAFWLRSSFYQVVCFPA"
FT   gene            complement(7801398..7803819)
FT                   /locus_tag="mCG_146950"
FT                   /note="gene_id=mCG146950.0"
FT   mRNA            complement(join(7801398..7801635,7803634..7803819))
FT                   /locus_tag="mCG_146950"
FT                   /product="mCG146950"
FT                   /note="gene_id=mCG146950.0 transcript_id=mCT187213.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(7801484..7801600)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146950"
FT                   /product="mCG146950"
FT                   /note="gene_id=mCG146950.0 transcript_id=mCT187213.0
FT                   protein_id=mCP109549.0"
FT                   /protein_id="EDL00130.1"
FT                   /translation="MVGRSQNSRDNKGTIRQTGLLQTQKTNSEEACKTECFK"
FT   gap             7806845..7806958
FT                   /estimated_length=114
FT   gene            7815480..7895548
FT                   /locus_tag="mCG_116548"
FT                   /note="gene_id=mCG116548.1"
FT   mRNA            join(7815480..7815736,7816562..7816689,7822717..7822885,
FT                   7824647..7824865,7829208..7829372,7833155..7833265,
FT                   7848958..7849037,7872762..7872834,7890112..7890202,
FT                   7892482..7892632,7893195..7893309,7895020..7895548)
FT                   /locus_tag="mCG_116548"
FT                   /product="mCG116548"
FT                   /note="gene_id=mCG116548.1 transcript_id=mCT173807.0
FT                   created on 01-APR-2003"
FT   CDS             join(7816591..7816689,7822717..7822885,7824647..7824865,
FT                   7829208..7829372,7833155..7833265,7848958..7849037,
FT                   7872762..7872834,7890112..7890202,7892482..7892632,
FT                   7893195..7893309,7895020..7895396)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116548"
FT                   /product="mCG116548"
FT                   /note="gene_id=mCG116548.1 transcript_id=mCT173807.0
FT                   protein_id=mCP96726.0"
FT                   /protein_id="EDL00131.1"
FT                   /translation="MDQGSVAQNHSNPDTHLMSVRRQLWQEDELQAEALRTLKLPPVSE
FT                   EPPGVLKPRRSRFKDSEPPKELFIIPMEIHFHAAQPPKEKASRRGARHPESEPEEATPL
FT                   WWPPMKHLYLERPRGITVHLPVDSSQDTPSPQGSSSLPPASYKARQRKVLSGEEGRQGD
FT                   GDILAQSVNQPLGLLPPMKGKKSSEIQRDMDRTRTSGFSSPTGCPNERAPPAGPEDSRD
FT                   LTLKHFLLSPDGENVCLTLPRLMGTEVLPLGQANAGAGASLHGNLYETSSRLAQAAESQ
FT                   ERGSELDSHEEPGGPLRGNAKDSQDPELRNKTLACLSTSLAEYNQPSEADTLKSMDGDY
FT                   NVHHLHRGPLKREPAFPKKLASETPRKKKKRRSKLLNQKTGVGINHGKDLVDKAKRKKR
FT                   TKTHQAKALKKEREERGLGQAEAAGGKPKHSKIKKKSELTPKKEKLGRKMKRTHKERNM
FT                   EMAAGLSKSDITNSKEAGGTSHQGLLRSHSAAGQLSLELDALESQVAIDGRLSSIQATD
FT                   VASDMECEEERSHEDPSKVWTGVLTRGSSVLT"
FT   gap             7821429..7821705
FT                   /estimated_length=277
FT   gap             7853494..7853879
FT                   /estimated_length=386
FT   gap             7863017..7863320
FT                   /estimated_length=304
FT   gap             7866734..7866753
FT                   /estimated_length=20
FT   gap             7873068..7873087
FT                   /estimated_length=20
FT   gene            7897234..7901438
FT                   /locus_tag="mCG_142695"
FT                   /note="gene_id=mCG142695.0"
FT   mRNA            join(7897234..7897441,7898172..7898344,7899019..7899238,
FT                   7901110..7901438)
FT                   /locus_tag="mCG_142695"
FT                   /product="mCG142695"
FT                   /note="gene_id=mCG142695.0 transcript_id=mCT181745.0
FT                   created on 01-APR-2003"
FT   CDS             join(7897305..7897441,7898172..7898344,7899019..7899238,
FT                   7901110..7901248)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142695"
FT                   /product="mCG142695"
FT                   /note="gene_id=mCG142695.0 transcript_id=mCT181745.0
FT                   protein_id=mCP104667.0"
FT                   /protein_id="EDL00132.1"
FT                   /translation="MRWLKVEQRRREQEELTWLHKEQLEKAEKMKEELELEQQRRTEEN
FT                   RLRKQRLEEERQQQEEAEKKRRLQLQAARERARQQQEELRRKLQEIQRKKQQEAAERAE
FT                   AEKQRQKELEMQLAEEQKRLMEMAEEERLEYQQQKLAAEEKARQEAEERRKQEEEAAKL
FT                   ALEEATKLAQEQIRQKAALDKHLHFHQELSKEASGLQWTQNISRPWVYSYFQSLQIPKP
FT                   "
FT   gene            complement(7904462..7935928)
FT                   /locus_tag="mCG_116538"
FT                   /note="gene_id=mCG116538.1"
FT   mRNA            complement(join(7904462..7905293,7907444..7907515,
FT                   7909543..7909620,7920478..7920552,7935785..7935928))
FT                   /locus_tag="mCG_116538"
FT                   /product="mCG116538"
FT                   /note="gene_id=mCG116538.1 transcript_id=mCT117661.1
FT                   created on 15-JUL-2002"
FT   CDS             complement(join(7905225..7905293,7907444..7907515,
FT                   7909543..7909620,7920478..7920552,7935785..7935796))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116538"
FT                   /product="mCG116538"
FT                   /note="gene_id=mCG116538.1 transcript_id=mCT117661.1
FT                   protein_id=mCP74529.1"
FT                   /protein_id="EDL00133.1"
FT                   /translation="MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLK
FT                   KLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV"
FT   gene            7909054..7916041
FT                   /locus_tag="mCG_146957"
FT                   /note="gene_id=mCG146957.0"
FT   mRNA            join(7909054..7909180,7913270..7916041)
FT                   /locus_tag="mCG_146957"
FT                   /product="mCG146957"
FT                   /note="gene_id=mCG146957.0 transcript_id=mCT187220.0
FT                   created on 13-JAN-2004"
FT   CDS             7914246..7914584
FT                   /codon_start=1
FT                   /locus_tag="mCG_146957"
FT                   /product="mCG146957"
FT                   /note="gene_id=mCG146957.0 transcript_id=mCT187220.0
FT                   protein_id=mCP109556.0"
FT                   /protein_id="EDL00134.1"
FT                   /translation="MLILWFLPQYWPFHPESIGCHFPSVSIPSMADKSSVNHDLAKCCD
FT                   HSLSPHTSIGASLGREGFRYRDYRQLSYFLSAPLLPHSDCEGIQSGTSSTVNTFPFMGR
FT                   LACEELCL"
FT   gap             7927751..7928186
FT                   /estimated_length=436
FT   gap             7935398..7935686
FT                   /estimated_length=289
FT   gap             7947680..7947699
FT                   /estimated_length=20
FT   gene            7950059..7976581
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /note="gene_id=mCG116536.1"
FT   mRNA            join(7950059..7950303,7955563..7955639,7957414..7957466,
FT                   7961051..7961172,7963396..7963532,7965958..7966022,
FT                   7967886..7968020,7969136..7969281,7969697..7969823,
FT                   7970666..7970829,7971706..7971840,7972076..7972137,
FT                   7974076..7974209,7975568..7975725,7976344..7976581)
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /product="nucleolar protein 5, transcript variant
FT                   mCT117659"
FT                   /note="gene_id=mCG116536.1 transcript_id=mCT117659.1
FT                   created on 15-JUL-2002"
FT   CDS             join(7950259..7950303,7955563..7955639,7957414..7957466,
FT                   7961051..7961172,7963396..7963532,7965958..7966022,
FT                   7967886..7968020,7969136..7969281,7969697..7969823,
FT                   7970666..7970829,7971706..7971840,7972076..7972137,
FT                   7974076..7974209,7975568..7975725,7976344..7976394)
FT                   /codon_start=1
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /product="nucleolar protein 5, isoform CRA_b"
FT                   /note="gene_id=mCG116536.1 transcript_id=mCT117659.1
FT                   protein_id=mCP74519.1 isoform=CRA_b"
FT                   /protein_id="EDL00136.1"
FT                   /translation="MLVLFETSVGYAIFKVLNEKKLQEVDSLWKEFETPEKANKIVKLK
FT                   HFEKFQDTAEALAAFTALMEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNL
FT                   SCIHSPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIV
FT                   QAISLLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASASL
FT                   SEFLSEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMA
FT                   IAPNVTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGL
FT                   IYHASLVGQSSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRILE
FT                   DRGIRKISGTGKALAKAEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEEVDKEDEITEKK
FT                   AKKAKIKIKAEVEEEMEEEEAEEEQVVEEEPTVKKKKKKDKKKHIKEEPLSEEEPCTST
FT                   AVPSPEKKKKKKKKKDAED"
FT   mRNA            join(7957611..7957805,7961051..7961172,7963396..7963532,
FT                   7965958..7966022,7967886..7968020,7969136..7969281,
FT                   7969697..7969823,7970666..7970829,7971706..7971840,
FT                   7972076..7972137,7974076..7974209,7975568..7975725,
FT                   7976344..7976581)
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /product="nucleolar protein 5, transcript variant
FT                   mCT170699"
FT                   /note="gene_id=mCG116536.1 transcript_id=mCT170699.0
FT                   created on 15-JUL-2002"
FT   CDS             join(7961065..7961172,7963396..7963532,7965958..7966022,
FT                   7967886..7968020,7969136..7969281,7969697..7969823,
FT                   7970666..7970829,7971706..7971840,7972076..7972137,
FT                   7974076..7974209,7975568..7975725,7976344..7976394)
FT                   /codon_start=1
FT                   /gene="Nol5"
FT                   /locus_tag="mCG_116536"
FT                   /product="nucleolar protein 5, isoform CRA_a"
FT                   /note="gene_id=mCG116536.1 transcript_id=mCT170699.0
FT                   protein_id=mCP93617.0 isoform=CRA_a"
FT                   /protein_id="EDL00135.1"
FT                   /translation="MEGKINKQLKKVLKKIVKEAHEPLAVADAKLGGVIKEKLNLSCIH
FT                   SPVVNELMRGIRSQMDGLIPGVEPREMAAMCLGLAHSLSRYRLKFSADKVDTMIVQAIS
FT                   LLDDLDKELNNYIMRCREWYGWHFPELGKIISDNLTYCKCLQKVGDRKNYASASLSEFL
FT                   SEEVEAEVKAAAEISMGTEVSEEDICNILHLCTQVIEISEYRTQLYEYLQNRMMAIAPN
FT                   VTVMVGELVGARLIAHAGSLLNLAKHAASTVQILGAEKALFRALKSRRDTPKYGLIYHA
FT                   SLVGQSSPKHKGKISRMLAAKTVLAIRYDAFGEDSSSAMGIENRAKLEARLRILEDRGI
FT                   RKISGTGKALAKAEKYEHKSEVKTYDPSGDSTLPTCSKKRKIEEVDKEDEITEKKAKKA
FT                   KIKIKAEVEEEMEEEEAEEEQVVEEEPTVKKKKKKDKKKHIKEEPLSEEEPCTSTAVPS
FT                   PEKKKKKKKKKDAED"
FT   gap             7992589..7992730
FT                   /estimated_length=142
FT   gap             8021129..8021444
FT                   /estimated_length=316
FT   gap             8025924..8026059
FT                   /estimated_length=136
FT   gap             8028260..8028282
FT                   /estimated_length=23
FT   gene            8029460..8136199
FT                   /gene="Bmpr2"
FT                   /locus_tag="mCG_116535"
FT                   /note="gene_id=mCG116535.1"
FT   mRNA            join(8029460..8029910,8078934..8079104,8080587..8080757,
FT                   8106771..8106881,8108083..8108174,8110818..8111048,
FT                   8112398..8112512,8116517..8116677,8117633..8117780,
FT                   8124512..8124648,8129121..8129293,8132676..8133955,
FT                   8135575..8136199)
FT                   /gene="Bmpr2"
FT                   /locus_tag="mCG_116535"
FT                   /product="bone morphogenic protein receptor, type II
FT                   (serine/threonine kinase)"
FT                   /note="gene_id=mCG116535.1 transcript_id=mCT117658.1
FT                   created on 16-JUL-2002"
FT   CDS             join(8029835..8029910,8078934..8079104,8080587..8080757,
FT                   8106771..8106881,8108083..8108174,8110818..8111048,
FT                   8112398..8112512,8116517..8116677,8117633..8117780,
FT                   8124512..8124648,8129121..8129293,8132676..8133955,
FT                   8135575..8135825)
FT                   /codon_start=1
FT                   /gene="Bmpr2"
FT                   /locus_tag="mCG_116535"
FT                   /product="bone morphogenic protein receptor, type II
FT                   (serine/threonine kinase)"
FT                   /note="gene_id=mCG116535.1 transcript_id=mCT117658.1
FT                   protein_id=mCP74792.1"
FT                   /protein_id="EDL00137.1"
FT                   /translation="MTSSLHRPFRVPWLLWAVLLVSTTAASQNQERLCAFKDPYQQDLG
FT                   IGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTT
FT                   PPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAV
FT                   LIVALCFGYRMLTGDRKQGLHSMNMMEAAAAEPSLDLDNLKLLELIGRGRYGAVYKGSL
FT                   DERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEY
FT                   YPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVL
FT                   VKNDGACVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCES
FT                   ALKQVDMYALGLIYWEVFMRCTDLFPGESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQ
FT                   RPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPT
FT                   VNPMSTAMQNERNLSHNRRVPKIGPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTP
FT                   LTIGEKNRNSINYERQQAQARIPSPETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYP
FT                   DETHLHATNVAQSIGPTPVCLQLTEEDLETNKLDPKEVDKNLKESSDENLMEHSLKQFS
FT                   GPDPLSSTSSSLLYPLIKLAVEVTGQQDFTQAANGQACLIPDVPPAQIYPLPKQQNLPK
FT                   RPTSLPLNTKNSTKEPRLKFGNKHKSNLKQVETGVAKMNTINAAEPHVVTVTMNGVAGR
FT                   SHNVNSHAATTQYANGAVPAGQAANIVAHRSQEMLQNQFIGEDTRLNINSSPDEHEPLL
FT                   RREQQAGHDEGVLDRLVDRRERPLEGGRTNSNNNNSNPCSEQDILTQGVTSTAADPGPS
FT                   KPRRAQRPNSLDLSATNILDGSSIQIGESTQDGKSGSGEKIKRRVKTPYSLKRWRPSTW
FT                   VISTEPLDCEVNNNGSDRAVHSKSSTAVYLAEGGTATTTVSKDIGMNCL"
FT   gap             8035021..8035181
FT                   /estimated_length=161
FT   gap             8051471..8051490
FT                   /estimated_length=20
FT   gap             8058740..8058759
FT                   /estimated_length=20
FT   gap             8071066..8071202
FT                   /estimated_length=137
FT   gap             8150543..8150671
FT                   /estimated_length=129
FT   gap             8154435..8154454
FT                   /estimated_length=20
FT   gap             8163042..8163660
FT                   /estimated_length=619
FT   gap             8177886..8179260
FT                   /estimated_length=1375
FT   gene            <8179516..8251192
FT                   /gene="Als2cr13"
FT                   /locus_tag="mCG_116544"
FT                   /note="gene_id=mCG116544.1"
FT   mRNA            join(<8179516..8179585,8214886..8215037,8218768..8218857,
FT                   8224155..8224268,8234801..8234944,8236333..8236558,
FT                   8240730..8240850,8247256..8251192)
FT                   /gene="Als2cr13"
FT                   /locus_tag="mCG_116544"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   chromosome region, candidate 13 (human)"
FT                   /note="gene_id=mCG116544.1 transcript_id=mCT117667.1
FT                   created on 06-SEP-2002"
FT   CDS             join(<8214888..8215037,8218768..8218857,8224155..8224268,
FT                   8234801..8234944,8236333..8236558,8240730..8240850,
FT                   8247256..8247574)
FT                   /codon_start=1
FT                   /gene="Als2cr13"
FT                   /locus_tag="mCG_116544"
FT                   /product="amyotrophic lateral sclerosis 2 (juvenile)
FT                   chromosome region, candidate 13 (human)"
FT                   /note="gene_id=mCG116544.1 transcript_id=mCT117667.1
FT                   protein_id=mCP74654.1"
FT                   /protein_id="EDL00138.1"
FT                   /translation="DKTHPPSSSSSSIIRRTSSLDTLAAPYLAGHWPRDIRGQAAPCMR
FT                   DKATQTESAWAEEYEKKKGSHKRSSSWGSTEQLKEIAKLRQQLQRSKHSSRHHRDKERQ
FT                   SPFHGNHAAINQSQAPAPKSTLVPAGPITKSSGSRFRNSVEGLNQEIEIIIKETGEKEE
FT                   QLIPQDIPDGHRAPPPLAQRSSSTRSIDTQTPGGADKGSNNSSRSQSVSPTSFLTISNE
FT                   GSEESPCSADDLLADPRDKENGNNSPLPKYATSPKPNNSYMFKREPPEGCERVKVFEEC
FT                   SPKQLHEIPAFYCPDKNKVNFIPKSGSAFCLVSILKPLLPTPDLTLKGSGHSLTVTTGM
FT                   TTTLLQPISMASLSTNTEQERVSRGTSTVLPSASLHAPPEPIEEAEG"
FT   gap             8225313..8225332
FT                   /estimated_length=20
FT   gap             8252427..8252446
FT                   /estimated_length=20
FT   gene            complement(8256187..8309258)
FT                   /gene="Ica1l"
FT                   /locus_tag="mCG_116545"
FT                   /note="gene_id=mCG116545.1"
FT   mRNA            complement(join(8256187..8257038,8263252..8263512,
FT                   8269457..8269506,8272182..8272267,8273756..8273854,
FT                   8276057..8276182,8279768..8279966,8281660..8281783,
FT                   8288530..8288602,8294020..8294198,8309206..8309258))
FT                   /gene="Ica1l"
FT                   /locus_tag="mCG_116545"
FT                   /product="islet cell autoantigen 1-like"
FT                   /note="gene_id=mCG116545.1 transcript_id=mCT117668.1
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(8256923..8257038,8263252..8263512,
FT                   8269457..8269506,8272182..8272267,8273756..8273854,
FT                   8276057..8276182,8279768..8279966,8281660..8281706))
FT                   /codon_start=1
FT                   /gene="Ica1l"
FT                   /locus_tag="mCG_116545"
FT                   /product="islet cell autoantigen 1-like"
FT                   /note="gene_id=mCG116545.1 transcript_id=mCT117668.1
FT                   protein_id=mCP74660.1"
FT                   /protein_id="EDL00139.1"
FT                   /translation="MMDAAGKALCSSAKQRLALCTPLSRLKQEVATFSQRAISDTLVTI
FT                   NRMERARTEYRGALLWMKDASQELDPDTFKQMEKFRKVQNQVRNSKDSFDKLKKDVCQK
FT                   VDLLGASRCNMLSHSLTTYQRTLLGFWEKTAQMMTQIQEACAGFHPYDFLALKRLQDTP
FT                   GNLTADCTEGQTEGSCLTTDLNKVALSEEEEEERFEREPAVARALPRDSLEGDDFEKEF
FT                   SFLNSLLSPTSSSASEFTQECQPACGSPCTGLTSQEPSVGPGSLTSSSQFLPSQLFDLG
FT                   LHADGAFNTPNNGNQDMSAWFNLFADLGPLSNPDAIGHSDDELLNA"
FT   gap             8270029..8270278
FT                   /estimated_length=250
FT   gap             8308990..8309176
FT                   /estimated_length=187
FT   gene            8318227..8319705
FT                   /pseudo
FT                   /locus_tag="mCG_1035585"
FT                   /note="gene_id=mCG1035585.1"
FT   mRNA            join(8318227..8319244,8319652..8319705)
FT                   /pseudo
FT                   /locus_tag="mCG_1035585"
FT                   /note="gene_id=mCG1035585.1 transcript_id=mCT153289.0
FT                   created on 19-MAR-2003"
FT   gene            complement(8343006..8364638)
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /note="gene_id=mCG116539.1"
FT   mRNA            complement(join(8343006..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363865,8364281..8364638))
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, transcript variant
FT                   mCT117662"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT117662.1
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(8343006..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363865,8364183..8364248))
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, transcript variant
FT                   mCT170700"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT170700.0
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(8343006..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8364045))
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, transcript variant
FT                   mCT170701"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT170701.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(8344301..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363685))
FT                   /codon_start=1
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, isoform CRA_a"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT170700.0
FT                   protein_id=mCP93619.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4V9X1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR028599"
FT                   /db_xref="MGI:MGI:1927241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V9X1"
FT                   /protein_id="EDL00140.1"
FT                   /translation="MAQLQARFYSENKKYAVDDVPFSIPAAAEVADLSNIINKLLETKN
FT                   ELHKHVEFDFLIKGQFLRVPLVKHMELENISSEEVVELEYVEKYTAPQPEQCMFHDDWI
FT                   SSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLTASM
FT                   DQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVPTD
FT                   EEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAEEICSASWDHTIR
FT                   VWDVESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTS
FT                   HTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGL
FT                   LLSGGADNKLYSYSYSPTTSHVGA"
FT   CDS             complement(join(8344301..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363685))
FT                   /codon_start=1
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, isoform CRA_a"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT170701.0
FT                   protein_id=mCP93618.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q4V9X1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR028599"
FT                   /db_xref="MGI:MGI:1927241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V9X1"
FT                   /protein_id="EDL00141.1"
FT                   /translation="MAQLQARFYSENKKYAVDDVPFSIPAAAEVADLSNIINKLLETKN
FT                   ELHKHVEFDFLIKGQFLRVPLVKHMELENISSEEVVELEYVEKYTAPQPEQCMFHDDWI
FT                   SSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLTASM
FT                   DQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVPTD
FT                   EEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAEEICSASWDHTIR
FT                   VWDVESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTS
FT                   HTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGL
FT                   LLSGGADNKLYSYSYSPTTSHVGA"
FT   CDS             complement(join(8344301..8344378,8346656..8346728,
FT                   8348174..8348306,8348428..8348533,8348646..8348786,
FT                   8349892..8349977,8351848..8351893,8353183..8353337,
FT                   8354178..8354293,8355389..8355495,8357157..8357251,
FT                   8360569..8360663,8363645..8363685))
FT                   /codon_start=1
FT                   /gene="Wdr12"
FT                   /locus_tag="mCG_116539"
FT                   /product="WD repeat domain 12, isoform CRA_a"
FT                   /note="gene_id=mCG116539.1 transcript_id=mCT117662.1
FT                   protein_id=mCP74537.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q4V9X1"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR012972"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR028599"
FT                   /db_xref="MGI:MGI:1927241"
FT                   /db_xref="UniProtKB/TrEMBL:Q4V9X1"
FT                   /protein_id="EDL00142.1"
FT                   /translation="MAQLQARFYSENKKYAVDDVPFSIPAAAEVADLSNIINKLLETKN
FT                   ELHKHVEFDFLIKGQFLRVPLVKHMELENISSEEVVELEYVEKYTAPQPEQCMFHDDWI
FT                   SSIEGAEEWILSGSYDKTSRIWSLEGKSIMTIVGHTDVVKDVAWVKKDSLSCLLLTASM
FT                   DQTVLLWEWNVEKNKVKALHCCRGHAGSVDAIAVDSSGAKFCSGSWDKMLKIWSTVPTD
FT                   EEDEMEEATNRPRKKQKTEQLGLTRTPLVTLSGHTEAISSVLWSDAEEICSASWDHTIR
FT                   VWDVESGGLKSTLTGNKVFNCISYSPLCKRLASGSTDRHIRLWDPRTKDGSLVSLSLTS
FT                   HTGWVTSVKWSPTHEQQLISGSLDNIVKLWDTRSCKAPLYDLAAHEDKVLSVDWTDTGL
FT                   LLSGGADNKLYSYSYSPTTSHVGA"
FT   gene            <8364384..8417193
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /note="gene_id=mCG145854.0"
FT   mRNA            join(<8364384..8364445,8368765..8368922,8371449..8371572,
FT                   8374221..8374338,8375465..8375587,8390993..8391053,
FT                   8391221..8391287,8392062..8392176,8394131..8394215,
FT                   8397986..8398175,8402406..8402526,8405342..8405485,
FT                   8407494..8407727,8410153..8410315,8412268..8412331,
FT                   8413527..8413639,8413992..8414361,8416740..8417193)
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /product="calcium response factor, transcript variant
FT                   mCT185962"
FT                   /note="gene_id=mCG145854.0 transcript_id=mCT185962.0
FT                   created on 03-JUL-2003"
FT   mRNA            join(<8364416..8364445,8371449..8371565,8374221..8374338,
FT                   8375360..8375587,8390993..8391053,8392062..8392176,
FT                   8394131..8394215,8397986..8398175,8402406..8402526,
FT                   8405342..8405485,8407494..8407727,8410153..8410315,
FT                   8412268..8412331,8413527..8413639,8413992..8414361,
FT                   8416740..8417193)
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /product="calcium response factor, transcript variant
FT                   mCT189263"
FT                   /note="gene_id=mCG145854.0 transcript_id=mCT189263.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<8374228..8374338,8375360..8375587,8390993..8391053,
FT                   8392062..8392176,8394131..8394215,8397986..8398175,
FT                   8402406..8402526,8405342..8405485,8407494..8407727,
FT                   8410153..8410315,8412268..8412331,8413527..8413639,
FT                   8413992..8414361,8416740..8416846)
FT                   /codon_start=1
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /product="calcium response factor, isoform CRA_b"
FT                   /note="gene_id=mCG145854.0 transcript_id=mCT189263.0
FT                   protein_id=mCP110293.0 isoform=CRA_b"
FT                   /protein_id="EDL00144.1"
FT                   /translation="LIRENGTECEASMEQRHSLAGNCDDGEKSEREAQGFEHRTCMDSG
FT                   DPSFGQNDPPTILPITAPKTYDSLTSQDMPETLTDTQALHEEQFHLLDQNGQPIQYDLQ
FT                   SLGNSTAQMTGMEQVAIPQEPFADEHSPQDISEEKPTGVRADVLEDSTSNYGLRSPASL
FT                   VLPKKAGARLVEEPLLAPLQPLSCNTPMWACRLRSCEKIGDSYRGYCVSETELESVLTF
FT                   HKQQTQTVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSRAVVMECQYGPRRKGF
FT                   QLKKISEQESRSCHLYKATCPARIYIKKVQKFPEYRVPTDPQIDRKIIRLEQEKAFTML
FT                   KKNLMDAGGVLRWYVQLPTQQAHQYHESETPGVPLSPSPFPMSPLEEEEAIVRDENCAL
FT                   PSRLHPQVAHKIQELVSQGVGQVYAVRKQLRKFVERELFKPDEIPERHNLSYFPTVNDI
FT                   KNHIHEVQKSLRTGDVVYNSEIIPATLQWTTDSGNILRETVTVTFAEGNLLGEPIPSKM
FT                   GTSQTQTAVSPEPLSSFPPKIFTHFQALKLQPRLSSPDGSQALVSVDSHASSSPPGLVD
FT                   TVGNAEVDNHSVLLGQSQNPGTDTCLTQDNSTSSSTGHLPESVPNPVAEDQLLEGEDVE
FT                   DAGNPEGSVNRTLLGDVQTVPIQIIDSRPVLVEESLSKNQVKQETNEPTLSTEAKTFLD
FT                   CKKISAT"
FT   gene            8383374..8383867
FT                   /pseudo
FT                   /locus_tag="mCG_116537"
FT                   /note="gene_id=mCG116537.1"
FT   mRNA            8383374..8383867
FT                   /pseudo
FT                   /locus_tag="mCG_116537"
FT                   /note="gene_id=mCG116537.1 transcript_id=mCT117660.0
FT                   created on 16-JUL-2002"
FT   CDS             join(<8391254..8391287,8392062..8392176,8394131..8394215,
FT                   8397986..8398175,8402406..8402526,8405342..8405485,
FT                   8407494..8407727,8410153..8410315,8412268..8412331,
FT                   8413527..8413639,8413992..8414361,8416740..8416846)
FT                   /codon_start=1
FT                   /gene="Carf"
FT                   /locus_tag="mCG_145854"
FT                   /product="calcium response factor, isoform CRA_a"
FT                   /note="gene_id=mCG145854.0 transcript_id=mCT185962.0
FT                   protein_id=mCP107687.0 isoform=CRA_a"
FT                   /protein_id="EDL00143.1"
FT                   /translation="SWLTLASSQMTNISEEKPTGVRADVLEDSTSNYGLRSPASLVLPK
FT                   KAGARLVEEPLLAPLQPLSCNTPMWACRLRSCEKIGDSYRGYCVSETELESVLTFHKQQ
FT                   TQTVWGTRQSPSPAKPATRLMWKSQYVPYDGIPFVNAGSRAVVMECQYGPRRKGFQLKK
FT                   ISEQESRSCHLYKATCPARIYIKKVQKFPEYRVPTDPQIDRKIIRLEQEKAFTMLKKNL
FT                   MDAGGVLRWYVQLPTQQAHQYHESETPGVPLSPSPFPMSPLEEEEAIVRDENCALPSRL
FT                   HPQVAHKIQELVSQGVGQVYAVRKQLRKFVERELFKPDEIPERHNLSYFPTVNDIKNHI
FT                   HEVQKSLRTGDVVYNSEIIPATLQWTTDSGNILRETVTVTFAEGNLLGEPIPSKMGTSQ
FT                   TQTAVSPEPLSSFPPKIFTHFQALKLQPRLSSPDGSQALVSVDSHASSSPPGLVDTVGN
FT                   AEVDNHSVLLGQSQNPGTDTCLTQDNSTSSSTGHLPESVPNPVAEDQLLEGEDVEDAGN
FT                   PEGSVNRTLLGDVQTVPIQIIDSRPVLVEESLSKNQVKQETNEPTLSTEAKTFLDCKKI
FT                   SAT"
FT   gap             8406257..8406276
FT                   /estimated_length=20
FT   gap             8438838..8438857
FT                   /estimated_length=20
FT   gene            8447725..8597842
FT                   /locus_tag="mCG_116543"
FT                   /note="gene_id=mCG116543.1"
FT   mRNA            join(8447725..8447984,8460735..8460826,8461246..8461407,
FT                   8466336..8466417,8467095..8467222,8472565..8472647,
FT                   8483427..8483512,8488298..8488604,8490856..8490962,
FT                   8496833..8496916,8501028..8501126,8501212..8501792,
FT                   8502602..8502734,8503328..8503447,8504803..8505107,
FT                   8508771..8508856,8511026..8511115,8513848..8514016,
FT                   8514595..8514728,8517267..8517426,8517536..8517638,
FT                   8519584..8519740,8521126..8521284,8523662..8523821,
FT                   8524883..8524971,8526466..8527026,8527643..8527818,
FT                   8530512..8530665,8533992..8534297,8534616..8534765,
FT                   8536505..8536662,8538366..8538490,8543358..8543484,
FT                   8544146..8544294,8544900..8545033,8545932..8546033,
FT                   8547480..8547575,8548058..8548182,8550216..8550356,
FT                   8553544..8553674,8556148..8556257,8558067..8558184,
FT                   8559100..8559197,8562112..8562228,8571508..8571597,
FT                   8576437..8576546,8577160..8577332,8578384..8578478,
FT                   8585550..8585666,8585904..8586065,8594111..8594259,
FT                   8595378..8595513,8596942..8597842)
FT                   /locus_tag="mCG_116543"
FT                   /product="mCG116543"
FT                   /note="gene_id=mCG116543.1 transcript_id=mCT117666.1
FT                   created on 01-APR-2003"
FT   CDS             join(8503443..8503447,8504803..8505107,8508771..8508856,
FT                   8511026..8511115,8513848..8514016,8514595..8514728,
FT                   8517267..8517426,8517536..8517638,8519584..8519740,
FT                   8521126..8521284,8523662..8523821,8524883..8524971,
FT                   8526466..8527026,8527643..8527818,8530512..8530665,
FT                   8533992..8534297,8534616..8534765,8536505..8536662,
FT                   8538366..8538490,8543358..8543484,8544146..8544294,
FT                   8544900..8545033,8545932..8546033,8547480..8547575,
FT                   8548058..8548182,8550216..8550356,8553544..8553674,
FT                   8556148..8556257,8558067..8558184,8559100..8559197,
FT                   8562112..8562228,8571508..8571597,8576437..8576546,
FT                   8577160..8577332,8578384..8578478,8585550..8585666,
FT                   8585904..8586065,8594111..8594259,8595378..8595513,
FT                   8596942..8597043)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116543"
FT                   /product="mCG116543"
FT                   /note="gene_id=mCG116543.1 transcript_id=mCT117666.1
FT                   protein_id=mCP74609.1"
FT                   /protein_id="EDL00145.1"
FT                   /translation="MSHLLPVVLVQLGKEPLTPPPSQIPDPPFSTPITPHRTSFGGILS
FT                   SASWGGTIEKSKLFTKLISAGTQDSEWGCPTSLEGQLGSVIIFHEALQPPQVKALYLAG
FT                   PNCLSPWKCQDCDMADLPSNILLHYTGKACKNSICLDLSANCLHGRLTGNKVVNWDIKD
FT                   IINCIGGLNVLFPLLEQISHFSEGQTSEAMSENTVPELVTPSEQECMGLASTRASESRL
FT                   EKNLIATFILIVKHFIQRHPINQDNLIQSHGVATLGALLQKVPGSQMDVNVLMAIQLLI
FT                   EQVSLEKNTLLLQQMYQCLLFDFRIWNRGDFPFQIGHIQYLSTIIKDSRRVFRKKYGVQ
FT                   FLLDTLRIYYGHGSTCNELSPDDIRTIRTSLYGLIKYFLCKGGTHEEIQSIIGYIAATN
FT                   EEEQLFGILDILFSLLRTSPTRGQLFLLLFEPGNADILYALLLNQKYSDKLREIIFKVM
FT                   EQMLKCTNVYERSKQRIRLREVGYSGIGLLLNEAPVNTSLIKNLVNQIINTDPVINFKD
FT                   LLSVVYICHRTHVNVRVVLCRKILQILQSQPDAAYQISQQVGWQDTFVRLFLKANFENV
FT                   NSLNKHGKTVSMKENKNMSTEDVKRNFEKLDDEKMMLADVSSDHWSLEDSQSLNSNTPL
FT                   FQEDSSEGELSFKSENQEEFWHSNTSHLSLDLSGIDACELSDSGSQVPDSSPSTPSPVE
FT                   STKSFSLQSDKERSITNEMGFSDDFSFLESQERCEEELFQLLTNILNYVMCKGLEKSDE
FT                   DTWIERGQVFSALTKPGISSELLRPSDEVKLTLLQKMLEWAITENRDAKSSPVTAENAF
FT                   RLMLIVQDFLQSEGLVNSNMWTEKVCAMASAKLNALLQTKVIENQDEACYILGKLEHIL
FT                   SRSIKEQTEIYSFLIPLLRTLVSKIYELLFMNLHLPSLPFTNGSASFFEDFQEYCNSEE
FT                   WQVYIEKYIVPYMKQYEAHTFYDGHENMALYWKNCYEALMVNMHKRDREGGESKLKFQE
FT                   YFVEPFNRKARQENLRYNNMIKQLNSQQLAAVRRWKAIRLYLTCERGPWAEKKQNRIHW
FT                   KLANVENYSRMRLKLVPNYNFKTHEEASALRDNLGVQHLQPSSDSLLLEVVKQVKLSDM
FT                   EEDKLELLEEDMAARVNIDEKEEQNQKEKLVLTEDCELITVIDIIPGRLEVTTQHIYFH
FT                   DNSVEKEDGLGFDFKWPHSQIREIHLRRYNLRRSALEIFHVDQSNYFLNFKKEVRNKIY
FT                   SRLLSLHSPTGYGTRSPQELFKASGLTQKWVNREITNFDYLIQINTMAGRTYNDLAQYP
FT                   VFPWILQDYTSEELDLNNPTVFRDLSKPIGVVNEKNAKAMREKYENFEDPMGTIDKFHY
FT                   GTHYSNSAGVMHYLIRVEPFTTLHIQLQSGRFDCADRQFHSIPATWQALMDNTYDVKEL
FT                   IPEFFYFPEFLENQNEFNLGHLQVSKELVNDVILPRWAKSAEDFIYKHRKALESEYVSA
FT                   HLHEWIDLIFGYKQRGPAAVEALNVFYYCSYEGAVDLDALTDEKERKALEGMINNFGQT
FT                   PCQLLKEPHPPRLSAEEAIQKQTKTEISTLNLFQHLTELKSFFIEGISDGIPLLKAIIP
FT                   KNQSRSFMSQGSPELLITVSMNYVIGTHGWLPYDRNISNYFTFIKDQTVTNPKAQRTIS
FT                   GPFAPGLEITSKLFVVSHDAKLLFSAGHWDNSIQVMSLTKGKIVSHNIRHIDIVTCLAT
FT                   DYCGIHLISGSRDTTCMIWQITQQGGTPVGLAPKPFQILYGHTDEILSVGISTELDMAV
FT                   SGSRDGTVIIHTVQKGQYMRTLRLPCESSLFLTIPSLAISWEGHIVVYSSLEEKSVLKD
FT                   KNLLHLFSINGKYLGSQVLSEQISDMCIIGEHIITGSLQGLLSIRELHSLKLSVTPLAM
FT                   RLPIHCVSITKEYSHILVGLEDGKLIVVGVGKPAEMRSGQLSRKLWGSSKRLSQISAGE
FT                   TEYNTQDCK"
FT   gap             8591537..8591591
FT                   /estimated_length=55
FT   gap             8607658..8607677
FT                   /estimated_length=20
FT   gene            <8609393..8654205
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /note="gene_id=mCG116542.1"
FT   mRNA            join(<8609393..8609530,8618194..8618243,8618982..8619148,
FT                   8620586..8620728,8629308..8629475,8632767..8632845,
FT                   8637339..8637454,8638708..8638762,8642185..8642305,
FT                   8645520..8645631,8648550..8648614,8653051..8653140,
FT                   8653258..8654205)
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, transcript variant mCT117665"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT117665.1
FT                   created on 06-SEP-2002"
FT   CDS             join(<8609393..8609530,8618194..8618243,8618982..8619148,
FT                   8620586..8620728,8629308..8629475,8632767..8632845,
FT                   8637339..8637454,8638708..8638762,8642185..8642305,
FT                   8645520..8645631,8648550..8648614,8653051..8653140,
FT                   8653258..8653435)
FT                   /codon_start=1
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, isoform CRA_c"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT117665.1
FT                   protein_id=mCP74597.1 isoform=CRA_c"
FT                   /protein_id="EDL00148.1"
FT                   /translation="LPSCGRHHGAHGRGPRGRARGSMLDFAIFAVTFLLALVGAVLYLY
FT                   PASRQASGIPGLTPTEEKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLG
FT                   TTDVLKQHFNPNKTSDPFETMLKSLLGYQSGGGSAGEDHVRRKLYGDAVTASLHSNFPL
FT                   LLQLSEELLDKWLSYPETQHIPLSQHMLGFALKFVTRMVLGSTFEDEQEVIRFQKIHGT
FT                   VWSEIGKGFLDGSLDKNTTRKKQYQEALMQLESTLKKIIKERKGGNFRQHTFIDSLTQG
FT                   KLNEQQILEDCVVFSLASCIITARLCTWTIHFLTTTGEVQKKLCKEIDQVLGEGPITSE
FT                   KIEQLSYCQQVLFETVRTAKLTPVSARLQDIEGKVGPFVIPKETLVLYALGVVLQDPST
FT                   WPLPHRFDPDRFADEPVMKVFSSLGFSGTWECPELSNQLTLFRSRFAYMVTAVLVSVLL
FT                   KRLRLLAVDRQVFEMKYELVTSAREEAWITVSKRH"
FT   mRNA            join(<8609441..8609530,8618194..8618243,8618982..8619148,
FT                   8620586..8620728,8629308..8629475,8632767..8632845,
FT                   8637339..8637454,8638708..8638762,8642185..8642305,
FT                   8645520..8645631,8648550..8648614,8653051..8653140,
FT                   8653285..8653533)
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, transcript variant mCT189315"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT189315.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<8609441..8609530,8618194..8618243,8618982..8619148,
FT                   8620586..8620728,8629308..8629475,8632767..8632845,
FT                   8637339..8637454,8638708..8638762,8642185..8642305,
FT                   8645520..8645631,8648550..8648614,8653051..8653140,
FT                   8653285..8653435)
FT                   /codon_start=1
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, isoform CRA_a"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT189315.0
FT                   protein_id=mCP110299.0 isoform=CRA_a"
FT                   /protein_id="EDL00146.1"
FT                   /translation="GRARGSMLDFAIFAVTFLLALVGAVLYLYPASRQASGIPGLTPTE
FT                   EKDGNLPDIVNSGSLHEFLVNLHERYGPVVSFWFGRRLVVSLGTTDVLKQHFNPNKTSD
FT                   PFETMLKSLLGYQSGGGSAGEDHVRRKLYGDAVTASLHSNFPLLLQLSEELLDKWLSYP
FT                   ETQHIPLSQHMLGFALKFVTRMVLGSTFEDEQEVIRFQKIHGTVWSEIGKGFLDGSLDK
FT                   NTTRKKQYQEALMQLESTLKKIIKERKGGNFRQHTFIDSLTQGKLNEQQILEDCVVFSL
FT                   ASCIITARLCTWTIHFLTTTGEVQKKLCKEIDQVLGEGPITSEKIEQLSYCQQVLFETV
FT                   RTAKLTPVSARLQDIEGKVGPFVIPKETLVLYALGVVLQDPSTWPLPHRFDPDRFADEP
FT                   VMKVFSSLGFSGTWECPELRFAYMVTAVLVSVLLKRLRLLAVDRQVFEMKYELVTSARE
FT                   EAWITVSKRH"
FT   mRNA            join(<8609461..8609530,8618194..8618243,8620586..8620728,
FT                   8629308..8629475,8632767..8632845,8637339..8637454,
FT                   8638708..8638762,8642185..8642305,8645520..8645631,
FT                   8648550..8648614,8653051..8653140,8653285..8654205)
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, transcript variant mCT189316"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT189316.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<8609487..8609530,8618194..8618243,8620586..8620728,
FT                   8629308..8629475,8632767..8632845,8637339..8637454,
FT                   8638708..8638762,8642185..8642305,8645520..8645631,
FT                   8648550..8648614,8653051..8653140,8653285..8653435)
FT                   /codon_start=1
FT                   /gene="Cyp20a1"
FT                   /locus_tag="mCG_116542"
FT                   /product="cytochrome P450, family 20, subfamily A,
FT                   polypeptide 1, isoform CRA_b"
FT                   /note="gene_id=mCG116542.1 transcript_id=mCT189316.0
FT                   protein_id=mCP110300.0 isoform=CRA_b"
FT                   /protein_id="EDL00147.1"
FT                   /translation="RSCWRWWERCCTSTRLPGKLQEFQGLLQLKKTDPFETMLKSLLGY
FT                   QSGGGSAGEDHVRRKLYGDAVTASLHSNFPLLLQLSEELLDKWLSYPETQHIPLSQHML
FT                   GFALKFVTRMVLGSTFEDEQEVIRFQKIHGTVWSEIGKGFLDGSLDKNTTRKKQYQEAL
FT                   MQLESTLKKIIKERKGGNFRQHTFIDSLTQGKLNEQQILEDCVVFSLASCIITARLCTW
FT                   TIHFLTTTGEVQKKLCKEIDQVLGEGPITSEKIEQLSYCQQVLFETVRTAKLTPVSARL
FT                   QDIEGKVGPFVIPKETLVLYALGVVLQDPSTWPLPHRFDPDRFADEPVMKVFSSLGFSG
FT                   TWECPELRFAYMVTAVLVSVLLKRLRLLAVDRQVFEMKYELVTSAREEAWITVSKRH"
FT   gap             8622953..8622972
FT                   /estimated_length=20
FT   gap             8624755..8624833
FT                   /estimated_length=79
FT   gap             8627737..8627806
FT                   /estimated_length=70
FT   gap             8660449..8660633
FT                   /estimated_length=185
FT   gene            <8675835..8747381
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /note="gene_id=mCG116541.2"
FT   mRNA            join(<8675835..8675971,8700440..8700607,8703253..8703429,
FT                   8705139..8705156,8710182..8710279,8713496..8713642,
FT                   8714314..8714438,8716307..8716489,8719840..8719998,
FT                   8736890..8737063,8742964..8747381)
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, transcript variant mCT173664"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT173664.1
FT                   created on 07-DEC-2004"
FT   mRNA            join(<8675835..8675971,8700440..8700607,8703253..8703429,
FT                   8710182..8710279,8713496..8713642,8714314..8714438,
FT                   8719840..8719998,8730765..8730851,8736890..8737063,
FT                   8742964..8747381)
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, transcript variant mCT117664"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT117664.2
FT                   created on 07-DEC-2004"
FT   mRNA            join(<8675835..8675971,8700440..8700607,8703253..8703429,
FT                   8710182..8710279,8713496..8713642,8714314..8714438,
FT                   8719840..8719998,8736890..8737063,8742964..8747381)
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, transcript variant mCT173663"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT173663.1
FT                   created on 07-DEC-2004"
FT   gap             8675972..8676393
FT                   /estimated_length=422
FT   CDS             join(<8700440..8700607,8703253..8703429,8705139..8705156,
FT                   8710182..8710279,8713496..8713642,8714314..8714438,
FT                   8716307..8716489,8719840..8719998,8736890..8737063,
FT                   8742964..8743139)
FT                   /codon_start=1
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, isoform CRA_c"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT173664.1
FT                   protein_id=mCP96583.1 isoform=CRA_c"
FT                   /protein_id="EDL00151.1"
FT                   /translation="SPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLR
FT                   RMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDY
FT                   TILDDIGHGVKWLLRFKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLE
FT                   PVRPPVVPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSREN
FT                   SGSGSVGVPIAVPTPSPPSVFPAPAGSAGTPPLPATSASVPTPLVPATVPSSTAPDAAA
FT                   GGAQSLADGFTSPTPPVISSNPPTGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITS
FT                   QTSLQNQMNGGPFYNQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSD
FT                   PYAEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVT
FT                   GLFPGNYVESIMHYSE"
FT   CDS             join(<8700440..8700607,8703253..8703429,8710182..8710279,
FT                   8713496..8713642,8714314..8714438,8719840..8719998,
FT                   8730765..8730851,8736890..8737063,8742964..8743139)
FT                   /codon_start=1
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, isoform CRA_a"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT117664.2
FT                   protein_id=mCP74593.2 isoform=CRA_a"
FT                   /protein_id="EDL00149.1"
FT                   /translation="SPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLR
FT                   RMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDY
FT                   TILDDIGHGVKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPV
FT                   VPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSV
FT                   GVPIAVPTPSPPSVFPGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQM
FT                   NGGPFYNQNPVSLAPPPPSILQVTPQLPLMGFVARVQENISDTPPPPPPVEEPVFDESP
FT                   PPPPPPEDYEEEEAAVVEYSDPYAEEDPPWAPRAYLEKVVAIYDYTKDKEDELSFQEGA
FT                   IIYVIKKNDDGWYEGVMNGVTGLFPGNYVESIMHYSE"
FT   CDS             join(<8700440..8700607,8703253..8703429,8710182..8710279,
FT                   8713496..8713642,8714314..8714438,8719840..8719998,
FT                   8736890..8737063,8742964..8743139)
FT                   /codon_start=1
FT                   /gene="Abi2"
FT                   /locus_tag="mCG_116541"
FT                   /product="abl-interactor 2, isoform CRA_b"
FT                   /note="gene_id=mCG116541.2 transcript_id=mCT173663.1
FT                   protein_id=mCP96582.1 isoform=CRA_b"
FT                   /protein_id="EDL00150.1"
FT                   /translation="SPDKQRALEETKAYTTQSLASVAYLINTLANNVLQMLDIQASQLR
FT                   RMESSINHISQTVDIHKEKVARREIGILTTNKNTSRTHKIIAPANLERPVRYIRKPIDY
FT                   TILDDIGHGVKVSTQNMKMGGLPRTTPPTQKPPSPPMSGKGTLGRHSPYRTLEPVRPPV
FT                   VPNDYVPSPTRNMAPSQQSPVRTASVNQRNRTYSSSGSSGGSHPSSRSSSRENSGSGSV
FT                   GVPIAVPTPSPPSVFPGHPVQFYSMNRPASRHTPPTIGGSLPYRRPPSITSQTSLQNQM
FT                   NGGPFYNQNPVSDTPPPPPPVEEPVFDESPPPPPPPEDYEEEEAAVVEYSDPYAEEDPP
FT                   WAPRAYLEKVVAIYDYTKDKEDELSFQEGAIIYVIKKNDDGWYEGVMNGVTGLFPGNYV
FT                   ESIMHYSE"
FT   gap             8711999..8712018
FT                   /estimated_length=20
FT   gene            complement(8749409..8832840)
FT                   /locus_tag="mCG_116540"
FT                   /note="gene_id=mCG116540.1"
FT   mRNA            complement(join(8749409..8756038,8757574..8757817,
FT                   8759436..8759754,8761489..8761609,8762299..8762397,
FT                   8764498..8764608,8765554..8765697,8766629..8766694,
FT                   8767830..8767951,8768899..8769058,8769592..8769669,
FT                   8791670..8792178,8793462..8793567,8799365..8799484,
FT                   8832641..8832840))
FT                   /locus_tag="mCG_116540"
FT                   /product="mCG116540, transcript variant mCT117663"
FT                   /note="gene_id=mCG116540.1 transcript_id=mCT117663.1
FT                   created on 06-SEP-2002"
FT   mRNA            complement(join(8749411..8749564,8759612..8759754,
FT                   8761489..8761609,8762299..8762397,8764498..8764608,
FT                   8765554..8765697,8766629..8766694,8767830..8767951,
FT                   8768899..8769058,8769592..8769669,8776491..8776565,
FT                   8785058..8785138,8791670..8792178,8793462..8793567,
FT                   8799365..8799484,8832641..8832840))
FT                   /locus_tag="mCG_116540"
FT                   /product="mCG116540, transcript variant mCT172698"
FT                   /note="gene_id=mCG116540.1 transcript_id=mCT172698.0
FT                   created on 06-SEP-2002"
FT   CDS             complement(join(8749460..8749564,8759612..8759754,
FT                   8761489..8761609,8762299..8762397,8764498..8764608,
FT                   8765554..8765697,8766629..8766694,8767830..8767951,
FT                   8768899..8769058,8769592..8769669,8776491..8776565,
FT                   8785058..8785138,8791670..8792178,8793462..8793567,
FT                   8799365..8799484))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116540"
FT                   /product="mCG116540, isoform CRA_b"
FT                   /note="gene_id=mCG116540.1 transcript_id=mCT172698.0
FT                   protein_id=mCP95617.0 isoform=CRA_b"
FT                   /db_xref="GOA:G5E867"
FT                   /db_xref="InterPro:IPR000159"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="MGI:MGI:1924550"
FT                   /db_xref="UniProtKB/TrEMBL:G5E867"
FT                   /protein_id="EDL00153.1"
FT                   /translation="MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDRLTQSLDSD
FT                   KPKEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIG
FT                   SGNSKRQVTEPKVPQKLPAGRHTSKHGTLRGPSSSSNRTTKPSHANYSLDDITAQLEQA
FT                   SLSMDEAAQQSLVEDPKPLVTNQHRRTASAGTVSDAEARSISNSSRSSITSAASSMDSL
FT                   DIDKVTRPQELDLTTHQGQPITEHAISLSCPSKQAKHHSDFTEEQAELTPHSYLDRETS
FT                   LLLRNIAGKPSHLLTKEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDDSSKTMMV
FT                   DERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLNWTRDSQN
FT                   KLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPEIEGVLWL
FT                   KDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYRNKYKAPT
FT                   DCCLALKHPQIQKKSQYIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNYQEALKRTESA
FT                   YDWTSLSSSSIKSGSSSSSIPESQSNHSNQSDSGVSDTLPTGHIRSQSTVSSIFSEAWK
FT                   RGTQLEESSKRTRVQFPAPSSGNSKPPITPAPKDPMSSSGLQGT"
FT   CDS             complement(join(8754524..8756038,8757574..8757817,
FT                   8759436..8759754,8761489..8761609,8762299..8762397,
FT                   8764498..8764608,8765554..8765697,8766629..8766694,
FT                   8767830..8767951,8768899..8769058,8769592..8769669,
FT                   8791670..8792178,8793462..8793567,8799365..8799484))
FT                   /codon_start=1
FT                   /locus_tag="mCG_116540"
FT                   /product="mCG116540, isoform CRA_a"
FT                   /note="gene_id=mCG116540.1 transcript_id=mCT117663.1
FT                   protein_id=mCP74575.1 isoform=CRA_a"
FT                   /protein_id="EDL00152.1"
FT                   /translation="MEQLSDEEIDHGAEEDSDKEDQDLDKMFGAWLGELDRLTQSLDSD
FT                   KPKEPVKRSPLRQETNMANFSYRFSIYNLNEALNQGETVDLDALMADLCSIEQELSSIG
FT                   SGNSKRQVTEPKVPQKLPAGRHTSKHGTLRGPSSSSNRTTKPSHANYSLDDITAQLEQA
FT                   SLSMDEAAQQSLVEDPKPLVTNQHRRTASAGTVSDAEARSISNSSRSSITSAASSMDSL
FT                   DIDKVTRPQELDLTTHQGQPITEEEQAAKLKAEKIRVALEKIKEAQVKKLVIRVHMSDD
FT                   SSKTMMVDERQTVRQVLDNLMDKSHCGYSLDWSLVETISELQMERIFEDHENLVENLLN
FT                   WTRDSQNKLIFMERIEKYALFKNPQNYLLGKKETAEMADRNKEVLLEECFCGSSVTVPE
FT                   IEGVLWLKDDGKKSWKKRYFLLRASGIYYVPKGKAKVSRDLVCFLQLDHVNVYYGQDYR
FT                   NKYKAPTDCCLALKHPQIQKKSQYIKYLCCDDARTLHQWVNGIRIAKYGKQLYTNYQEA
FT                   LKRTESAYDWTSLSSSSIKSGSSSSSIPESQSNHSNQSDSGVSDTLPTGHIRSQSTVSS
FT                   IFSEAWKRGTQLEESSKVTHKHYFTYKSVSSSVQKPVPFIPLLQSHLVPFHWSFLGETI
FT                   LALSTVTCASLRSSFFITLVHHAQDYWLDFPPLSETNKQTNKMKTQMLCDQEAVCHCSF
FT                   RKRLNPAMHNVSVFESLSLCVFLLLPQSQVPHEKANSAKTAPPTPPPAPPITATVPPQA
FT                   PPKPLVTIPPSASTKTVSPVVAQAVPPTPAPPVPPAKKQPVFPVSHIPPTPPVQPTPHP
FT                   PPTLPKQQSFGVKPPPSPLSPVPSVVKQIASQFPPPPTPPPVDSQPLKSLPASGTPQSP
FT                   PAVKAKPKWQPSSIPVPSPDFPPPPPESSLVFPPPPPPAPAPAPPPPPPPPPPPPPVPP
FT                   TASPTPDKGGSPGKKTSKMSSPGGKKPPPTPQRNSSIKSGSCAEHPEPKRPSVDSLVSK
FT                   FAPPAESGSPSKETPPPPAAPPKPGKLHLSGVNLPGIHQQGIVSAKASVLSGRGKDVVV
FT                   EFPSPPSDSDFPPPPPEIELPLPPIEIPAVFSGNTSPKVAVVNPQPQLWSKTSVKKAPP
FT                   PTRPKRNDSTRLTQADISEQPAMTTVVPQVPTSPKSSLSVQPGFLADLNRTLQRKSITR
FT                   HGSLSSSRMSRAEPTATMDDMALPPPPPELLSDQQKAGFGGSHISGYATLRRGPPPAPP
FT                   KRDQNTKLSRDW"
FT   gap             8756050..8756286
FT                   /estimated_length=237
FT   gene            complement(8788733..8789099)
FT                   /locus_tag="mCG_116534"
FT                   /note="gene_id=mCG116534.1"
FT   mRNA            complement(8788733..8789099)
FT                   /locus_tag="mCG_116534"
FT                   /product="mCG116534"
FT                   /note="gene_id=mCG116534.1 transcript_id=mCT117657.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(8788890..8789096)
FT                   /codon_start=1
FT                   /locus_tag="mCG_116534"
FT                   /product="mCG116534"
FT                   /note="gene_id=mCG116534.1 transcript_id=mCT117657.0
FT                   protein_id=mCP74791.1"
FT                   /db_xref="GOA:Q5SWJ8"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR008158"
FT                   /db_xref="InterPro:IPR022943"
FT                   /db_xref="InterPro:IPR023391"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SWJ8"
FT                   /protein_id="EDL00154.1"
FT                   /translation="MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFA
FT                   IMGFIGFFVKLIHIPINNIIVGG"
FT   gap             8832924..8832987
FT                   /estimated_length=64
FT   gap             8855845..8855929
FT                   /estimated_length=85
FT   gene            complement(8858090..8858791)
FT                   /pseudo
FT                   /locus_tag="mCG_113579"
FT                   /note="gene_id=mCG113579.1"
FT   mRNA            complement(8858090..8858791)
FT                   /pseudo
FT                   /locus_tag="mCG_113579"
FT                   /note="gene_id=mCG113579.1 transcript_id=mCT114664.0
FT                   created on 16-JUL-2002"
FT   gap             8867363..8867382
FT                   /estimated_length=20
FT   gap             8896732..8900262
FT                   /estimated_length=3531
FT   gap             8940191..8940210
FT                   /estimated_length=20
FT   gap             8947995..8948028
FT                   /estimated_length=34
FT   gap             8956723..8956742
FT                   /estimated_length=20
FT   gene            <8969914..8971674
FT                   /locus_tag="mCG_1035528"
FT                   /note="gene_id=mCG1035528.1"
FT   mRNA            <8969914..8971674
FT                   /locus_tag="mCG_1035528"
FT                   /product="mCG1035528"
FT                   /note="gene_id=mCG1035528.1 transcript_id=mCT153232.1
FT                   created on 09-SEP-2002"
FT   CDS             8969914..8971134
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035528"
FT                   /product="mCG1035528"
FT                   /note="gene_id=mCG1035528.1 transcript_id=mCT153232.1
FT                   protein_id=mCP74465.0"
FT                   /protein_id="EDL00155.1"
FT                   /translation="MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLR
FT                   GIYAYGFEKPSAIQQRAILPCIKGYDVIAQAQSGTGKTATFAISILQQIELDLKATQAL
FT                   VLAPTRELAQQIQKVVMALGDYMGASCHACIGGTNVRAEVQKLQMEAPHIIVGTPGRVF
FT                   DMLNRRYLSPKYIKIFVLDEADEMLSRGFKDQIYDIFQKLNSNTQVVLLSATMPSDVLE
FT                   VTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCDLYETLTITQAVIFINT
FT                   RRKVDWLTEKMHARDFTVSAMHGDMDQKERDVIMREFRSGSSRVLITTDLLARGIDVQQ
FT                   VSLVINYDLPTNRENYIHRIGRGGRFGRKGVAINMVTEEDKRTLRDIETFYNTSIEEMP
FT                   LNVADLI"
FT   gap             8973991..8974116
FT                   /estimated_length=126
FT   gap             8995341..8995396
FT                   /estimated_length=56
FT   gap             9003926..9004122
FT                   /estimated_length=197
FT   gene            9012059..9036587
FT                   /gene="Cd28"
FT                   /locus_tag="mCG_113576"
FT                   /note="gene_id=mCG113576.1"
FT   mRNA            join(9012059..9012186,9028636..9028992,9030934..9031049,
FT                   9035314..9036587)
FT                   /gene="Cd28"
FT                   /locus_tag="mCG_113576"
FT                   /product="CD28 antigen"
FT                   /note="gene_id=mCG113576.1 transcript_id=mCT114661.1
FT                   created on 16-JUL-2002"
FT   CDS             join(9012132..9012186,9028636..9028992,9030934..9031049,
FT                   9035314..9035442)
FT                   /codon_start=1
FT                   /gene="Cd28"
FT                   /locus_tag="mCG_113576"
FT                   /product="CD28 antigen"
FT                   /note="gene_id=mCG113576.1 transcript_id=mCT114661.1
FT                   protein_id=mCP74563.1"
FT                   /db_xref="GOA:P31041"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR008093"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:88327"
FT                   /db_xref="UniProtKB/Swiss-Prot:P31041"
FT                   /protein_id="EDL00156.1"
FT                   /translation="MTLRLLFLALNFFSVQVTENKILVKQSPLLVVDSNEVSLSCRYSY
FT                   NLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRSNAEFNCDGDFDNETVTFRLWNLH
FT                   VNHTDIYFCKIEFMYPPPYLDNERSNGTIIHIKEKHLCHTQSSPKLFWALVVVAGVLFC
FT                   YGLLVTVALCVIWTNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP"
FT   gene            complement(9042322..9047422)
FT                   /locus_tag="mCG_146948"
FT                   /note="gene_id=mCG146948.0"
FT   mRNA            complement(join(9042322..9042881,9047278..9047422))
FT                   /locus_tag="mCG_146948"
FT                   /product="mCG146948"
FT                   /note="gene_id=mCG146948.0 transcript_id=mCT187211.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(9042641..9042781)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146948"
FT                   /product="mCG146948"
FT                   /note="gene_id=mCG146948.0 transcript_id=mCT187211.0
FT                   protein_id=mCP109543.0"
FT                   /protein_id="EDL00157.1"
FT                   /translation="MQNHNYRKTELFAALLSQLTFPPSSQLALWRQRRLSVIEMPLHNE
FT                   V"
FT   gap             9042945..9043002
FT                   /estimated_length=58
FT   gene            <9044572..9069327
FT                   /locus_tag="mCG_113580"
FT                   /note="gene_id=mCG113580.1"
FT   mRNA            join(<9044572..9044644,9063483..9063566,9066779..9066839,
FT                   9069161..9069327)
FT                   /locus_tag="mCG_113580"
FT                   /product="mCG113580"
FT                   /note="gene_id=mCG113580.1 transcript_id=mCT114665.1
FT                   created on 18-APR-2003"
FT   CDS             join(<9044572..9044644,9063483..9063566,9066779..9066831)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113580"
FT                   /product="mCG113580"
FT                   /note="gene_id=mCG113580.1 transcript_id=mCT114665.1
FT                   protein_id=mCP74594.1"
FT                   /protein_id="EDL00158.1"
FT                   /translation="TLTRPLSSLIAAPPCLSTAAGYTQVSVRWLVDLEVPPGRRLRRAI
FT                   HPCCMTSSPRERRKVLVLLGSFWG"
FT   gap             9053938..9054697
FT                   /estimated_length=760
FT   gap             9100260..9100401
FT                   /estimated_length=142
FT   gap             9111340..9111359
FT                   /estimated_length=20
FT   gap             9137491..9137547
FT                   /estimated_length=57
FT   gap             9160644..9160769
FT                   /estimated_length=126
FT   gene            9166252..9166857
FT                   /locus_tag="mCG_113581"
FT                   /note="gene_id=mCG113581.1"
FT   mRNA            9166252..9166857
FT                   /locus_tag="mCG_113581"
FT                   /product="mCG113581"
FT                   /note="gene_id=mCG113581.1 transcript_id=mCT114666.1
FT                   created on 22-OCT-2002"
FT   CDS             9166291..9166620
FT                   /codon_start=1
FT                   /locus_tag="mCG_113581"
FT                   /product="mCG113581"
FT                   /note="gene_id=mCG113581.1 transcript_id=mCT114666.1
FT                   protein_id=mCP74760.1"
FT                   /protein_id="EDL00159.1"
FT                   /translation="MKASGTLREYKVVGRCLPTPKCHTPPLYRMRIFAPNHVVAKSRFW
FT                   YFVSQLKKMKKSPGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYREYRDLTTAG
FT                   AVTQC"
FT   gene            <9174416..9181218
FT                   /gene="Ctla4"
FT                   /locus_tag="mCG_113577"
FT                   /note="gene_id=mCG113577.1"
FT   mRNA            join(<9174416..9174671,9177815..9178162,9178611..9178720,
FT                   9180001..9181218)
FT                   /gene="Ctla4"
FT                   /locus_tag="mCG_113577"
FT                   /product="cytotoxic T-lymphocyte-associated protein 4"
FT                   /note="gene_id=mCG113577.1 transcript_id=mCT114662.1
FT                   created on 16-JUL-2002"
FT   CDS             join(<9174536..9174671,9177815..9178162,9178611..9178720,
FT                   9180001..9180105)
FT                   /codon_start=1
FT                   /gene="Ctla4"
FT                   /locus_tag="mCG_113577"
FT                   /product="cytotoxic T-lymphocyte-associated protein 4"
FT                   /note="gene_id=mCG113577.1 transcript_id=mCT114662.1
FT                   protein_id=mCP74568.0"
FT                   /protein_id="EDL00160.1"
FT                   /translation="GPQHICPPAMACLGLRRYKAQLQLPSRTWPFVALLTLLFIPVFSE
FT                   AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTV
FT                   GFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDP
FT                   EPCPDSDFLLWILVAVSLGLFFYSFLVTAVSLSKMLKKRSPLTTGVYVKMPPTEPECEK
FT                   QFQPYFIPIN"
FT   gap             9194357..9194437
FT                   /estimated_length=81
FT   gap             9219052..9219071
FT                   /estimated_length=20
FT   gene            9243417..9264670
FT                   /gene="Icos"
FT                   /locus_tag="mCG_113578"
FT                   /note="gene_id=mCG113578.1"
FT   mRNA            join(9243417..9243516,9259219..9259557,9260127..9260233,
FT                   9261040..9261124,9263222..9264670)
FT                   /gene="Icos"
FT                   /locus_tag="mCG_113578"
FT                   /product="inducible T-cell co-stimulator"
FT                   /note="gene_id=mCG113578.1 transcript_id=mCT114663.1
FT                   created on 16-JUL-2002"
FT   CDS             join(9243459..9243516,9259219..9259557,9260127..9260233,
FT                   9261040..9261124,9263222..9263235)
FT                   /codon_start=1
FT                   /gene="Icos"
FT                   /locus_tag="mCG_113578"
FT                   /product="inducible T-cell co-stimulator"
FT                   /note="gene_id=mCG113578.1 transcript_id=mCT114663.1
FT                   protein_id=mCP74569.1"
FT                   /db_xref="GOA:Q5SUZ7"
FT                   /db_xref="MGI:MGI:1858745"
FT                   /db_xref="UniProtKB/TrEMBL:Q5SUZ7"
FT                   /protein_id="EDL00161.1"
FT                   /translation="MKPYFCRVFVFCFLIRLLTGEINGSADHRMFSFHNGGVQISCKYP
FT                   ETVQQLKMRLFREREVLCELTKTKGSGNAVSIKNPMLCLYHLSNNSVSFFLNNPDSSQG
FT                   SYYFCSLSIFDPPPFQERNLSGGYLHIYESQLCCQLKLWLPVGCAAFVVVLLFGCILII
FT                   WFSKKKYGSSVHDPNSEYMFMAAVNTNKKSRLAGVTS"
FT   gap             9251164..9251233
FT                   /estimated_length=70
FT   gap             9253285..9253375
FT                   /estimated_length=91
FT   gap             9310722..9310741
FT                   /estimated_length=20
FT   gap             9312461..9312480
FT                   /estimated_length=20
FT   gap             9326927..9326946
FT                   /estimated_length=20
FT   gap             9335421..9335969
FT                   /estimated_length=549
FT   gene            9341813..9342364
FT                   /pseudo
FT                   /locus_tag="mCG_1035529"
FT                   /note="gene_id=mCG1035529.1"
FT   mRNA            9341813..9342364
FT                   /pseudo
FT                   /locus_tag="mCG_1035529"
FT                   /note="gene_id=mCG1035529.1 transcript_id=mCT153233.0
FT                   created on 19-MAR-2003"
FT   gap             9358511..9358530
FT                   /estimated_length=20
FT   gap             9406633..9406652
FT                   /estimated_length=20
FT   gap             9414153..9414172
FT                   /estimated_length=20
FT   gap             9426735..9426754
FT                   /estimated_length=20
FT   gap             9477718..9480563
FT                   /estimated_length=2846
FT   gap             9499135..9499154
FT                   /estimated_length=20
FT   gap             9547339..9547358
FT                   /estimated_length=20
FT   gap             9560274..9560367
FT                   /estimated_length=94
FT   gap             9569053..9569294
FT                   /estimated_length=242
FT   gap             9570625..9570644
FT                   /estimated_length=20
FT   gap             9616662..9616681
FT                   /estimated_length=20
FT   gap             9627857..9628951
FT                   /estimated_length=1095
FT   gap             9632268..9632287
FT                   /estimated_length=20
FT   gene            <9644731..9662064
FT                   /locus_tag="mCG_144499"
FT                   /note="gene_id=mCG144499.0"
FT   mRNA            join(<9644731..9644856,9645310..9645468,9646296..9646529,
FT                   9660268..9660367,9661791..9662064)
FT                   /locus_tag="mCG_144499"
FT                   /product="mCG144499"
FT                   /note="gene_id=mCG144499.0 transcript_id=mCT183923.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<9646363..9646529,9660268..9660358)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144499"
FT                   /product="mCG144499"
FT                   /note="gene_id=mCG144499.0 transcript_id=mCT183923.0
FT                   protein_id=mCP106106.0"
FT                   /protein_id="EDL00162.1"
FT                   /translation="SAVNWQRSVLMNIKGSAWLIPPLMLIPQSSHWGLLAWSIVAPFVL
FT                   PGFSTRPETSRVIVLAGFVCSLDTAGVITEKGASVEEMPP"
FT   gap             9665443..9665772
FT                   /estimated_length=330
FT   gap             9683406..9683425
FT                   /estimated_length=20
FT   gap             9723776..9723975
FT                   /estimated_length=200
FT   gap             9758268..9764507
FT                   /estimated_length=6240
FT   gap             9777498..9785863
FT                   /estimated_length=8366
FT   gap             9791990..9792457
FT                   /estimated_length=468
FT   gap             9809201..9809672
FT                   /estimated_length=472
FT   gap             9834830..9835036
FT                   /estimated_length=207
FT   gap             9837989..9838402
FT                   /estimated_length=414
FT   gap             9847043..9850630
FT                   /estimated_length=3588
FT   gap             9874544..9874563
FT                   /estimated_length=20
FT   gap             9878471..9878948
FT                   /estimated_length=478
FT   gene            complement(9882090..9886319)
FT                   /locus_tag="mCG_1035661"
FT                   /note="gene_id=mCG1035661.1"
FT   mRNA            complement(join(9882090..9882402,9885780..9886319))
FT                   /locus_tag="mCG_1035661"
FT                   /product="mCG1035661"
FT                   /note="gene_id=mCG1035661.1 transcript_id=mCT153365.0
FT                   created on 09-SEP-2002"
FT   gap             9883597..9883670
FT                   /estimated_length=74
FT   CDS             complement(9885922..9886077)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035661"
FT                   /product="mCG1035661"
FT                   /note="gene_id=mCG1035661.1 transcript_id=mCT153365.0
FT                   protein_id=mCP74788.1"
FT                   /protein_id="EDL00163.1"
FT                   /translation="MECSTALITLTNDDMNAKAKVQLLGKLFTKVCLSSDLKHRQKTKA
FT                   GYQSLL"
FT   gene            9903991..10610909
FT                   /locus_tag="mCG_113371"
FT                   /note="gene_id=mCG113371.1"
FT   mRNA            join(9903991..9904530,10032892..10032993,
FT                   10275133..10275304,10341204..10341313,10409510..10409598,
FT                   10418596..10418682,10424098..10424223,10425771..10425943,
FT                   10428741..10428880,10431016..10431144,10463283..10463468,
FT                   10476240..10476410,10481129..10481261,10496436..10496535,
FT                   10505094..10505209,10542206..10542250,10609731..10609937,
FT                   10610667..10610909)
FT                   /locus_tag="mCG_113371"
FT                   /product="mCG113371, transcript variant mCT114449"
FT                   /note="gene_id=mCG113371.1 transcript_id=mCT114449.1
FT                   created on 26-MAR-2003"
FT   mRNA            join(<9904167..9904530,10032892..10032993,
FT                   10275133..10275304,10341204..10341313,10409510..10409598,
FT                   10418596..10418682,10424098..10424223,10425771..10426129,
FT                   10428741..10428880,10431016..10431144,10463283..10463468,
FT                   10476240..10476410,10481129..10481261,10496436..10496535,
FT                   10505094..10505209,10542206..10542250,10609731..10609937,
FT                   10610667..>10610795)
FT                   /locus_tag="mCG_113371"
FT                   /product="mCG113371, transcript variant mCT189258"
FT                   /note="gene_id=mCG113371.1 transcript_id=mCT189258.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<9904168..9904530,10032892..10032993,
FT                   10275133..10275304,10341204..10341313,10409510..10409598,
FT                   10418596..10418682,10424098..10424223,10425771..10426129,
FT                   10428741..10428880,10431016..10431144,10463283..10463468,
FT                   10476240..10476410,10481129..10481261,10496436..10496535,
FT                   10505094..10505209,10542206..10542250,10609731..10609937,
FT                   10610667..>10610795)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113371"
FT                   /product="mCG113371, isoform CRA_b"
FT                   /note="gene_id=mCG113371.1 transcript_id=mCT189258.0
FT                   protein_id=mCP110237.0 isoform=CRA_b"
FT                   /protein_id="EDL00165.1"
FT                   /translation="QFHFGAWSLRLRPADPPRPRVSEPAFPPSASRGAAGEQLWVPVPE
FT                   ARVGQRRVRPTSPDGGAVPGGQAPVRPSPAREPRARMKVTVCFGRTGIVVPCKDGQLRV
FT                   RELTQQALQRYLKTRDQDPGYWVKIHHLEYTDGGILDPDDVLADVVEDKDKLIAVFDEQ
FT                   EPLQKTESPGGNPADRQSPDAFETEVAAQLAAFKPVGGEIVVTPSALKLGTPLLVRRSS
FT                   DPAPGPHADAQPSTASLSGQSLKPVVLDSTQNVENKEAMNGEQAGLLSLHRPKDELSDM
FT                   TRAVEISGEGDPLGIHVVPFFSSLSGRILGLFIRGIEENSRCKQEGLFQENECIVKINN
FT                   VELLDKTFAQAQDVFRQAMKSPSVILHVLLPQNREQYEKSVIGPLNIFGNNDGASRTKA
FT                   APPARGKPGLKAVHLTRASSPEGEEPASPQQSKSPRVPRLGRKPSSPSLSPLMGFGSKK
FT                   NAKKIKIDLKKGPEGLGFTVVTRDSSIHGPGPIFVKNILPKGAAVKDGRLQSGDRILEV
FT                   NGRDVTGRTQEELVAMLRSTKQGETVSLVIARQEGSFLPRELKGEPDCYALSLESSEQL
FT                   TLEIPLNDSGSAGLGVSLKGNKSRETGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVN
FT                   GETLLGKSNHEAMETLRRSMSMEGNIRGMIQLVILRRPERPLEELSECGALSRPGFENC
FT                   QEALSTSRRNDSSILYPFGTYSPQDKRKDLLLPSDGWAENEVPPSPPPHPALEWGLEDF
FT                   SHSSGVDSTGYFPDQHVNFRTVTPVRQPELINLKASKSMDLVPDEGKVQSLADRRSDSP
FT                   GKDFGPTLGLKKSSSLESLQTAVAEVRKNDLPFHRPRPHMVRGRGCNESFRAAIDKSYD
FT                   GPEEADADGLSDKSSRSGHTALNCESAPQGNPELDNVENKAKNIKKTKEK"
FT   CDS             join(9904411..9904530,10032892..10032993,
FT                   10275133..10275304,10341204..10341313,10409510..10409598,
FT                   10418596..10418682,10424098..10424223,10425771..10425943,
FT                   10428741..10428880,10431016..10431144,10463283..10463468,
FT                   10476240..10476410,10481129..10481261,10496436..10496535,
FT                   10505094..10505209,10542206..10542250,10609731..10609937,
FT                   10610667..10610908)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113371"
FT                   /product="mCG113371, isoform CRA_a"
FT                   /note="gene_id=mCG113371.1 transcript_id=mCT114449.1
FT                   protein_id=mCP74737.1 isoform=CRA_a"
FT                   /protein_id="EDL00164.1"
FT                   /translation="MKVTVCFGRTGIVVPCKDGQLRVRELTQQALQRYLKTRDQDPGYW
FT                   VKIHHLEYTDGGILDPDDVLADVVEDKDKLIAVFDEQEPLQKTESPGGNPADRQSPDAF
FT                   ETEVAAQLAAFKPVGGEIVVTPSALKLGTPLLVRRSSDPAPGPHADAQPSTASLSGQSL
FT                   KPVVLDSTQNVENKEAMNGEQAGLLSLHRPKDELSDMTRAVEISGEGDPLGIHVVPFFS
FT                   SLSGRILGLFIRGIEENSRCKQEGLFQENECIVKINNVELLDKTFAQAQDVFRQAMKSP
FT                   SVILHVLLPQNREQYEKSVIGPLNIFGNNDGASRTKAAPPARGKPGPEGLGFTVVTRDS
FT                   SIHGPGPIFVKNILPKGAAVKDGRLQSGDRILEVNGRDVTGRTQEELVAMLRSTKQGET
FT                   VSLVIARQEGSFLPRELKGEPDCYALSLESSEQLTLEIPLNDSGSAGLGVSLKGNKSRE
FT                   TGTDLGIFIKSIIHGGAAFKDGRLRMNDQLIAVNGETLLGKSNHEAMETLRRSMSMEGN
FT                   IRGMIQLVILRRPERPLEELSECGALSRPGFENCQEALSTSRRNDSSILYPFGTYSPQD
FT                   KRKDLLLPSDGWAENEVPPSPPPHPALEWGLEDFSHSSGVDSTGYFPDQHVNFRTVTPV
FT                   RQPELINLKASKSMDLVPDEGKVQSLADRRSDSPGKDFGPTLGLKKSSSLESLQTAVAE
FT                   VRKNDLPFHRPRPHMVRGRGCNESFRAAIDKSYDGPEEADADGLSDKSSRSGHTALNCE
FT                   SAPQGNPELDNVENKAKNIKKTKEKEKKKGKGKLKVKEKKLKEEHEDAERKMKRKGFGA
FT                   MLR"
FT   gap             9920743..9920881
FT                   /estimated_length=139
FT   gap             9934313..9934332
FT                   /estimated_length=20
FT   gap             9936384..9940957
FT                   /estimated_length=4574
FT   gap             9943182..9943383
FT                   /estimated_length=202
FT   gap             9947607..9947626
FT                   /estimated_length=20
FT   gap             9973609..9973628
FT                   /estimated_length=20
FT   gap             9999656..9999675
FT                   /estimated_length=20
FT   gap             10001401..10001420
FT                   /estimated_length=20
FT   gene            complement(10051690..>10116435)
FT                   /locus_tag="mCG_144500"
FT                   /note="gene_id=mCG144500.0"
FT   mRNA            complement(join(10051690..10051900,10113315..10113429,
FT                   10116028..>10116435))
FT                   /locus_tag="mCG_144500"
FT                   /product="mCG144500"
FT                   /note="gene_id=mCG144500.0 transcript_id=mCT183924.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(10051834..10051900,10113315..>10113412))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144500"
FT                   /product="mCG144500"
FT                   /note="gene_id=mCG144500.0 transcript_id=mCT183924.0
FT                   protein_id=mCP106107.0"
FT                   /protein_id="EDL00166.1"
FT                   /translation="SLSSTAQAGAFSATFYIKFTSSLSFEEIQHRVGFPVTKGDLFFYI
FT                   LNTEDEIPL"
FT   gap             10079977..10079996
FT                   /estimated_length=20
FT   gap             10160295..10160347
FT                   /estimated_length=53
FT   gap             10187659..10187698
FT                   /estimated_length=40
FT   gap             10196964..10196983
FT                   /estimated_length=20
FT   gap             10200436..10200455
FT                   /estimated_length=20
FT   gap             10246431..10246538
FT                   /estimated_length=108
FT   gap             10259386..10259405
FT                   /estimated_length=20
FT   gap             10268104..10268169
FT                   /estimated_length=66
FT   gap             10283607..10283650
FT                   /estimated_length=44
FT   gap             10330885..10331043
FT                   /estimated_length=159
FT   gap             10332737..10332789
FT                   /estimated_length=53
FT   gap             10364840..10368290
FT                   /estimated_length=3451
FT   gap             10371714..10371860
FT                   /estimated_length=147
FT   gap             10376814..10377599
FT                   /estimated_length=786
FT   gap             10401825..10401844
FT                   /estimated_length=20
FT   gap             10451339..10451358
FT                   /estimated_length=20
FT   gap             10485338..10487571
FT                   /estimated_length=2234
FT   gap             10489442..10492876
FT                   /estimated_length=3435
FT   gap             10496341..10496360
FT                   /estimated_length=20
FT   gap             10518790..10518809
FT                   /estimated_length=20
FT   gap             10535718..10535787
FT                   /estimated_length=70
FT   gap             10556854..10556873
FT                   /estimated_length=20
FT   gap             10563519..10569251
FT                   /estimated_length=5733
FT   gap             10604803..10604822
FT                   /estimated_length=20
FT   gap             10629117..10629136
FT                   /estimated_length=20
FT   gap             10665232..10665832
FT                   /estimated_length=601
FT   gap             10683390..10683409
FT                   /estimated_length=20
FT   gene            complement(10722662..10764944)
FT                   /locus_tag="mCG_146952"
FT                   /note="gene_id=mCG146952.0"
FT   mRNA            complement(join(10722662..10723353,10764775..10764944))
FT                   /locus_tag="mCG_146952"
FT                   /product="mCG146952"
FT                   /note="gene_id=mCG146952.0 transcript_id=mCT187215.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10722886..10723044)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146952"
FT                   /product="mCG146952"
FT                   /note="gene_id=mCG146952.0 transcript_id=mCT187215.0
FT                   protein_id=mCP109551.0"
FT                   /protein_id="EDL00167.1"
FT                   /translation="MSGGEYSEPTEHHNFATQSTAEYWLLMLGKNGPLGAVAGCLLPSQ
FT                   CCNTEKA"
FT   gap             10738504..10738539
FT                   /estimated_length=36
FT   gap             10765972..10765991
FT                   /estimated_length=20
FT   gap             10814978..10814997
FT                   /estimated_length=20
FT   gap             10827916..10827935
FT                   /estimated_length=20
FT   gap             10867218..10867694
FT                   /estimated_length=477
FT   gap             10868912..10868931
FT                   /estimated_length=20
FT   gap             10870650..10870669
FT                   /estimated_length=20
FT   gap             10873871..10873942
FT                   /estimated_length=72
FT   gap             10901703..10901722
FT                   /estimated_length=20
FT   gap             10902778..10902797
FT                   /estimated_length=20
FT   gene            10906453..10908117
FT                   /locus_tag="mCG_1035668"
FT                   /note="gene_id=mCG1035668.1"
FT   mRNA            10906453..10908117
FT                   /locus_tag="mCG_1035668"
FT                   /product="mCG1035668"
FT                   /note="gene_id=mCG1035668.1 transcript_id=mCT153372.1
FT                   created on 09-SEP-2002"
FT   CDS             10906582..10906821
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035668"
FT                   /product="mCG1035668"
FT                   /note="gene_id=mCG1035668.1 transcript_id=mCT153372.1
FT                   protein_id=mCP74543.1"
FT                   /protein_id="EDL00168.1"
FT                   /translation="MSGVGKQNRACWSGHTESNVLGMSVPDQVPNSTHLPLEQQVDESV
FT                   CVCVCVCVCVCVCARMSALVRTHKHVITSMEKRR"
FT   gap             10915456..10915522
FT                   /estimated_length=67
FT   gap             10919314..10919333
FT                   /estimated_length=20
FT   gene            10928439..10929389
FT                   /pseudo
FT                   /locus_tag="mCG_114995"
FT                   /note="gene_id=mCG114995.1"
FT   mRNA            10928439..10929389
FT                   /pseudo
FT                   /locus_tag="mCG_114995"
FT                   /note="gene_id=mCG114995.1 transcript_id=mCT116093.0
FT                   created on 16-JUL-2002"
FT   gap             10951346..10951365
FT                   /estimated_length=20
FT   gap             10957826..10957850
FT                   /estimated_length=25
FT   gene            10964725..11076557
FT                   /locus_tag="mCG_115000"
FT                   /note="gene_id=mCG115000.2"
FT   mRNA            join(10964725..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047034,11076003..11076557)
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, transcript variant mCT116098"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT116098.2
FT                   created on 28-SEP-2004"
FT   mRNA            join(10964725..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047019,11073226..11073276,11076003..11076557)
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, transcript variant mCT194529"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT194529.0
FT                   created on 28-SEP-2004"
FT   mRNA            join(10964725..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047034,11056398..11057681)
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, transcript variant mCT173661"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT173661.1
FT                   created on 28-SEP-2004"
FT   CDS             join(10965499..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047034,11076003..11076307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, isoform CRA_c"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT116098.2
FT                   protein_id=mCP74771.2 isoform=CRA_c"
FT                   /protein_id="EDL00171.1"
FT                   /translation="MDMFPLTWVFLALYFSGHEVRSQQDPPCGGRLNSKDAGYITSPGY
FT                   PQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKH
FT                   CGNIAPPTIISSGSVLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESP
FT                   GFPEKYPHNLDCTFTILAKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHV
FT                   GPLIGKYCGTKTPSKLRSSTGILSLTFHTDMAVAKDGFSARYYLIHQEPPENFQCNVPL
FT                   GMESGRIANEQISASSTFSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLT
FT                   AIATQGAISRETQKGYYVKSYKLEVSTNGEDWMVYRHGKNHKIFQANNDATEVVLNKLH
FT                   MPLLTRFIRIRPQTWHLGIALRLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREY
FT                   LWSPSAARLVSSRSGWFPRNPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEA
FT                   RAFVRKFKVSYSLNGKDWEYIQDPRTQQTKLFEGNMHYDTPDIRRFDPVPAQYVRVYPE
FT                   RWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPMDEDATECGENCSFEDD
FT                   KDLQLPSGFNCNFDFPEETCGWVYDHAKWLRSTWISSANPNDRTFPDDKNFLKLQSDGR
FT                   REGQYGRLISPPVHLPRSPVCMEFQYQAMGGHGVALQVVREASQESKLLWVIREDQGSE
FT                   WKHGRIILPSYDMEYQIVFEGVIGKGRSGEISIDDIRISTDVPLENCMEPISAFAGEDF
FT                   KDEYEGDWSNSSSSTSGAGDPSSGKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLL
FT                   YCTCSYSGLSSRSCTTLENYNFELYDGLKHKVKINHQKCCSEA"
FT   CDS             join(10965499..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047019,11073226..11073276,11076003..11076307)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, isoform CRA_a"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT194529.0
FT                   protein_id=mCP115558.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8QZY7"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR000859"
FT                   /db_xref="InterPro:IPR000998"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR014648"
FT                   /db_xref="InterPro:IPR022579"
FT                   /db_xref="MGI:MGI:1100492"
FT                   /db_xref="UniProtKB/TrEMBL:Q8QZY7"
FT                   /protein_id="EDL00169.1"
FT                   /translation="MDMFPLTWVFLALYFSGHEVRSQQDPPCGGRLNSKDAGYITSPGY
FT                   PQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKH
FT                   CGNIAPPTIISSGSVLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESP
FT                   GFPEKYPHNLDCTFTILAKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHV
FT                   GPLIGKYCGTKTPSKLRSSTGILSLTFHTDMAVAKDGFSARYYLIHQEPPENFQCNVPL
FT                   GMESGRIANEQISASSTFSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLT
FT                   AIATQGAISRETQKGYYVKSYKLEVSTNGEDWMVYRHGKNHKIFQANNDATEVVLNKLH
FT                   MPLLTRFIRIRPQTWHLGIALRLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREY
FT                   LWSPSAARLVSSRSGWFPRNPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEA
FT                   RAFVRKFKVSYSLNGKDWEYIQDPRTQQTKLFEGNMHYDTPDIRRFDPVPAQYVRVYPE
FT                   RWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPMDEDATECGENCSFEDD
FT                   KDLQLPSGFNCNFDFPEETCGWVYDHAKWLRSTWISSANPNDRTFPDDKNFLKLQSDGR
FT                   REGQYGRLISPPVHLPRSPVCMEFQYQAMGGHGVALQVVREASQESKLLWVIREDQGSE
FT                   WKHGRIILPSYDMEYQIVFEGVIGKGRSGEISIDDIRISTDVPLENCMEPISAFAVDIP
FT                   ETHGGEGYEDEIDDEYEGDWSNSSSSTSGAGDPSSGKEKSWLYTLDPILITIIAMSSLG
FT                   VLLGATCAGLLLYCTCSYSGLSSRSCTTLENYNFELYDGLKHKVKINHQKCCSEA"
FT   CDS             join(10965499..10965571,10980178..10980355,
FT                   10999036..10999217,11004905..11005135,11006088..11006243,
FT                   11007888..11008057,11009863..11010018,11021499..11021643,
FT                   11023415..11023764,11025576..11025720,11029729..11029845,
FT                   11032434..11032574,11044016..11044278,11045763..11045859,
FT                   11046999..11047034,11056398..11056678)
FT                   /codon_start=1
FT                   /locus_tag="mCG_115000"
FT                   /product="mCG115000, isoform CRA_b"
FT                   /note="gene_id=mCG115000.2 transcript_id=mCT173661.1
FT                   protein_id=mCP96580.1 isoform=CRA_b"
FT                   /protein_id="EDL00170.1"
FT                   /translation="MDMFPLTWVFLALYFSGHEVRSQQDPPCGGRLNSKDAGYITSPGY
FT                   PQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKH
FT                   CGNIAPPTIISSGSVLYIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESP
FT                   GFPEKYPHNLDCTFTILAKPRMEIILQFLTFDLEHDPLQVGEGDCKYDWLDIWDGIPHV
FT                   GPLIGKYCGTKTPSKLRSSTGILSLTFHTDMAVAKDGFSARYYLIHQEPPENFQCNVPL
FT                   GMESGRIANEQISASSTFSDGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLT
FT                   AIATQGAISRETQKGYYVKSYKLEVSTNGEDWMVYRHGKNHKIFQANNDATEVVLNKLH
FT                   MPLLTRFIRIRPQTWHLGIALRLELFGCRVTDAPCSNMLGMLSGLIADTQISASSTREY
FT                   LWSPSAARLVSSRSGWFPRNPQAQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEA
FT                   RAFVRKFKVSYSLNGKDWEYIQDPRTQQTKLFEGNMHYDTPDIRRFDPVPAQYVRVYPE
FT                   RWSPAGIGMRLEVLGCDWTDSKPTVETLGPTVKSEETTTPYPMDEDATECGENCSFEDD
FT                   KDLQLPSGFNCNFDFPEETCGWVYDHAKWLRSTWISSANPNDRTFPDDKNFLKLQSDGR
FT                   REGQYGRLISPPVHLPRSPVCMEFQYQAMGGHGVALQVVREASQESKLLWVIREDQGSE
FT                   WKHGRIILPSYDMEYQIVFEGVIGKGRSGEISIDDIRISTDVPLENCMEPISAFAGEDF
FT                   KGGTLPPGTEPTVDTVPVQPIPAYWYYVMAAGGAVLVLASVVLALVLHYHRFRYAAKKT
FT                   DHSITYKTSHYTNGAPLAVEPTLTIKLEQERGSHC"
FT   gap             10967199..10967218
FT                   /estimated_length=20
FT   gene            10985710..10987432
FT                   /locus_tag="mCG_146945"
FT                   /note="gene_id=mCG146945.0"
FT   mRNA            10985710..10987432
FT                   /locus_tag="mCG_146945"
FT                   /product="mCG146945"
FT                   /note="gene_id=mCG146945.0 transcript_id=mCT187208.0
FT                   created on 13-JAN-2004"
FT   CDS             10985792..10986340
FT                   /codon_start=1
FT                   /locus_tag="mCG_146945"
FT                   /product="mCG146945"
FT                   /note="gene_id=mCG146945.0 transcript_id=mCT187208.0
FT                   protein_id=mCP109545.0"
FT                   /protein_id="EDL00172.1"
FT                   /translation="MCKGGTLKRGLSLALGSTVINMADLHFLSCECCQGRGKRRKAVLV
FT                   TFATNPLPGKKKKKKKKMPDMLLNSISWPGDFPHLLRRGTQSRKQERLGLWGVYGPALP
FT                   AVVMSLLPRSLCPDVLRIMESVVCSGTVQVTIWIKSSSVHSCPDPRSLFFSLGNQITQL
FT                   EVWLQLGTPEVETEPVSVV"
FT   gap             10987848..10987867
FT                   /estimated_length=20
FT   gap             10994291..10994496
FT                   /estimated_length=206
FT   gap             11004535..11004578
FT                   /estimated_length=44
FT   gene            complement(11051663..>11055433)
FT                   /locus_tag="mCG_144506"
FT                   /note="gene_id=mCG144506.0"
FT   mRNA            complement(join(11051663..11052301,11055095..11055170,
FT                   11055252..>11055433))
FT                   /locus_tag="mCG_144506"
FT                   /product="mCG144506"
FT                   /note="gene_id=mCG144506.0 transcript_id=mCT183930.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(11052216..11052301,11055095..11055170,
FT                   11055252..>11055356))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144506"
FT                   /product="mCG144506"
FT                   /note="gene_id=mCG144506.0 transcript_id=mCT183930.0
FT                   protein_id=mCP106113.0"
FT                   /protein_id="EDL00173.1"
FT                   /translation="FSQGFTSDENLAQKGTKAVLSLPKADMIFTSEKADGVPEEGQMSC
FT                   LFTASVCGPTFAHHAVGNKMFSIPQPFFINFHPPNSPQSFLIV"
FT   gap             11060170..11060189
FT                   /estimated_length=20
FT   gap             11068402..11069105
FT                   /estimated_length=704
FT   gap             11074582..11074601
FT                   /estimated_length=20
FT   gene            complement(11082005..11093017)
FT                   /locus_tag="mCG_146959"
FT                   /note="gene_id=mCG146959.0"
FT   mRNA            complement(join(11082005..11082596,11092745..11093017))
FT                   /locus_tag="mCG_146959"
FT                   /product="mCG146959"
FT                   /note="gene_id=mCG146959.0 transcript_id=mCT187222.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(11082553..11082596,11092745..11092937))
FT                   /codon_start=1
FT                   /locus_tag="mCG_146959"
FT                   /product="mCG146959"
FT                   /note="gene_id=mCG146959.0 transcript_id=mCT187222.0
FT                   protein_id=mCP109558.0"
FT                   /protein_id="EDL00174.1"
FT                   /translation="MHEDVRRWCDPGGELQKPPSIPSVLALLPVWGSGCELSAVPASHL
FT                   PATILPAITMDDGLLSLWNWVSNLMEAQVSEGL"
FT   gap             11125910..11128395
FT                   /estimated_length=2486
FT   gap             11129341..11130521
FT                   /estimated_length=1181
FT   gap             11147913..11147932
FT                   /estimated_length=20
FT   gap             11149988..11150113
FT                   /estimated_length=126
FT   gene            complement(11218838..>11319150)
FT                   /locus_tag="mCG_114999"
FT                   /note="gene_id=mCG114999.1"
FT   mRNA            complement(join(11218838..11219052,11223010..11223154,
FT                   11241238..11241314,11242001..11242183,11318988..>11319150))
FT                   /locus_tag="mCG_114999"
FT                   /product="mCG114999"
FT                   /note="gene_id=mCG114999.1 transcript_id=mCT116097.1
FT                   created on 25-SEP-2002"
FT   gap             11235255..11235398
FT                   /estimated_length=144
FT   CDS             complement(join(11242062..11242183,11318988..11319150))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114999"
FT                   /product="mCG114999"
FT                   /note="gene_id=mCG114999.1 transcript_id=mCT116097.1
FT                   protein_id=mCP74770.1"
FT                   /protein_id="EDL00175.1"
FT                   /translation="MGPSAELMASTSPKQQLPQFSAAFGHQLSSHSGIPKDLQPSHSSI
FT                   APPTGFTATVTESSAVKISSKDLYLLSHLPGQNVNCCRLAPGLLLFYFA"
FT   gap             11247090..11247296
FT                   /estimated_length=207
FT   gap             11254703..11254722
FT                   /estimated_length=20
FT   gap             11267054..11267195
FT                   /estimated_length=142
FT   gap             11293876..11294861
FT                   /estimated_length=986
FT   gap             11298829..11298848
FT                   /estimated_length=20
FT   gene            complement(11321084..11375151)
FT                   /locus_tag="mCG_115001"
FT                   /note="gene_id=mCG115001.1"
FT   mRNA            complement(join(11321084..11322146,11322985..11323202,
FT                   11326658..11326791,11329138..11329247,11335469..11335693,
FT                   11340100..11340208,11346811..11347541,11354366..11354521,
FT                   11354721..11354811,11366791..11366894,11375046..11375151))
FT                   /locus_tag="mCG_115001"
FT                   /product="mCG115001, transcript variant mCT173662"
FT                   /note="gene_id=mCG115001.1 transcript_id=mCT173662.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11321084..11322146,11322985..11323202,
FT                   11326658..11326791,11329138..11329247,11335469..11335693,
FT                   11340100..11340208,11346811..11347541,11354366..11354612,
FT                   11354721..11354811,11366791..11366894,11375046..11375151))
FT                   /locus_tag="mCG_115001"
FT                   /product="mCG115001, transcript variant mCT116099"
FT                   /note="gene_id=mCG115001.1 transcript_id=mCT116099.1
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(11321960..11322146,11322985..11323202,
FT                   11326658..11326791,11329138..11329247,11335469..11335693,
FT                   11340100..11340208,11346811..11347541,11354366..11354583))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115001"
FT                   /product="mCG115001, isoform CRA_b"
FT                   /note="gene_id=mCG115001.1 transcript_id=mCT116099.1
FT                   protein_id=mCP74508.1 isoform=CRA_b"
FT                   /protein_id="EDL00177.1"
FT                   /translation="MYEGKHIHFSEVDNKPLCSYSPKLCKQRRLNGYAFCIRHVLEDKT
FT                   APFKQCEYVAKYNSQRCTNPIPKSEDRRYCNSHLQVLGFIPKKERKKKTDPVDEVKARH
FT                   QMDAMAFSLTVPTLALKMPNGLDSMSLSPPGARVPLHYLDTELEDPFAFNEEDDDLKKG
FT                   VTVRKKLQSKLAQNRQRQRETEILKVRQEHFSTPPTPPQQHTHLSPLSTSLKPPAPPQG
FT                   SVCKSPQPQNTSLPMQGVAPTTHSIAQIRQASHKRPLPLLPSSRAPISDAPRTDRILMK
FT                   AAAFSPHLSCISRLQRLVKLCTQKRQLDADLFPHLGLDWSEESGEELEDADQASPYQVA
FT                   WSIRETLRHERHTSDDDDMESRSSRVTQLCTYFQQKYKHLCRLERAESRQKKCRHTFRK
FT                   ALLQAASKEPECTGQLIQELRRAACSRASLRQTKLKEVEPAACSGTVKGEQCTKQALPF
FT                   TRHCFQHILLNRSQQLFSSCTAKFADGQQCSVPVFDITHQTPLCEEHAKKMDNFLRGDN
FT                   SRKVQHQQQRKPRKKTKPPALTKKHKKKRRRGPRRPQKPIPPAVPQGNLSMPTSVSLPV
FT                   EASQMRSPSTPELSADELPDDIANEITDIPHDLELNQEDFADVLPRLPDDLQDFDFFEG
FT                   MVSVLLRN"
FT   CDS             complement(join(11321960..11322146,11322985..11323202,
FT                   11326658..11326791,11329138..11329247,11335469..11335693,
FT                   11340100..11340208,11346811..11347444))
FT                   /codon_start=1
FT                   /locus_tag="mCG_115001"
FT                   /product="mCG115001, isoform CRA_a"
FT                   /note="gene_id=mCG115001.1 transcript_id=mCT173662.0
FT                   protein_id=mCP96581.0 isoform=CRA_a"
FT                   /protein_id="EDL00176.1"
FT                   /translation="MDAMAFSLTVPTLALKMPNGLDSMSLSPPGARVPLHYLDTELEDP
FT                   FAFNEEDDDLKKGVTVRKKLQSKLAQNRQRQRETEILKVRQEHFSTPPTPPQQHTHLSP
FT                   LSTSLKPPAPPQGSVCKSPQPQNTSLPMQGVAPTTHSIAQIRQASHKRPLPLLPSSRAP
FT                   ISDAPRTDRILMKAAAFSPHLSCISRLQRLVKLCTQKRQLDADLFPHLGLDWSEESGEE
FT                   LEDADQASPYQVAWSIRETLRHERHTSDDDDMESRSSRVTQLCTYFQQKYKHLCRLERA
FT                   ESRQKKCRHTFRKALLQAASKEPECTGQLIQELRRAACSRASLRQTKLKEVEPAACSGT
FT                   VKGEQCTKQALPFTRHCFQHILLNRSQQLFSSCTAKFADGQQCSVPVFDITHQTPLCEE
FT                   HAKKMDNFLRGDNSRKVQHQQQRKPRKKTKPPALTKKHKKKRRRGPRRPQKPIPPAVPQ
FT                   GNLSMPTSVSLPVEASQMRSPSTPELSADELPDDIANEITDIPHDLELNQEDFADVLPR
FT                   LPDDLQDFDFFEGMVSVLLRN"
FT   gap             11332172..11332191
FT                   /estimated_length=20
FT   gap             11349236..11349255
FT                   /estimated_length=20
FT   gap             11358231..11358340
FT                   /estimated_length=110
FT   gap             11365591..11365724
FT                   /estimated_length=134
FT   gap             11373020..11373045
FT                   /estimated_length=26
FT   gap             11374483..11374966
FT                   /estimated_length=484
FT   gene            <11375306..11419037
FT                   /locus_tag="mCG_145850"
FT                   /note="gene_id=mCG145850.0"
FT   mRNA            join(<11375306..11375379,11404863..11404929,
FT                   11416967..11417068,11417705..11419037)
FT                   /locus_tag="mCG_145850"
FT                   /product="mCG145850"
FT                   /note="gene_id=mCG145850.0 transcript_id=mCT185958.0
FT                   created on 03-JUL-2003"
FT   gene            11382446..11386616
FT                   /locus_tag="mCG_1035670"
FT                   /note="gene_id=mCG1035670.1"
FT   mRNA            join(11382446..11383134,11386433..11386616)
FT                   /locus_tag="mCG_1035670"
FT                   /product="mCG1035670"
FT                   /note="gene_id=mCG1035670.1 transcript_id=mCT153374.0
FT                   created on 18-MAR-2003"
FT   CDS             join(11382931..11383134,11386433..11386453)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035670"
FT                   /product="mCG1035670"
FT                   /note="gene_id=mCG1035670.1 transcript_id=mCT153374.0
FT                   protein_id=mCP74558.0"
FT                   /protein_id="EDL00179.1"
FT                   /translation="MYEGQLCNLLPTEFILQMSCRNNGSPPFVVGHTGASCCPAQDDVN
FT                   INLREGRWTSLEPNSSHCVCIEEIVSMCR"
FT   gap             11392571..11392590
FT                   /estimated_length=20
FT   gap             11401257..11401276
FT                   /estimated_length=20
FT   gene            complement(11404338..11437559)
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /note="gene_id=mCG114998.1"
FT   mRNA            complement(join(11404338..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431662,11437353..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT116096"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT116096.1
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11404347..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11429977..11430084,
FT                   11430798..11430889,11431597..11431662,11437353..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT173660"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173660.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11404347..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431662,11432902..11433005,11437353..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT173657"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173657.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11404347..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431662,11437195..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT173658"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173658.0
FT                   created on 25-SEP-2002"
FT   mRNA            complement(join(11404347..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431662,11432902..11433005,11437195..11437559))
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   transcript variant mCT173659"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173659.0
FT                   created on 25-SEP-2002"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11429977..11430084,
FT                   11430798..11430889,11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173660.0
FT                   protein_id=mCP96576.0 isoform=CRA_b"
FT                   /protein_id="EDL00183.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKDQSMMFGSDRSRFLEGK
FT                   RAVEDKNIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMS
FT                   ELSGNVIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILP
FT                   RMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFE
FT                   GNAVAAIAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAG
FT                   VEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKIL
FT                   QDIASGRHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWK
FT                   VMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQG
FT                   HHGDVGAPMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEI
FT                   AGITLPYDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQ
FT                   LTIKDFYMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173657.0
FT                   protein_id=mCP96579.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VD9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="MGI:MGI:2443241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VD9"
FT                   /protein_id="EDL00180.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILT
FT                   NSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDK
FT                   NIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNV
FT                   IDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDI
FT                   NEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAA
FT                   IAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADV
FT                   VLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASG
FT                   RHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILH
FT                   RIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVG
FT                   APMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLP
FT                   YDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDF
FT                   YMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173658.0
FT                   protein_id=mCP96577.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VD9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="MGI:MGI:2443241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VD9"
FT                   /protein_id="EDL00181.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILT
FT                   NSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDK
FT                   NIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNV
FT                   IDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDI
FT                   NEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAA
FT                   IAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADV
FT                   VLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASG
FT                   RHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILH
FT                   RIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVG
FT                   APMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLP
FT                   YDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDF
FT                   YMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT173659.0
FT                   protein_id=mCP96578.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VD9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="MGI:MGI:2443241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VD9"
FT                   /protein_id="EDL00182.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILT
FT                   NSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDK
FT                   NIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNV
FT                   IDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDI
FT                   NEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAA
FT                   IAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADV
FT                   VLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASG
FT                   RHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILH
FT                   RIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVG
FT                   APMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLP
FT                   YDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDF
FT                   YMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             complement(join(11404575..11404666,11407865..11407937,
FT                   11408035..11408169,11409141..11409316,11410703..11410857,
FT                   11412298..11412458,11413522..11413651,11416951..11417079,
FT                   11417879..11418024,11420496..11420610,11421626..11421760,
FT                   11424410..11424595,11425473..11425603,11425692..11425773,
FT                   11427039..11427115,11429977..11430084,11430798..11430889,
FT                   11431597..11431657))
FT                   /codon_start=1
FT                   /gene="Ndufs1"
FT                   /locus_tag="mCG_114998"
FT                   /product="NADH dehydrogenase (ubiquinone) Fe-S protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114998.1 transcript_id=mCT116096.1
FT                   protein_id=mCP74738.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q91VD9"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="MGI:MGI:2443241"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91VD9"
FT                   /protein_id="EDL00184.1"
FT                   /translation="MLRIPIKRALIGLSNSPKGYVRTTGTAASNLIEVFVDGQSVMVEP
FT                   GTTVLQACEKVGMQIPRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILT
FT                   NSEKSKKAREGVMEFLLANHPLDCPICDQGGECDLQDQSMMFGSDRSRFLEGKRAVEDK
FT                   NIGPLVKTIMTRCIQCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNV
FT                   IDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDI
FT                   NEEWISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYTSWEDALSRVAGMLQNFEGNAVAA
FT                   IAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADV
FT                   VLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASG
FT                   RHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILH
FT                   RIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVG
FT                   APMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLP
FT                   YDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDF
FT                   YMTDSISRASQTMAKCVKAVTEGAQAVEEPSIC"
FT   CDS             join(<11417010..11417068,11417705..11417939)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145850"
FT                   /product="mCG145850"
FT                   /note="gene_id=mCG145850.0 transcript_id=mCT185958.0
FT                   protein_id=mCP107690.0"
FT                   /protein_id="EDL00178.1"
FT                   /translation="KNNICFFHTSNCGIEKIIGTKTIAENSCNTHLQSKYLGGKDRKFF
FT                   CYTEFKASLGYKKLKNQNEIPNSSLEHSLLLLTQLLQWGRSLQCISCQSQLY"
FT   gene            11437681..11440745
FT                   /gene="Eef1b2"
FT                   /locus_tag="mCG_114996"
FT                   /note="gene_id=mCG114996.1"
FT   mRNA            join(11437681..11438058,11438521..11438643,
FT                   11439206..11439332,11439599..11439665,11440015..11440140,
FT                   11440225..11440745)
FT                   /gene="Eef1b2"
FT                   /locus_tag="mCG_114996"
FT                   /product="eukaryotic translation elongation factor 1 beta
FT                   2"
FT                   /note="gene_id=mCG114996.1 transcript_id=mCT116094.1
FT                   created on 16-JUL-2002"
FT   CDS             join(11437979..11438058,11438521..11438643,
FT                   11439206..11439332,11439599..11439665,11440015..11440140,
FT                   11440225..11440379)
FT                   /codon_start=1
FT                   /gene="Eef1b2"
FT                   /locus_tag="mCG_114996"
FT                   /product="eukaryotic translation elongation factor 1 beta
FT                   2"
FT                   /note="gene_id=mCG114996.1 transcript_id=mCT116094.1
FT                   protein_id=mCP74727.1"
FT                   /protein_id="EDL00185.1"
FT                   /translation="MGFGDLKTPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSGPP
FT                   PADLCHALRWYNHIKSYEKEKASLPGVKKSLGKYGPSSVEDTTGSGAADAKDDDDIDLF
FT                   GSDDEEESEEAKKLREERLAQYESKKAKKPAVVAKSSILLDVKPWDDETDMTKLEECVR
FT                   SIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAF
FT                   NKI"
FT   gene            complement(11443341..11474963)
FT                   /gene="Gpr1"
FT                   /locus_tag="mCG_1035531"
FT                   /note="gene_id=mCG1035531.1"
FT   mRNA            complement(join(11443341..11444872,11470513..11470658,
FT                   11474925..11474963))
FT                   /gene="Gpr1"
FT                   /locus_tag="mCG_1035531"
FT                   /product="G protein-coupled receptor 1"
FT                   /note="gene_id=mCG1035531.1 transcript_id=mCT153235.1
FT                   created on 19-SEP-2002"
FT   CDS             complement(11443781..11444842)
FT                   /codon_start=1
FT                   /gene="Gpr1"
FT                   /locus_tag="mCG_1035531"
FT                   /product="G protein-coupled receptor 1"
FT                   /note="gene_id=mCG1035531.1 transcript_id=mCT153235.1
FT                   protein_id=mCP74656.1"
FT                   /protein_id="EDL00186.1"
FT                   /translation="MEVSKEMLFEELDNYSYALDYYSQESDPEEKVYLGLVHWISLFLY
FT                   ALAFVLGIPGNAIVIWLMGFKWKKTVTTLWFLNLAIADFIFVLFLPLYISYVALSFHWP
FT                   FGLWLCKVNSFIAQLNMFSSVFFLTVISLDRYIHLLHPGLSHRHRTLKSSLVVVILVWL
FT                   LASLLGGPTLYFRDTMEVNNHIICYNNFQEHELTLMRHHVLTWVKFLFGYLFPLLTMSS
FT                   CYLCLIFKMKKRNILISRKHLWMILSVVIAFLVCWTPYHLFSIWELSIHHNSSFQNVLQ
FT                   GGIPLSTGLAFLNSCLNPILYVLISKTFQARFRASVAEVLKRSLWEASCSGTVSEQLRS
FT                   AETKSLSLLETAQ"
FT   gap             11452648..11452684
FT                   /estimated_length=37
FT   gap             11460501..11460520
FT                   /estimated_length=20
FT   gap             11476978..11477001
FT                   /estimated_length=24
FT   gap             11494644..11494810
FT                   /estimated_length=167
FT   gap             11518779..11518975
FT                   /estimated_length=197
FT   gap             11529174..11529652
FT                   /estimated_length=479
FT   gap             11530674..11530693
FT                   /estimated_length=20
FT   gene            11534263..>11564779
FT                   /locus_tag="mCG_114997"
FT                   /note="gene_id=mCG114997.1"
FT   mRNA            join(11534263..11534471,11536056..11536138,
FT                   11538891..11538943,11542004..11542114,11551923..11552058,
FT                   11556192..11556322,11563912..>11564779)
FT                   /locus_tag="mCG_114997"
FT                   /product="mCG114997, transcript variant mCT116095"
FT                   /note="gene_id=mCG114997.1 transcript_id=mCT116095.1
FT                   created on 18-APR-2003"
FT   mRNA            join(<11534264..11534471,11536056..11536138,
FT                   11538891..11538943,11542004..11542114,11551956..11552058,
FT                   11556192..11556322,11563912..>11564209)
FT                   /locus_tag="mCG_114997"
FT                   /product="mCG114997, transcript variant mCT189306"
FT                   /note="gene_id=mCG114997.1 transcript_id=mCT189306.0
FT                   created on 08-MAR-2004"
FT   gap             11534484..11534503
FT                   /estimated_length=20
FT   gap             11540340..11540359
FT                   /estimated_length=20
FT   gap             11551619..11551733
FT                   /estimated_length=115
FT   CDS             join(<11552008..11552058,11556192..11556322,
FT                   11563912..>11564209)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114997"
FT                   /product="mCG114997, isoform CRA_b"
FT                   /note="gene_id=mCG114997.1 transcript_id=mCT189306.0
FT                   protein_id=mCP110298.0 isoform=CRA_b"
FT                   /protein_id="EDL00188.1"
FT                   /translation="FQMEAQSYQEVMKNNGQHLFSSQHRSLTRQSRRRTATNNTLMERF
FT                   LQDVLRHHPYNYQDNRSAPNEPEAAAAAAAAADPGSPEVVVVLDDSDEKEDDTADSGAE
FT                   RNSEDSGSVEEIDYRPGTSQEHAEVAVRPSVIQKLERGQQQSLELAHKVESGVKKV"
FT   CDS             join(11552014..11552058,11556192..11556322,
FT                   11563912..>11564779)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114997"
FT                   /product="mCG114997, isoform CRA_a"
FT                   /note="gene_id=mCG114997.1 transcript_id=mCT116095.1
FT                   protein_id=mCP74728.1 isoform=CRA_a"
FT                   /protein_id="EDL00187.1"
FT                   /translation="MEAQSYQEVMKNNGQHLFSSQHRSLTRQSRRRTATNNTLMERFLQ
FT                   DVLRHHPYNYQDNRSAPNEPEAAAAAAAAADPGSPEVVVVLDDSDEKEDDTADSGAERN
FT                   SEDSGSVEEIDYRPGTSQEHAEVAVRPSVIQKLERGQQQSLELAHKVESGVKKVNSVGV
FT                   VQATTSGKKLVRPPVICNAPASSLPSGSFERPVAANSVPRLVLAVASDSFPACDTENLE
FT                   TYFDSPDQGPSNPSSQPKTKDPKKKLSINLDKLLAQRNLRAKGASFSPVVRVRELTGSE
FT                   LCSVRAESSELEAGTAGNPRETDTLPEQAREGAIPKRREASRSNTVRPQEETRLVLNKP
FT                   TLLKQKRS"
FT   gap             11570483..11570863
FT                   /estimated_length=381
FT   gap             11581253..11581272
FT                   /estimated_length=20
FT   gap             11590135..11590154
FT                   /estimated_length=20
FT   gap             11592875..11592894
FT                   /estimated_length=20
FT   gap             11632025..11632044
FT                   /estimated_length=20
FT   gap             11634605..11634624
FT                   /estimated_length=20
FT   gap             11642438..11642851
FT                   /estimated_length=414
FT   gap             11644292..11644311
FT                   /estimated_length=20
FT   gap             11658460..11658479
FT                   /estimated_length=20
FT   gap             11659843..11663797
FT                   /estimated_length=3955
FT   gap             11670177..11671192
FT                   /estimated_length=1016
FT   gap             11693331..11693350
FT                   /estimated_length=20
FT   gap             11707926..11708123
FT                   /estimated_length=198
FT   gap             11711056..11711088
FT                   /estimated_length=33
FT   gap             11715881..11715996
FT                   /estimated_length=116
FT   gene            <11718476..11866402
FT                   /gene="Adam23"
FT                   /locus_tag="mCG_114994"
FT                   /note="gene_id=mCG114994.1"
FT   mRNA            join(<11718476..11718520,11718760..11718880,
FT                   11720185..11720405,11750119..11750195,11788336..11788399,
FT                   11801736..11801818,11803214..11803277,11807263..11807335,
FT                   11808112..11808185,11809906..11809971,11816172..11816243,
FT                   11818533..11818696,11819518..11819602,11820638..11820728,
FT                   11822656..11822704,11824669..11824768,11828063..11828134,
FT                   11828722..11828811,11830316..11830396,11836316..11836366,
FT                   11837052..11837115,11839505..11839610,11840752..11840871,
FT                   11843813..11843981,11845779..11845890,11858783..11858873,
FT                   11866032..11866402)
FT                   /gene="Adam23"
FT                   /locus_tag="mCG_114994"
FT                   /product="a disintegrin and metallopeptidase domain 23"
FT                   /note="gene_id=mCG114994.1 transcript_id=mCT116092.1
FT                   created on 16-JUL-2002"
FT   gap             11718521..11718759
FT                   /estimated_length=239
FT   CDS             join(<11718760..11718880,11720185..11720405,
FT                   11750119..11750195,11788336..11788399,11801736..11801818,
FT                   11803214..11803277,11807263..11807335,11808112..11808185,
FT                   11809906..11809971,11816172..11816243,11818533..11818696,
FT                   11819518..11819602,11820638..11820728,11822656..11822704,
FT                   11824669..11824768,11828063..11828134,11828722..11828811,
FT                   11830316..11830396,11836316..11836366,11837052..11837115,
FT                   11839505..11839610,11840752..11840871,11843813..11843981,
FT                   11845779..11845890,11858783..11858873,11866032..11866080)
FT                   /codon_start=1
FT                   /gene="Adam23"
FT                   /locus_tag="mCG_114994"
FT                   /product="a disintegrin and metallopeptidase domain 23"
FT                   /note="gene_id=mCG114994.1 transcript_id=mCT116092.1
FT                   protein_id=mCP74706.1"
FT                   /protein_id="EDL00189.1"
FT                   /translation="CPAGPVPARAPPCRLLLVLLMLPALATSSRPRARGAAAPSAPHWN
FT                   ETAEKTLGVLADEDNTLQQNSSSRNTSYSSAVQKEITLPSRLVYYINQDSESPYHVLDT
FT                   KARHQQKHNKAVHLAQASFQIEAFGSKFILDLTLNNGLLSSDYVEIHYEDGKQMYSKGG
FT                   EHCYYHGSIRGVKDSRVALSTCNGLHGMFEDDTFVYMIEPLELTDDEKSTGRPHIIQKT
FT                   LAGQYSKQMKNLSTDGSDQWPLLPELQWLRRRKRAVNPSRGVFEEMKYLELMIVNDHKT
FT                   YKKHRSSHAHTNNFAKSVVNLVDSIYKEQLNTRVVLVAVETWTEKDHIDITINPVQMLH
FT                   DFSKYRQRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRIRGVGVNEYGLPMAVAQVL
FT                   SQSLAQNLGIQWEPSSRKPKCECIESWGGCIMEETGVSHSRKFSKCSILEYRDFLQRGG
FT                   GACLFNRPTKLFEPTECGNGYVEAGEECDCGFHVECYGVCCKKCSLSNGAHCSDGPCCN
FT                   NTSCLFQSRGYECRDAVNSCDITEYCTGDSGQCPPNLHKQDGYSCNQNQGRCYNGECKT
FT                   RDNQCQYIWGTKAAGSDKFCYEKLNTEGTEKGNCGKDGDRWIPCSKHDVFCGFLLCTNL
FT                   TRAPRIGQLQGEIIPTSFYHQGRVIDCSGAHVVLDDDTDVGYVEDGTPCGPSMMCLDRK
FT                   CLQIQALNMSSCPLDSRGKVCSGHGVCSNEATCICDFTWAGTDCSIRDPVRNPNPPKDE
FT                   GPKGPSATNLIIGSIAGAILVAAIVLGGTGWGFKNVKKRRFDPTQQGPI"
FT   gap             11719607..11719626
FT                   /estimated_length=20
FT   gap             11734473..11734555
FT                   /estimated_length=83
FT   gap             11768544..11770600
FT                   /estimated_length=2057
FT   gap             11781399..11781446
FT                   /estimated_length=48
FT   gap             11788180..11788253
FT                   /estimated_length=74
FT   gap             11793521..11794181
FT                   /estimated_length=661
FT   gap             11814923..11815047
FT                   /estimated_length=125
FT   gap             11816668..11816687
FT                   /estimated_length=20
FT   gap             11820260..11820303
FT                   /estimated_length=44
FT   gap             11838276..11838295
FT                   /estimated_length=20
FT   gap             11850724..11851271
FT                   /estimated_length=548
FT   gap             11872342..11872361
FT                   /estimated_length=20
FT   gap             11895928..11895947
FT                   /estimated_length=20
FT   gap             11905042..11905081
FT                   /estimated_length=40
FT   gap             11928080..11928099
FT                   /estimated_length=20
FT   gap             11943291..11943310
FT                   /estimated_length=20
FT   gap             11945567..11945805
FT                   /estimated_length=239
FT   gap             11967292..11967708
FT                   /estimated_length=417
FT   gap             11971117..11971265
FT                   /estimated_length=149
FT   gene            complement(11975582..12007196)
FT                   /gene="Mdh1b"
FT                   /locus_tag="mCG_113879"
FT                   /note="gene_id=mCG113879.1"
FT   mRNA            complement(join(11975582..11975792,11978331..11978396,
FT                   11987864..11987915,11988201..11988340,11992072..11992235,
FT                   11995399..11995540,11996402..11996898,11998320..11998462,
FT                   11998640..11998774,12002442..12002554,12007127..12007196))
FT                   /gene="Mdh1b"
FT                   /locus_tag="mCG_113879"
FT                   /product="malate dehydrogenase 1B, NAD (soluble)"
FT                   /note="gene_id=mCG113879.1 transcript_id=mCT114968.1
FT                   created on 01-APR-2003"
FT   CDS             complement(join(11975764..11975792,11978331..11978396,
FT                   11987864..11987915,11988201..11988340,11992072..11992235,
FT                   11995399..11995540,11996402..11996898,11998320..11998462,
FT                   11998640..11998774,12002442..12002554,12007127..12007148))
FT                   /codon_start=1
FT                   /gene="Mdh1b"
FT                   /locus_tag="mCG_113879"
FT                   /product="malate dehydrogenase 1B, NAD (soluble)"
FT                   /note="gene_id=mCG113879.1 transcript_id=mCT114968.1
FT                   protein_id=mCP74812.1"
FT                   /protein_id="EDL00190.1"
FT                   /translation="MAKFVIAGKANCPYYAKAELLADYLQKNLPDFRIFKITQHPDKWE
FT                   DWVEDVCERNMWDHRTSPIIWRELLDRGGRGLLLGGYNEFLEHAQLYYGVTSNMTTELM
FT                   MVIAKENMQTHTEQQLDKETMKDLISPLQVWIASAGTYVCCHLIPLLLSGEVFGMHTEI
FT                   SLTLFDQEQREDCLRSIVMETQDLASPVLRTVSFCTTVKEAFLQAQVIIILDDSTEEEV
FT                   YSLESCLRSRVPLCRLYGYLIEKNAHKSVKVIVGGKNFVNLKTTLLMQYAPNIASNIIA
FT                   VALGVEGQAKAVLARKMKTTSANIKDVIIWGNITGNNYVDLRKAKVYNYESAVKGPPGH
FT                   YHSVLSLIFDREWITKEFVQTLKILSSTGKQFGGILAAHSIATTLKYWYHGSPPGEIVS
FT                   LGVMSEGQFDIPEGIVFSMPVKFENGTWVVLTDLEDISLSEKTLSRLTGDLIQEKLVAC
FT                   GDLLTFQPIEEDPKDNEPSNTGMNEEKEQPGSDDSDEKNEDQ"
FT   gap             11990663..11990776
FT                   /estimated_length=114
FT   gap             11997973..11998189
FT                   /estimated_length=217
FT   gene            12007111..12029343
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /note="gene_id=mCG113881.1"
FT   mRNA            join(12007111..12007118,12028141..12028250,
FT                   12029169..12029334)
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, transcript variant
FT                   mCT173265"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT173265.0
FT                   created on 09-SEP-2002"
FT   mRNA            join(12007327..12007344,12028161..12028250,
FT                   12029169..12029343)
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, transcript variant
FT                   mCT173266"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT173266.0
FT                   created on 09-SEP-2002"
FT   mRNA            join(<12007416..12007547,12008256..12009077,
FT                   12011596..12011699,12012327..12012435,12012710..12012833,
FT                   12014644..12014783,12016047..12016219,12022704..12022867,
FT                   12024831..12025043,12026558..12026642,12028136..12028250,
FT                   12029169..12029336)
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, transcript variant
FT                   mCT114970"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT114970.1
FT                   created on 09-SEP-2002"
FT   CDS             join(12007416..12007547,12008256..12009077,
FT                   12011596..12011699,12012327..12012435,12012710..12012833,
FT                   12014644..12014783,12016047..12016219,12022704..12022867,
FT                   12024831..12025043,12026558..12026642,12028136..12028250,
FT                   12029169..12029276)
FT                   /codon_start=1
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, isoform CRA_b"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT114970.1
FT                   protein_id=mCP74823.1 isoform=CRA_b"
FT                   /protein_id="EDL00192.1"
FT                   /translation="MASTVAENRCFLTYKRIRNTSPDAPLEEELSWLRLCVVTGFCSKD
FT                   SPQHVLFFRKTATCVASWVFESVPIDSRMNSKARSLLWTIRRFSTLLPRSRALRIDPLG
FT                   TCRPEVIHSKWNPRNHRLNVFDEGLQPSVRYLFQDIFISKSVDGCIQTKGISHSAVFKP
FT                   DRLLCPRRLSFDAKHSFVSDGTSDHDLKKINFHHTSSEDVFTKKVRPTPVNYKKLAQEC
FT                   NSLSDVLDTFSKAPTFPGSNYFLAMWIIAKRISEDKRRFERQLMFSHPAFNQLCEQMMR
FT                   EAKIMHYDHLLFSLNAIVKLGIPQNTLMVQTLLRTIQERINECDERCLSILSTALVSME
FT                   PCMNVNALRAGLRILVDQQVWNIKHVFTLQTVMKCIGKDAPSALKKKLEMKALKELGRF
FT                   SILNSQHMFEVLAAMDLRSVVLLNECSKVVIDNVHGCPFKVLISILQSCRDLRYQNEDL
FT                   FKSIAEYVATTFDIWKLKQVIFFLLLFETLGFRPPGLMDKLMEKVVQEPGSLNVKNIVS
FT                   ILHVYSSLNHVHKIHNREFLEALASALTGCLHHISSESLLNAVHSFCMMNYFPLAPINQ
FT                   LIKENIINELLTSGDTEKNIHKLHVLNTCLKLDESTYKSVHIPLPQLPLSASQPNEKLA
FT                   EVLSRLLEGEGRFSRNVPLPHNYHIDFEIRMDTNRTQVFSFSDVDASSATNMQRVAVLC
FT                   VPKSVYCLNSCHPRGLMAMKIRHLNVMGFHVILIHNWELKKLKMEDAVTFVRKKIYSDE
FT                   VLPTADTTV"
FT   CDS             join(12028200..12028250,12029169..12029276)
FT                   /codon_start=1
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, isoform CRA_a"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT173265.0
FT                   protein_id=mCP96184.0 isoform=CRA_a"
FT                   /protein_id="EDL00191.1"
FT                   /translation="MAMKIRHLNVMGFHVILIHNWELKKLKMEDAVTFVRKKIYSDEVL
FT                   PTADTTV"
FT   CDS             join(12028200..12028250,12029169..12029276)
FT                   /codon_start=1
FT                   /gene="Fastkd2"
FT                   /locus_tag="mCG_113881"
FT                   /product="FAST kinase domains 2, isoform CRA_a"
FT                   /note="gene_id=mCG113881.1 transcript_id=mCT173266.0
FT                   protein_id=mCP96185.0 isoform=CRA_a"
FT                   /protein_id="EDL00193.1"
FT                   /translation="MAMKIRHLNVMGFHVILIHNWELKKLKMEDAVTFVRKKIYSDEVL
FT                   PTADTTV"
FT   gene            complement(12031778..12046233)
FT                   /locus_tag="mCG_113882"
FT                   /note="gene_id=mCG113882.1"
FT   mRNA            complement(join(12031778..12033291,12045349..12045506,
FT                   12046145..12046233))
FT                   /locus_tag="mCG_113882"
FT                   /product="mCG113882"
FT                   /note="gene_id=mCG113882.1 transcript_id=mCT114971.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(join(12032971..12033291,12045349..12045506,
FT                   12046145..12046169))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113882"
FT                   /product="mCG113882"
FT                   /note="gene_id=mCG113882.1 transcript_id=mCT114971.0
FT                   protein_id=mCP74848.1"
FT                   /db_xref="GOA:Q9D4D3"
FT                   /db_xref="MGI:MGI:1921676"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D4D3"
FT                   /protein_id="EDL00194.1"
FT                   /translation="MDMNYFRRGQPALFSTDLKPNCPRRLEMFAAATERKLESAVLHNF
FT                   PKSKENIGKLSARSQKDNMIPGWEQCLRGQWKTCSELWEKNRKPKCEKNRRKTKGGGMV
FT                   SLLPCLLEKCAESKITCQSSLKKPLVRMTRHCHRTCSQKELHLLLRAQNLGNHHDDLSR
FT                   ALLH"
FT   gap             12034537..12034668
FT                   /estimated_length=132
FT   gap             12049465..12050098
FT                   /estimated_length=634
FT   gap             12059030..12060108
FT                   /estimated_length=1079
FT   gap             12064957..12065202
FT                   /estimated_length=246
FT   gap             12066418..12066965
FT                   /estimated_length=548
FT   gap             12072919..12075862
FT                   /estimated_length=2944
FT   gap             12104086..12108183
FT                   /estimated_length=4098
FT   gap             12110810..12111674
FT                   /estimated_length=865
FT   gap             12125606..12125625
FT                   /estimated_length=20
FT   gap             12135695..12137407
FT                   /estimated_length=1713
FT   gap             12147613..12147978
FT                   /estimated_length=366
FT   gap             12161016..12161052
FT                   /estimated_length=37
FT   gap             12172674..12172693
FT                   /estimated_length=20
FT   gap             12184525..12184637
FT                   /estimated_length=113
FT   gap             12190295..12190427
FT                   /estimated_length=133
FT   gap             12210899..12211045
FT                   /estimated_length=147
FT   gap             12223394..12223413
FT                   /estimated_length=20
FT   gene            12230146..12234318
FT                   /locus_tag="mCG_146953"
FT                   /note="gene_id=mCG146953.0"
FT   mRNA            join(12230146..12230218,12232959..12234318)
FT                   /locus_tag="mCG_146953"
FT                   /product="mCG146953"
FT                   /note="gene_id=mCG146953.0 transcript_id=mCT187216.0
FT                   created on 13-JAN-2004"
FT   gap             12230494..12230580
FT                   /estimated_length=87
FT   gap             12231825..12231844
FT                   /estimated_length=20
FT   CDS             12233329..12233430
FT                   /codon_start=1
FT                   /locus_tag="mCG_146953"
FT                   /product="mCG146953"
FT                   /note="gene_id=mCG146953.0 transcript_id=mCT187216.0
FT                   protein_id=mCP109552.0"
FT                   /protein_id="EDL00195.1"
FT                   /translation="MAWHFDSRLTHHPSHCSSYSLPASLYPVSAARS"
FT   gap             12236234..12236253
FT                   /estimated_length=20
FT   gap             12246729..12246748
FT                   /estimated_length=20
FT   gap             12279784..12279803
FT                   /estimated_length=20
FT   gap             12286604..12286623
FT                   /estimated_length=20
FT   gap             12287945..12287964
FT                   /estimated_length=20
FT   gene            12296109..12299576
FT                   /locus_tag="mCG_1035680"
FT                   /note="gene_id=mCG1035680.1"
FT   mRNA            join(12296109..12296494,12296764..12299576)
FT                   /locus_tag="mCG_1035680"
FT                   /product="mCG1035680"
FT                   /note="gene_id=mCG1035680.1 transcript_id=mCT153384.1
FT                   created on 19-MAR-2003"
FT   CDS             12298240..12298485
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035680"
FT                   /product="mCG1035680"
FT                   /note="gene_id=mCG1035680.1 transcript_id=mCT153384.1
FT                   protein_id=mCP74777.1"
FT                   /protein_id="EDL00196.1"
FT                   /translation="MLELANPPPPPFVFPWMQIDTDHLEAYPKFKSLNTLFSNFKEDLK
FT                   IKNKLKKIPRNPSCSSDMRLALFLPCYHQAIKDGKG"
FT   gene            complement(12299971..12388002)
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /note="gene_id=mCG113878.1"
FT   mRNA            complement(join(12299971..12302432,12308971..12309094,
FT                   12345375..12346002,12387478..12388002))
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /product="Kruppel-like factor 7 (ubiquitous), transcript
FT                   variant mCT114967"
FT                   /note="gene_id=mCG113878.1 transcript_id=mCT114967.1
FT                   created on 16-JUL-2002"
FT   CDS             complement(join(12302381..12302432,12308971..12309094,
FT                   12345375..12346002,12387478..12387579))
FT                   /codon_start=1
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /product="Kruppel-like factor 7 (ubiquitous), isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG113878.1 transcript_id=mCT114967.1
FT                   protein_id=mCP74805.1 isoform=CRA_a"
FT                   /protein_id="EDL00197.1"
FT                   /translation="MDVLASYSIFQELQLVHDTGYFSALPSLEETWQQTCLELERYLQT
FT                   EPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEATICEKSSAVDILLSRDKL
FT                   LSETCLSLQPTSSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHLVKTSQTLSAVDGTVT
FT                   LKLVAKKASLSSVKVGGVAAAAAVTPAGAVKSGQSDSEQGGGGADTCPENKKRVHRCQF
FT                   NGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELTRHYRKHTGAKPFKCN
FT                   HCDRCFSRSDHLALHMKRHI"
FT   mRNA            complement(join(<12302383..12302432,12308971..12309094,
FT                   12345375..12346002,12387478..12387717,12387964..>12387978))
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /product="Kruppel-like factor 7 (ubiquitous), transcript
FT                   variant mCT189248"
FT                   /note="gene_id=mCG113878.1 transcript_id=mCT189248.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(<12302383..12302432,12308971..12309094,
FT                   12345375..12346002,12387478..>12387624))
FT                   /codon_start=1
FT                   /gene="Klf7"
FT                   /locus_tag="mCG_113878"
FT                   /product="Kruppel-like factor 7 (ubiquitous), isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG113878.1 transcript_id=mCT189248.0
FT                   protein_id=mCP110238.0 isoform=CRA_b"
FT                   /protein_id="EDL00198.1"
FT                   /translation="ARGRVSPPVLPGSSSMDVLASYSIFQELQLVHDTGYFSALPSLEE
FT                   TWQQTCLELERYLQTEPRRISETFGEDLDCFLHASPPPCIEESFRRLDPLLLPVEATIC
FT                   EKSSAVDILLSRDKLLSETCLSLQPTSSSLDSYTAVNQAQLNAVTSLTPPSSPELSRHL
FT                   VKTSQTLSAVDGTVTLKLVAKKASLSSVKVGGVAAAAAVTPAGAVKSGQSDSEQGGGGA
FT                   DTCPENKKRVHRCQFNGCRKVYTKSSHLKAHQRTHTGEKPYKCSWEGCEWRFARSDELT
FT                   RHYRKHTGAKPFKCNHCDRCFSRSDHLALHMKRHI"
FT   gap             12388096..12388181
FT                   /estimated_length=86
FT   gene            12416721..12417430
FT                   /pseudo
FT                   /locus_tag="mCG_1035533"
FT                   /note="gene_id=mCG1035533.2"
FT   mRNA            12416721..12417430
FT                   /pseudo
FT                   /locus_tag="mCG_1035533"
FT                   /note="gene_id=mCG1035533.2 transcript_id=mCT153237.1
FT                   created on 16-JUL-2003"
FT   gap             12418208..12418227
FT                   /estimated_length=20
FT   gap             12436510..12436702
FT                   /estimated_length=193
FT   gap             12442690..12443154
FT                   /estimated_length=465
FT   gene            complement(12445858..12562617)
FT                   /locus_tag="mCG_146955"
FT                   /note="gene_id=mCG146955.0"
FT   mRNA            complement(join(12445858..12447106,12562580..12562617))
FT                   /locus_tag="mCG_146955"
FT                   /product="mCG146955"
FT                   /note="gene_id=mCG146955.0 transcript_id=mCT187218.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(12446862..12447104)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146955"
FT                   /product="mCG146955"
FT                   /note="gene_id=mCG146955.0 transcript_id=mCT187218.0
FT                   protein_id=mCP109554.0"
FT                   /protein_id="EDL00199.1"
FT                   /translation="MNAGKYDYEDLTICPIEGKLSFPLGKGEGSSCTRVSTRPSDLVIS
FT                   VYCSGIRTLLTSWLLSCVSELRGRHMQRRRSTYPH"
FT   gap             12487227..12487246
FT                   /estimated_length=20
FT   gap             12498928..12498947
FT                   /estimated_length=20
FT   gap             12515393..12515412
FT                   /estimated_length=20
FT   gap             12520312..12520331
FT                   /estimated_length=20
FT   gap             12524362..12525552
FT                   /estimated_length=1191
FT   gap             12536272..12536291
FT                   /estimated_length=20
FT   gap             12562702..12562721
FT                   /estimated_length=20
FT   gap             12585330..12585349
FT                   /estimated_length=20
FT   gap             12679460..12679513
FT                   /estimated_length=54
FT   gap             12688408..12688427
FT                   /estimated_length=20
FT   gap             12698237..12698539
FT                   /estimated_length=303
FT   gap             12720172..12720331
FT                   /estimated_length=160
FT   gap             12723649..12724003
FT                   /estimated_length=355
FT   gap             12773348..12773463
FT                   /estimated_length=116
FT   gene            <12784683..12854752
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /note="gene_id=mCG113880.1"
FT   mRNA            join(12784683..12784904,12803007..12803128,
FT                   12810656..12810802,12811499..12811540,12817970..12818070,
FT                   12821887..12822029,12825826..12826008,12827922..12828072,
FT                   12849018..12854752)
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   transcript variant mCT114969"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT114969.0
FT                   created on 22-JUL-2002"
FT   mRNA            join(12784683..12784904,12803007..12803128,
FT                   12810656..12810802,12817970..12818070,12821887..12822029,
FT                   12827922..12828072,12849018..12854752)
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   transcript variant mCT171045"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171045.0
FT                   created on 22-JUL-2002"
FT   mRNA            join(<12784683..12784904,12810656..12810802,
FT                   12817970..12818070,12821887..12822029,12825826..12826008,
FT                   12827922..12828072,12849018..12854752)
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   transcript variant mCT171046"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171046.0
FT                   created on 22-JUL-2002"
FT   mRNA            join(12784684..12784904,12803007..12803128,
FT                   12810656..12810802,12817970..12818070,12821887..12822029,
FT                   12825826..12826008,12827922..12828072,12849018..12854752)
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   transcript variant mCT171044"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171044.0
FT                   created on 22-JUL-2002"
FT   CDS             join(<12784818..12784904,12810656..12810802,
FT                   12817970..12818070,12821887..12822029,12825826..12826008,
FT                   12827922..12828072,12849018..12849162)
FT                   /codon_start=1
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171046.0
FT                   protein_id=mCP93964.0 isoform=CRA_d"
FT                   /protein_id="EDL00203.1"
FT                   /translation="RGVLRGGENKTPARSGPRTKAVTEELVPPVSMPAAHATSSAPTVT
FT                   LVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTDSQKRREI
FT                   LSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSSGQYIAIT
FT                   QGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVPSNQVVVQAA
FT                   SGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARECRRKK
FT                   KEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD"
FT   gap             12785005..12785525
FT                   /estimated_length=521
FT   gap             12797160..12797179
FT                   /estimated_length=20
FT   CDS             join(12803015..12803128,12810656..12810802,
FT                   12811499..12811540,12817970..12818070,12821887..12822029,
FT                   12825826..12826008,12827922..12828072,12849018..12849162)
FT                   /codon_start=1
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT114969.0
FT                   protein_id=mCP74815.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q547S9"
FT                   /db_xref="InterPro:IPR001630"
FT                   /db_xref="InterPro:IPR003102"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="MGI:MGI:88494"
FT                   /db_xref="UniProtKB/TrEMBL:Q547S9"
FT                   /protein_id="EDL00202.1"
FT                   /translation="MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAH
FT                   ATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQIST
FT                   IAESEDSQESVDSVTDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAP
FT                   AITTVTVPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTIL
FT                   QYAQTTDGQQILVPSNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEE
FT                   AARKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKS
FT                   D"
FT   CDS             join(12803015..12803128,12810656..12810802,
FT                   12817970..12818070,12821887..12822029,12825826..12826008,
FT                   12827922..12828072,12849018..12849162)
FT                   /codon_start=1
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171044.0
FT                   protein_id=mCP93963.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q543W0"
FT                   /db_xref="InterPro:IPR001630"
FT                   /db_xref="InterPro:IPR003102"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="MGI:MGI:88494"
FT                   /db_xref="UniProtKB/TrEMBL:Q543W0"
FT                   /protein_id="EDL00200.1"
FT                   /translation="MTMESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAH
FT                   ATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSV
FT                   TDSQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQT
FT                   SSGQYIAITQGGAIQLANNGTDGVQGLQTLTMTNAAATQPGTTILQYAQTTDGQQILVP
FT                   SNQVVVQAASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNRE
FT                   AARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD"
FT   CDS             join(12803021..12803128,12810656..12810802,
FT                   12817970..12818070,12821887..12822029,12827922..12828072,
FT                   12849018..12849162)
FT                   /codon_start=1
FT                   /gene="Creb1"
FT                   /locus_tag="mCG_113880"
FT                   /product="cAMP responsive element binding protein 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG113880.1 transcript_id=mCT171045.0
FT                   protein_id=mCP93962.0 isoform=CRA_b"
FT                   /protein_id="EDL00201.1"
FT                   /translation="MESGADNQQSGDAAVTEAENQQMTVQAQPQIATLAQVSMPAAHAT
FT                   SSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQISTIAESEDSQESVDSVTD
FT                   SQKRREILSRRPSYRKILNDLSSDAPGVPRIEEEKSEEETSAPAITTVTVPTPIYQTSS
FT                   GQYTASGDVQTYQIRTAPTSTIAPGVVMASSPALPTQPAEEAARKREVRLMKNREAARE
FT                   CRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKSD"
FT   gap             12840239..12840314
FT                   /estimated_length=76
FT   gene            complement(12858264..12869036)
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /note="gene_id=mCG123126.1"
FT   mRNA            complement(join(12858264..12859921,12866906..12867017,
FT                   12868081..12868252,12868970..12869036))
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /product="RIKEN cDNA 2310038H17, transcript variant
FT                   mCT124355"
FT                   /note="gene_id=mCG123126.1 transcript_id=mCT124355.1
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(12858264..12859921,12866906..12867017,
FT                   12868081..>12868977))
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /product="RIKEN cDNA 2310038H17, transcript variant
FT                   mCT189292"
FT                   /note="gene_id=mCG123126.1 transcript_id=mCT189292.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(12859524..12859921,12866906..12867017,
FT                   12868081..>12868236))
FT                   /codon_start=1
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /product="RIKEN cDNA 2310038H17, isoform CRA_a"
FT                   /note="gene_id=mCG123126.1 transcript_id=mCT189292.0
FT                   protein_id=mCP110265.0 isoform=CRA_a"
FT                   /protein_id="EDL00204.1"
FT                   /translation="TEEMALVPYEESAAIGLQKFHKPLATFSFANHTIQIRQDWRQLGV
FT                   AAVVWDAAVVLSMYLEMGAVELRGCSAVELGAGTGLVGIVAALLGAQVTITDRKVALEF
FT                   LKSNVEANLPPHIQPKAVVKELTWGQNLESFSPGEFDLILGADVIYLEDTFTDLLQTLG
FT                   HLCSNNSVILLACRIRYERDSNFLTMLERQFTVSKVHYDPEKDVHIYKAQKRNQREDL"
FT   CDS             complement(join(12859524..12859921,12866906..12867017,
FT                   12868081..12868227))
FT                   /codon_start=1
FT                   /gene="2310038H17Rik"
FT                   /locus_tag="mCG_123126"
FT                   /product="RIKEN cDNA 2310038H17, isoform CRA_b"
FT                   /note="gene_id=mCG123126.1 transcript_id=mCT124355.1
FT                   protein_id=mCP74830.1 isoform=CRA_b"
FT                   /protein_id="EDL00205.1"
FT                   /translation="MALVPYEESAAIGLQKFHKPLATFSFANHTIQIRQDWRQLGVAAV
FT                   VWDAAVVLSMYLEMGAVELRGCSAVELGAGTGLVGIVAALLGAQVTITDRKVALEFLKS
FT                   NVEANLPPHIQPKAVVKELTWGQNLESFSPGEFDLILGADVIYLEDTFTDLLQTLGHLC
FT                   SNNSVILLACRIRYERDSNFLTMLERQFTVSKVHYDPEKDVHIYKAQKRNQREDL"
FT   gap             12882363..12883117
FT                   /estimated_length=755
FT   gap             12927262..12927811
FT                   /estimated_length=550
FT   gene            complement(12931921..12942630)
FT                   /locus_tag="mCG_1035592"
FT                   /note="gene_id=mCG1035592.1"
FT   mRNA            complement(join(12931921..12932435,12942434..12942630))
FT                   /locus_tag="mCG_1035592"
FT                   /product="mCG1035592"
FT                   /note="gene_id=mCG1035592.1 transcript_id=mCT153296.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(12932096..12932242)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035592"
FT                   /product="mCG1035592"
FT                   /note="gene_id=mCG1035592.1 transcript_id=mCT153296.0
FT                   protein_id=mCP74570.1"
FT                   /protein_id="EDL00206.1"
FT                   /translation="MSNTPDTTNLHFATGSHHMLSSHPSPLKNKRKMYDGQVKNDRKSS
FT                   SQA"
FT   gap             12943246..12943278
FT                   /estimated_length=33
FT   gene            12943279..12977661
FT                   /locus_tag="mCG_123133"
FT                   /note="gene_id=mCG123133.1"
FT   mRNA            join(12943279..12943351,12952918..12952992,
FT                   12954295..12954329,12960327..12960427,12963329..12963402,
FT                   12965056..12965107,12966514..12966633,12970163..12970329,
FT                   12973660..12973822,12975674..12977661)
FT                   /locus_tag="mCG_123133"
FT                   /product="mCG123133"
FT                   /note="gene_id=mCG123133.1 transcript_id=mCT124362.1
FT                   created on 18-NOV-2002"
FT   CDS             join(12960425..12960427,12963329..12963402,
FT                   12965056..12965107,12966514..12966633,12970163..12970329,
FT                   12973660..12973822,12975674..12975952)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123133"
FT                   /product="mCG123133"
FT                   /note="gene_id=mCG123133.1 transcript_id=mCT124362.1
FT                   protein_id=mCP74452.1"
FT                   /protein_id="EDL00207.1"
FT                   /translation="MKTNCFKYFFSFHSVTLAIYYHIKNRDANRSLDIFDERSHPLTRE
FT                   KVPEEYFKHDPEHKFIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPTNWKR
FT                   IVLGAILLASKVWDDQAVWNVDYCQILKDITVEDMNEMERHFLELLQFNINVPASVYAK
FT                   YYFDLRSLADDNNLNFLFAPLSKERAQNLERETRGVRTPGTPHRQAGATAPLLIREQQR
FT                   WDSTGWEDLGFKRLWTVTADSIGKNGTLSKQQLSVLCNVNGYRNHSTATALTTDRAYHV
FT                   GQWL"
FT   gap             12967782..12967801
FT                   /estimated_length=20
FT   gap             12978704..12978723
FT                   /estimated_length=20
FT   gap             12981155..12981527
FT                   /estimated_length=373
FT   gene            complement(12986522..12989860)
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /note="gene_id=mCG123123.1"
FT   mRNA            complement(join(12986522..12988963,12989350..12989860))
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /product="frizzled homolog 5 (Drosophila), transcript
FT                   variant mCT170710"
FT                   /note="gene_id=mCG123123.1 transcript_id=mCT170710.0
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(12986523..12988963,12989243..12989492))
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /product="frizzled homolog 5 (Drosophila), transcript
FT                   variant mCT124352"
FT                   /note="gene_id=mCG123123.1 transcript_id=mCT124352.1
FT                   created on 16-JUL-2002"
FT   CDS             complement(12986953..12988710)
FT                   /codon_start=1
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /product="frizzled homolog 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG123123.1 transcript_id=mCT124352.1
FT                   protein_id=mCP74653.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9EQD0"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026547"
FT                   /db_xref="MGI:MGI:108571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQD0"
FT                   /protein_id="EDL00208.1"
FT                   /translation="MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIG
FT                   YNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPP
FT                   CRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSF
FT                   PAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPC
FT                   YQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCV
FT                   SLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTW
FT                   FLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNS
FT                   LRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYT
FT                   VPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITS
FT                   GVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAY
FT                   HKQVSLSHV"
FT   CDS             complement(12986953..12988710)
FT                   /codon_start=1
FT                   /gene="Fzd5"
FT                   /locus_tag="mCG_123123"
FT                   /product="frizzled homolog 5 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG123123.1 transcript_id=mCT170710.0
FT                   protein_id=mCP93628.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9EQD0"
FT                   /db_xref="InterPro:IPR000539"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR017981"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026547"
FT                   /db_xref="MGI:MGI:108571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9EQD0"
FT                   /protein_id="EDL00209.1"
FT                   /translation="MARPDPSAPPSLLLLLLAQLVGRAAAASKAPVCQEITVPMCRGIG
FT                   YNLTHMPNQFNHDTQDEAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPP
FT                   CRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGGDAEVLCMDYNRSEATTASPKSF
FT                   PAKPTLPGPPGAPSSGGECPSGGPSVCTCREPFVPILKESHPLYNKVRTGQVPNCAVPC
FT                   YQPSFSPDERTFATFWIGLWSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCV
FT                   SLGFLVRLVVGHASVACSREHSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTW
FT                   FLAAGMKWGNEAIAGYAQYFHLAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNS
FT                   LRGFVLGPLVLYLLVGTLFLLAGFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYT
FT                   VPASIVVACYLYEQHYRESWEAALTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITS
FT                   GVWIWSGKTLESWRRFTSRCCCSSRRGHKSGGAMAAGDYAEASAALTGRTGPPGPTAAY
FT                   HKQVSLSHV"
FT   gap             13011691..13011710
FT                   /estimated_length=20
FT   gene            complement(13046090..>13207792)
FT                   /locus_tag="mCG_123132"
FT                   /note="gene_id=mCG123132.1"
FT   mRNA            complement(join(13046090..13046986,13070483..13070640,
FT                   13111729..13111792,13133639..13133832,13143234..13143379,
FT                   13172065..13172997,13188490..13189171,13207661..13207792))
FT                   /locus_tag="mCG_123132"
FT                   /product="mCG123132, transcript variant mCT124361"
FT                   /note="gene_id=mCG123132.1 transcript_id=mCT124361.1
FT                   created on 18-NOV-2002"
FT   mRNA            complement(join(13046679..13046986,13070483..13070640,
FT                   13111729..13111792,13133639..13133832,13143234..13143379,
FT                   13172065..13172997,13188329..13189171,13207741..>13207792))
FT                   /locus_tag="mCG_123132"
FT                   /product="mCG123132, transcript variant mCT189249"
FT                   /note="gene_id=mCG123132.1 transcript_id=mCT189249.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(13046809..13046986,13070483..13070640,
FT                   13111729..13111792,13133639..13133832,13143234..13143379,
FT                   13172065..13172997,13188329..>13188959))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123132"
FT                   /product="mCG123132, isoform CRA_b"
FT                   /note="gene_id=mCG123132.1 transcript_id=mCT189249.0
FT                   protein_id=mCP110266.0 isoform=CRA_b"
FT                   /protein_id="EDL00211.1"
FT                   /translation="KLGPCVMEALEVDDISPALEVTEDFFSTFDSKLEKAVQQAEVYGI
FT                   QEVPELVGHEVLGNIADNGALRSVASLGKGTMIWDHCKSRLLETKAQNVFPAKEQLMVQ
FT                   RGTAPDNLSWMAQKEASTFNFFNICQRRRDRPRSVNDLLDETTTFKPGHARSRSDVTHV
FT                   DWRVVLSTMPLQQQQQQQQASLQGIHFPGPSFLLSSPSKVEDAQGNTEHKQTFPNILKK
FT                   GYLEIRKNHDSYWQSCYAELSPYNLNFYSLDSSGNQNLYATYQLSHFQSISVLGNLEAR
FT                   MVDTVLYDNSQLQLKAESPWEALDWGQKLWEVVHAAVPNYMGRQGEMANSPGLIHHGDC
FT                   AQNHCLQKKSSGLLASPVLDSPKQYQNILKSGTLYRLTVQNNWKAFTFVLSKAYLMAFH
FT                   PGKLDEDPLLSYNVDVCLAVQIDNLDGCDSCFQVIFPQDVLRLRAETRQRAQEWMEALK
FT                   TAANAARSSEQNLQVTLRNKPKDQLDGRELRKNKRQSVTTSFLSILTTLSLERGLTAQS
FT                   FKCAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVHNWDTSKYKVSKQAK
FT                   EFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYLFSCRAAVAEDLRRR
FT                   IFPREYLLQQIHLYSLADLQQVIEGKLAPFLGKVIKFATAHVYSCSLCSQKGFICEICN
FT                   NGEILYPFEDISTSRCESCGAVFHSECKEKSVPCPRCVRRELQKKQKSFWRQLNVDESL
FT                   EEACAMFELSYQST"
FT   CDS             complement(join(13046809..13046986,13070483..13070640,
FT                   13111729..13111792,13133639..13133832,13143234..13143379,
FT                   13172065..13172785))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123132"
FT                   /product="mCG123132, isoform CRA_a"
FT                   /note="gene_id=mCG123132.1 transcript_id=mCT124361.1
FT                   protein_id=mCP74448.1 isoform=CRA_a"
FT                   /protein_id="EDL00210.1"
FT                   /translation="MVDTVLYDNSQLQLKAESPWEALDWGQKLWEVVHAAVPNYMGRQG
FT                   EMANSPGLIHHGDCAQNHCLQKKSSGLLASPVLDSPKQYQNILKSGTLYRLTVQNNWKA
FT                   FTFVLSKAYLMAFHPGKLDEDPLLSYNVDVCLAVQIDNLDGCDSCFQVIFPQDVLRLRA
FT                   ETRQRAQEWMEALKTAANAARSSEQNLQVTLRNKPKDQLDGRELRKNKRQSVTTSFLSI
FT                   LTTLSLERGLTAQSFKCAGCQRSIGLSNGKAKVCNYSGWYYCSSCHVDDSFLIPARIVH
FT                   NWDTSKYKVSKQAKEFLEYVYEEPLIDIQQENPMLYLHAEPLATVVRLRQRLKSLRAYL
FT                   FSCRAAVAEDLRRRIFPREYLLQQIHLYSLADLQQVIEGKLAPFLGKVIKFATAHVYSC
FT                   SLCSQKGFICEICNNGEILYPFEDISTSRCESCGAVFHSECKEKSVPCPRCVRRELQKK
FT                   QKSFWRQLNVDESLEEACAMFELSYQST"
FT   gap             13108914..13108933
FT                   /estimated_length=20
FT   gap             13152803..13152822
FT                   /estimated_length=20
FT   gap             13185562..13185836
FT                   /estimated_length=275
FT   gap             13191683..13191702
FT                   /estimated_length=20
FT   gap             13195183..13195202
FT                   /estimated_length=20
FT   gene            complement(13237807..13238506)
FT                   /locus_tag="mCG_123122"
FT                   /note="gene_id=mCG123122.1"
FT   mRNA            complement(13237807..13238506)
FT                   /locus_tag="mCG_123122"
FT                   /product="mCG123122"
FT                   /note="gene_id=mCG123122.1 transcript_id=mCT124351.0
FT                   created on 16-JUL-2002"
FT   CDS             complement(13237838..13238491)
FT                   /codon_start=1
FT                   /locus_tag="mCG_123122"
FT                   /product="mCG123122"
FT                   /note="gene_id=mCG123122.1 transcript_id=mCT124351.0
FT                   protein_id=mCP74652.1"
FT                   /db_xref="GOA:Q5XJF6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR016094"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="MGI:MGI:1343877"
FT                   /db_xref="UniProtKB/TrEMBL:Q5XJF6"
FT                   /protein_id="EDL00212.1"
FT                   /translation="MSSKVSRDTLYEAVREVLHGNQRKRRKFLETVELQISLKNYDPQK
FT                   DKRFSGTVRLKSTPRPKFSVCVLGDQQHCDEAKAVDIPHMDIEALKKLNKNKKLVKKLA
FT                   KKYDAFLASESLIKQIPRILGPGLNKAGKFPSLLTHNENMVAKVDEVKSTIKFQMKKVL
FT                   CLAVAVGHVKMTDDELVYNIHLAVNFLVSLLKKNWQNVRALYIKSTMGKPQRLY"
FT   gap             13247989..13248008
FT                   /estimated_length=20
FT   gene            complement(13256439..13276139)
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /note="gene_id=mCG123121.1"
FT   mRNA            complement(join(13256439..13257059,13258427..13258509,
FT                   13259817..13259982,13260415..13260524,13264777..13264899,
FT                   13265313..13265390,13268057..13268173,13268957..13269124,
FT                   13275975..13276137))
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /product="RIKEN cDNA 4921521F21, transcript variant
FT                   mCT124350"
FT                   /note="gene_id=mCG123121.1 transcript_id=mCT124350.0
FT                   created on 16-JUL-2002"
FT   mRNA            complement(join(13256836..13257059,13258427..13258509,
FT                   13259817..13259982,13260415..13260524,13264777..13264899,
FT                   13265313..13265390,13268057..13268173,13268957..13269124,
FT                   13273962..13274082,13275975..13276139))
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /product="RIKEN cDNA 4921521F21, transcript variant
FT                   mCT170709"
FT                   /note="gene_id=mCG123121.1 transcript_id=mCT170709.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(13257017..13257059,13258427..13258509,
FT                   13259817..13259982,13260415..13260524,13264777..13264899,
FT                   13265313..13265390,13268057..13268173,13268957..13269124,
FT                   13273962..13274042))
FT                   /codon_start=1
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /product="RIKEN cDNA 4921521F21, isoform CRA_b"
FT                   /note="gene_id=mCG123121.1 transcript_id=mCT170709.0
FT                   protein_id=mCP93627.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3UXL1"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:1918111"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UXL1"
FT                   /protein_id="EDL00214.1"
FT                   /translation="MNPKRYMELSDGHHIPVLGFGTFVPGEVSKSMVAKATKIAIDAGF
FT                   RHIDSAYFYQNEEEVGLAIRSKVADGTVRREDIFYTSKLPCTCHRPELVQPCLEQSLRK
FT                   LQLDYVDLYLIHCPVSMKPGNDLIPTDENGKLLFDTVDLCDTWEAMEKCKDSGLAKSIG
FT                   VSNFNRRQLEMILNKPGLRYKPVCNQVECHPYLNQSKLLDYCKSKDIVLVAYGALGSQR
FT                   CKNWIEENAPYLLEDPTLCAMAEKHKQTPALISLRYLLQRGIVIVTKSFNEKRIKENLK
FT                   VFEFHLPAEDMAVIDRLNRNYRYATARIISAHPNYPFLDEY"
FT   CDS             complement(join(13257017..13257059,13258427..13258509,
FT                   13259817..13259982,13260415..13260524,13264777..13264899,
FT                   13265313..13265390,13268057..13268173,13268957..13269112))
FT                   /codon_start=1
FT                   /gene="4921521F21Rik"
FT                   /locus_tag="mCG_123121"
FT                   /product="RIKEN cDNA 4921521F21, isoform CRA_a"
FT                   /note="gene_id=mCG123121.1 transcript_id=mCT124350.0
FT                   protein_id=mCP74643.1 isoform=CRA_a"
FT                   /db_xref="GOA:G3XA14"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:1918111"
FT                   /db_xref="UniProtKB/TrEMBL:G3XA14"
FT                   /protein_id="EDL00213.1"
FT                   /translation="MVAKATKIAIDAGFRHIDSAYFYQNEEEVGLAIRSKVADGTVRRE
FT                   DIFYTSKLPCTCHRPELVQPCLEQSLRKLQLDYVDLYLIHCPVSMKPGNDLIPTDENGK
FT                   LLFDTVDLCDTWEAMEKCKDSGLAKSIGVSNFNRRQLEMILNKPGLRYKPVCNQVECHP
FT                   YLNQSKLLDYCKSKDIVLVAYGALGSQRCKNWIEENAPYLLEDPTLCAMAEKHKQTPAL
FT                   ISLRYLLQRGIVIVTKSFNEKRIKENLKVFEFHLPAEDMAVIDRLNRNYRYATARIISA
FT                   HPNYPFLDEY"
FT   gap             13260660..13262008
FT                   /estimated_length=1349
FT   gap             13280248..13280348
FT                   /estimated_length=101
FT   gene            complement(13291923..13294570)
FT                   /locus_tag="mCG_123124"
FT                   /note="gene_id=mCG123124.1"
FT   mRNA            complement(join(13291923..13292260,13294190..13294432,
FT                   13294525..13294570))
FT                   /locus_tag="mCG_123124"
FT                   /product="mCG123124"
FT                   /note="gene_id=mCG123124.1 transcript_id=mCT124353.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(13291988..13292260,13294190..13294432,
FT                   13294525..13294533))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123124"
FT                   /product="mCG123124"
FT                   /note="gene_id=mCG123124.1 transcript_id=mCT124353.1
FT                   protein_id=mCP74824.1"
FT                   /db_xref="GOA:A2RTH4"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="MGI:MGI:88525"
FT                   /db_xref="UniProtKB/TrEMBL:A2RTH4"
FT                   /protein_id="EDL00215.1"
FT                   /translation="MGKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWML
FT                   YEQPNFTGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHSSSHRIKIYEREDYRGQMVE
FT                   ITDDCSHLQDRFHFSDFHSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNAR
FT                   VGSLRRIMDFY"
FT   gap             13301747..13302047
FT                   /estimated_length=301
FT   gene            complement(13305289..13306885)
FT                   /locus_tag="mCG_123130"
FT                   /note="gene_id=mCG123130.2"
FT   mRNA            complement(join(13305289..13305628,13306507..13306749,
FT                   13306842..13306885))
FT                   /locus_tag="mCG_123130"
FT                   /product="mCG123130"
FT                   /note="gene_id=mCG123130.2 transcript_id=mCT124359.2
FT                   created on 23-NOV-2004"
FT   CDS             complement(join(13305356..13305628,13306507..13306749,
FT                   13306842..13306850))
FT                   /codon_start=1
FT                   /locus_tag="mCG_123130"
FT                   /product="mCG123130"
FT                   /note="gene_id=mCG123130.2 transcript_id=mCT124359.2
FT                   protein_id=mCP74430.1"
FT                   /protein_id="EDL00216.1"
FT                   /translation="MGKITFYEDRGFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWML
FT                   YEQPNFAGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHAGSHRIRLYEREEYRGQMIE
FT                   FTEDCPSLQDRFHFNEIYSLNVLEGCWVLYDMTNYRGRQYLLRPGEYRRYHDWGAMNAR
FT                   VGSLRRVMDFY"
FT   gap             13312689..13312838
FT                   /estimated_length=150
FT   gene            complement(13315115..13317099)
FT                   /gene="Crygc"
FT                   /locus_tag="mCG_123125"
FT                   /note="gene_id=mCG123125.1"
FT   mRNA            complement(join(13315115..13315453,13316745..13316987,
FT                   13317080..13317099))
FT                   /gene="Crygc"
FT                   /locus_tag="mCG_123125"
FT                   /product="crystallin, gamma C"
FT                   /note="gene_id=mCG123125.1 transcript_id=mCT124354.1
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(13315181..13315453,13316745..13316987,
FT                   13317080..13317088))
FT                   /codon_start=1
FT                   /gene="Crygc"
FT                   /locus_tag="mCG_123125"
FT                   /product="crystallin, gamma C"
FT                   /note="gene_id=mCG123125.1 transcript_id=mCT124354.1
FT                   protein_id=mCP74829.1"
FT                   /db_xref="GOA:A3RLD4"
FT                   /db_xref="InterPro:IPR001064"
FT                   /db_xref="InterPro:IPR011024"
FT                   /db_xref="MGI:MGI:88523"
FT                   /db_xref="UniProtKB/TrEMBL:A3RLD4"
FT                   /protein_id="EDL00217.1"
FT                   /translation="MGKITFFEDRSFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWML
FT                   YERPNYQGHQYFLRRGEYPDYQQWMGFSDSIRSCRLIPHAGSHRMRLYEKEDHKGVMME
FT                   LSEDCSCIQDRFHLSEVRSLQVLEGCWVLYEMPNYRGRQYLLRPQEYRRFQDWGSVDAK
FT                   AGSLRRVVDLY"
FT   gap             13318249..13318268
FT                   /estimated_length=20
FT   gene            complement(13323791..13325830)
FT                   /gene="Crygb"
FT                   /locus_tag="mCG_146941"
FT                   /note="gene_id=mCG146941.0"
FT   mRNA            complement(join(13323791..13324130,13325478..13325720,
FT                   13325810..13325830))
FT                   /gene="Crygb"
FT                   /locus_tag="mCG_146941"
FT                   /product="crystallin, gamma B"
FT                   /note="gene_id=mCG146941.0 transcript_id=mCT187204.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(13323855..13324130,13325478..13325720,
FT                   13325810..13325818))
FT                   /codon_start=1
FT                   /gene="Crygb"
FT                   /locus_tag="mCG_146941"
FT                   /product="crystallin, gamma B"
FT                   /note="gene_id=mCG146941.0 transcript_id=mCT187204.0
FT                   protein_id=mCP109540.0"
FT                   /protein_id="EDL00218.1"
FT                   /translation="MGKITFFEDRSFQGRCYECSSDCPNLQTYFSRCNSVRVDSGCWML
FT                   YERPNYQGHQYFLRRGEYPDYQQWMGFSDSIRSCRLIPQHSGTYRMRIYEKDDFRGQMS
FT                   EITDDCLSLQDRFHFSEIHSLNVMEGCWVLYEMPSYRGRQYLLRPGEYRRYLDWGAANA
FT                   KVGSFRRVMDFY"
FT   gap             13328402..13328605
FT                   /estimated_length=204
FT   gap             13330772..13330791
FT                   /estimated_length=20
FT   gene            complement(13344089..13346450)
FT                   /gene="Cryga"
FT                   /locus_tag="mCG_123129"
FT                   /note="gene_id=mCG123129.1"
FT   mRNA            complement(join(13344089..13344425,13346083..13346325,
FT                   13346431..13346450))
FT                   /gene="Cryga"
FT                   /locus_tag="mCG_123129"
FT                   /product="crystallin, gamma A"
FT                   /note="gene_id=mCG123129.1 transcript_id=mCT124358.1
FT                   created on 21-MAR-2003"
FT   CDS             complement(join(13344153..13344425,13346083..13346325,
FT                   13346431..13346439))
FT                   /codon_start=1
FT                   /gene="Cryga"
FT                   /locus_tag="mCG_123129"
FT                   /product="crystallin, gamma A"
FT                   /note="gene_id=mCG123129.1 transcript_id=mCT124358.1
FT                   protein_id=mCP74428.1"
FT                   /protein_id="EDL00219.1"
FT                   /translation="MGKITFYEDRGFQGRCYECSSDCPNLQTYFSRCNSIRVDSGCWML
FT                   YERPNYQGYQYFLRRGDYPDYQQWMGFSDSIRSCRSIPYTSSHRIRLYERDDYRGLVSE
FT                   LMDDCSCIHDRFRLHEIYSMHVLEGCWVLYEMPNYRGRQYLLRPGDYRRYHDWGAMDAK
FT                   VGSLRRVMDLY"
FT   gene            complement(13348452..13365132)
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /note="gene_id=mCG123135.1"
FT   mRNA            complement(join(13348452..13348797,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..>13360545))
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, transcript variant
FT                   mCT176049"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT176049.0
FT                   created on 21-APR-2003"
FT   CDS             complement(join(13348776..13348797,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..>13360544))
FT                   /codon_start=1
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, isoform CRA_b"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT176049.0
FT                   protein_id=mCP98971.0 isoform=CRA_b"
FT                   /protein_id="EDL00221.1"
FT                   /translation="RAPLHVRPAYPNRKEREAMILSSYAGVLMNSIPIEEVLKIYGANS
FT                   SASPDSTKVAQALLPRRSLHPFAMLTAPRAAECNRRQSVKLRRGATNKNTTSSSTKKAT
FT                   GQNGDPVGKGTHTPATKSLRNVD"
FT   mRNA            complement(join(13350360..13351845,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..13360545,
FT                   13363280..13363362,13365033..13365132))
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, transcript variant
FT                   mCT124364"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT124364.1
FT                   created on 21-APR-2003"
FT   mRNA            complement(join(13351563..13351845,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..13360545,
FT                   13365051..13365132))
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, transcript variant
FT                   mCT182081"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT182081.0
FT                   created on 21-APR-2003"
FT   CDS             complement(join(13351737..13351845,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..13360545,
FT                   13365051..13365058))
FT                   /codon_start=1
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, isoform CRA_c"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT182081.0
FT                   protein_id=mCP105003.0 isoform=CRA_c"
FT                   /protein_id="EDL00222.1"
FT                   /translation="MIWRAPLHVRPAYPNRKEREAMILSSYAGVLMNSIPIEEVLKIYG
FT                   ANSSASPDSTKVAQALLPRRSLHPFAMLTAPRAAECNRRQSVKLRRGATNKNTTSSSTK
FT                   KATGQNGDPVGKGTHTPATNISPTPVLSSAQPFHSSTVMWRNLESAQRQMGLEGK"
FT   CDS             complement(join(13351737..13351845,13352435..13352549,
FT                   13352851..13352938,13360017..13360088,13360458..13360545,
FT                   13363280..13363362,13365033..13365053))
FT                   /codon_start=1
FT                   /gene="D630023F18Rik"
FT                   /locus_tag="mCG_123135"
FT                   /product="RIKEN cDNA D630023F18, isoform CRA_a"
FT                   /note="gene_id=mCG123135.1 transcript_id=mCT124364.1
FT                   protein_id=mCP74674.1 isoform=CRA_a"
FT                   /protein_id="EDL00220.1"
FT                   /translation="MVNQVTLAHYDLAISVASQWLDCSENLTWLQWEKVRAPLHVRPAY
FT                   PNRKEREAMILSSYAGVLMNSIPIEEVLKIYGANSSASPDSTKVAQALLPRRSLHPFAM
FT                   LTAPRAAECNRRQSVKLRRGATNKNTTSSSTKKATGQNGDPVGKGTHTPATNISPTPVL
FT                   SSAQPFHSSTVMWRNLESAQRQMGLEGK"
FT   gap             13352187..13352258
FT                   /estimated_length=72
FT   gap             13357579..13357848
FT                   /estimated_length=270
FT   gap             13358786..13359710
FT                   /estimated_length=925
FT   gap             13362899..13362918
FT                   /estimated_length=20
FT   gap             13363991..13364010
FT                   /estimated_length=20
FT   gap             13366068..13366931
FT                   /estimated_length=864
FT   gap             13368026..13368045
FT                   /estimated_length=20
FT   gap             13370157..13370176
FT                   /estimated_length=20
FT   gap             13382800..13382819
FT                   /estimated_length=20
FT   gap             13385517..13386057
FT                   /estimated_length=541
FT   gap             13388184..13388203
FT                   /estimated_length=20
FT   gene            complement(13399596..13427421)
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /note="gene_id=mCG123128.1"
FT   mRNA            complement(join(13399596..13400530,13402025..13402187,
FT                   13402775..13402915,13406075..13406226,13407082..13407259,
FT                   13409483..13409588,13411942..13412233,13416214..13416351,
FT                   13427288..13427421))
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   transcript variant mCT171055"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT171055.0
FT                   created on 17-JUL-2002"
FT   mRNA            complement(join(13399596..13400530,13402025..13402187,
FT                   13402775..13402915,13406075..13406226,13407082..13407259,
FT                   13409483..13409588,13411942..13412233,13416214..13416351,
FT                   13419973..13420078))
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   transcript variant mCT124357"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT124357.1
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(13400440..13400530,13402025..13402187,
FT                   13402775..13402915,13406075..13406226,13407082..13407259,
FT                   13409483..13409588,13411942..13412233,13416214..13416335))
FT                   /codon_start=1
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT124357.1
FT                   protein_id=mCP74872.1 isoform=CRA_a"
FT                   /db_xref="GOA:O88844"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="MGI:MGI:96413"
FT                   /db_xref="PDB:2CMJ"
FT                   /db_xref="PDB:2CMV"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88844"
FT                   /protein_id="EDL00223.1"
FT                   /translation="MSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLG
FT                   IENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILG
FT                   GTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGTQ
FT                   KVTYMVHDFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGR
FT                   FKDIFQEIYDKKYKSQFEAQKICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSV
FT                   AQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGL
FT                   AHRAKLDNNTELSFFAKALEDVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMD
FT                   KLGENLKAKLAQAKL"
FT   CDS             complement(join(13400440..13400530,13402025..13402187,
FT                   13402775..13402915,13406075..13406226,13407082..13407259,
FT                   13409483..13409588,13411942..13412233,13416214..13416335))
FT                   /codon_start=1
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT171055.0
FT                   protein_id=mCP93972.0 isoform=CRA_a"
FT                   /db_xref="GOA:O88844"
FT                   /db_xref="InterPro:IPR004790"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="MGI:MGI:96413"
FT                   /db_xref="PDB:2CMJ"
FT                   /db_xref="PDB:2CMV"
FT                   /db_xref="UniProtKB/Swiss-Prot:O88844"
FT                   /protein_id="EDL00225.1"
FT                   /translation="MSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLG
FT                   IENRDATNDQVTKDAAEAIKKYNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILG
FT                   GTVFREAIICKNIPRLVTGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPKDGTQ
FT                   KVTYMVHDFEEGGGVAMGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGR
FT                   FKDIFQEIYDKKYKSQFEAQKICYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSV
FT                   AQGYGSLGMMTSVLICPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWSRGL
FT                   AHRAKLDNNTELSFFAKALEDVCIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMD
FT                   KLGENLKAKLAQAKL"
FT   mRNA            complement(join(<13407190..13407227,13412152..13412233,
FT                   13416214..13416351,13422611..13422681,13427192..>13427355))
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   transcript variant mCT171054"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT171054.0
FT                   created on 17-JUL-2002"
FT   CDS             complement(join(<13407190..13407227,13412152..13412233,
FT                   13416214..13416351,13422611..13422681,13427192..>13427275))
FT                   /codon_start=1
FT                   /gene="Idh1"
FT                   /locus_tag="mCG_123128"
FT                   /product="isocitrate dehydrogenase 1 (NADP+), soluble,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG123128.1 transcript_id=mCT171054.0
FT                   protein_id=mCP93973.0 isoform=CRA_b"
FT                   /protein_id="EDL00224.1"
FT                   /translation="LSGSFQDSANTNYVSLNKSLVSLGLTPLKSVCHSKTKCNRYLCCS
FT                   PAGNRNWVIEVKMSRKIQGGSVVEMQGDEMTRIIWELIKEKLILPYVELDLHSYDLGIE
FT                   NRDATNDQVTKDAAEAIKKYNQDKSIEDFAHSS"
FT   gap             13409267..13409286
FT                   /estimated_length=20
FT   gap             13427495..13427601
FT                   /estimated_length=107
FT   gene            <13427732..13515066
FT                   /gene="Pip5k3"
FT                   /locus_tag="mCG_123127"
FT                   /note="gene_id=mCG123127.1"
FT   mRNA            join(<13427732..13427864,13431347..13431527,
FT                   13433173..13433322,13433562..13433594,13436684..13436802,
FT                   13437640..13437811,13443749..13443956,13446622..13446711,
FT                   13456905..13457043,13460725..13460882,13463241..13463352,
FT                   13464476..13464623,13471763..13471822,13474699..13474828,
FT                   13475223..13475403,13475979..13476053,13479408..13479515,
FT                   13485370..13485510,13486684..13486810,13487036..13488192,
FT                   13491230..13491330,13492649..13492720,13493456..13493627,
FT                   13494396..13494574,13496086..13496199,13496567..13496675,
FT                   13496984..13497138,13497593..13497683,13498956..13499016,
FT                   13499830..13499967,13501046..13501166,13503824..13503919,
FT                   13505291..13505374,13506193..13506290,13506706..13506870,
FT                   13508769..13508828,13509638..13509814,13510813..13510916,
FT                   13512202..13512330,13513381..13513642,13513967..13514041,
FT                   13514577..13515066)
FT                   /gene="Pip5k3"
FT                   /locus_tag="mCG_123127"
FT                   /product="phosphatidylinositol-3-phosphate/phosphatidylinositol
FT                   5-kinase, type III"
FT                   /note="gene_id=mCG123127.1 transcript_id=mCT124356.1
FT                   created on 17-JUL-2002"
FT   CDS             join(<13427814..13427864,13431347..13431527,
FT                   13433173..13433322,13433562..13433594,13436684..13436802,
FT                   13437640..13437811,13443749..13443956,13446622..13446711,
FT                   13456905..13457043,13460725..13460882,13463241..13463352,
FT                   13464476..13464623,13471763..13471822,13474699..13474828,
FT                   13475223..13475403,13475979..13476053,13479408..13479515,
FT                   13485370..13485510,13486684..13486810,13487036..13488192,
FT                   13491230..13491330,13492649..13492720,13493456..13493627,
FT                   13494396..13494574,13496086..13496199,13496567..13496675,
FT                   13496984..13497138,13497593..13497683,13498956..13499016,
FT                   13499830..13499967,13501046..13501166,13503824..13503919,
FT                   13505291..13505374,13506193..13506290,13506706..13506870,
FT                   13508769..13508828,13509638..13509814,13510813..13510916,
FT                   13512202..13512330,13513381..13513642,13513967..13514041,
FT                   13514577..13514692)
FT                   /codon_start=1
FT                   /gene="Pip5k3"
FT                   /locus_tag="mCG_123127"
FT                   /product="phosphatidylinositol-3-phosphate/phosphatidylinositol
FT                   5-kinase, type III"
FT                   /note="gene_id=mCG123127.1 transcript_id=mCT124356.1
FT                   protein_id=mCP74837.0"
FT                   /protein_id="EDL00226.1"
FT                   /translation="GGGRGGGRPAGPGREAKTHEMATDDKSSPTLDSANDLPRSPASPS
FT                   HLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERGEGGQGEQQSPSSSWASPQIPSRTQ
FT                   SVRSPVPYKKQLNEELHRRSSVLENTLPHPQESTDSRRKAEPACGGHDPRTAVQLRSLS
FT                   TVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHCRLCGQIFCSRC
FT                   CNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSTCSVSILDPSE
FT                   PRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNSALSTRLVSVQEDAGKSPARNRSASIT
FT                   NLSLDRSGSPMVPSYETSVSPQANRNYIRTETTEDERKILLDSAQLKDLWKKICHHTSG
FT                   MEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLDCVSHHDQ
FT                   LFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDD
FT                   NLAKYLVSDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENEE
FT                   KQAMERLLSANHNHMMALLQQLLQNESLSSSWRDIIVSLVCQVVQTVRPDVKHQDDDMD
FT                   IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMNSCIKNPKILLLKCSIEYLYREET
FT                   KFTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQ
FT                   VLERISRMTQGDLVVSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGC
FT                   TIKLRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQSPSFHLLTEGR
FT                   GEEGASQEQVSGSSLPQDPECPREALSSEDSTLLESRTVLEKGELDNKSIPQAVASLKH
FT                   QDYTTPTCPAGIPCALFALVPESLLPLHMDQQDAVGNEQPETSQQTDEQQDPKSQMKAF
FT                   RDPLQDDTGMYVTEEVTSSEDQRKTYALTFKQELKDVILCISPVITFREPFLLTEKGMR
FT                   CSTRDYFPEQIYWSPLLNKEVKEMESRRKKQLLRDLSGLQGMNGSVQAKSIQVLPSHEL
FT                   VSTRIAEHLGDSQTLGRMLADYRARGGRIQSKHLDPFVHSKDASCTSGGKSGNKTESDE
FT                   ERGLIPSDVIWPTKVDCLNPANHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKND
FT                   LTLGIFLERYCFRSSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTI
FT                   LTYSWCRICKQVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQ
FT                   YFSYNQMVASFSYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYLAVD
FT                   ERLASLKTDTFSKTREEKMEDIFAQKEMEEGEFKNWTEKMQARLMSSSVDTPQQLQSIF
FT                   ESLIAKKQSLCEVLQAWNSRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKINAMDTSPR
FT                   NISPGLHNGEKEDRFLTTLSSQSSTSSTHLQLPTPPEALAEQVVGGPTDLDSASGSEDV
FT                   FDGHLLGSTDSQVKEKSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCE
FT                   KEPSSIIAFALSCKEYRNALEELSKATLRNSAEEGLPANSALDNRPKSSSPIRLPEISG
FT                   GQTNRTVEAEPQPTKKASGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQAGKEG
FT                   LESQGLEPQDEVDGGDTQKKQLTNPHVELQFSDANAKFYCRLYYAGEFHKMREVILGSS
FT                   EEEFIRSLSHSSPWQARGGKSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITN
FT                   AVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNR
FT                   NVKTDTGKESCDVVLLDENLLKMVRDNPLYIRSHSKSVLRTSIHSDAHFLSSHLIIDYS
FT                   LLVGRDDTSNELVVGIIDYIRTFTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFC
FT                   EAMDKYFLMVPDHWTGLDLNC"
FT   gap             13455008..13455045
FT                   /estimated_length=38
FT   gap             13488506..13488729
FT                   /estimated_length=224
FT   gap             13501600..13501619
FT                   /estimated_length=20
FT   gene            13522971..13630932
FT                   /gene="Pthr2"
FT                   /locus_tag="mCG_123134"
FT                   /note="gene_id=mCG123134.1"
FT   mRNA            join(13522971..13523140,13562961..13563063,
FT                   13577740..13577850,13577966..13578081,13584473..13584570,
FT                   13586438..13586567,13587944..13588097,13592666..13592726,
FT                   13604599..13604662,13613627..13613721,13625201..13625339,
FT                   13627617..13627658,13629734..13630932)
FT                   /gene="Pthr2"
FT                   /locus_tag="mCG_123134"
FT                   /product="parathyroid hormone receptor 2, transcript
FT                   variant mCT176048"
FT                   /note="gene_id=mCG123134.1 transcript_id=mCT176048.0
FT                   created on 19-NOV-2002"
FT   CDS             join(13523081..13523140,13562961..13563063,
FT                   13577740..13577850,13577966..13578081,13584473..13584570,
FT                   13586438..13586567,13587944..13588097,13592666..13592726,
FT                   13604599..13604662,13613627..13613721,13625201..13625339,
FT                   13627617..13627658,13629734..13630126)
FT                   /codon_start=1
FT                   /gene="Pthr2"
FT                   /locus_tag="mCG_123134"
FT                   /product="parathyroid hormone receptor 2, isoform CRA_c"
FT                   /note="gene_id=mCG123134.1 transcript_id=mCT176048.0
FT                   protein_id=mCP98969.0 isoform=CRA_c"
FT                   /protein_id="EDL00229.1"
FT                   /translation="MKLFTRGSPLSLNLYLWNCELDSDGTITIEEQIVLVMKAKMQCEL
FT                   NITAQLQEGEGNCFPEWDGIICWPRGTVGKMSAVPCPPYVYDFNHKGVAFRHCTPNGTW
FT                   DSIHGSNKTWANYSDCFLQPDINIGKQEFFESLYILYTVGYSISFGSLAVAILIIGYFR
FT                   RLHCTRNYIHLHLFVSFMLRAMSIFVKDRVAQAHLGVEALQSLVGCKIAVVMFIYFLAT
FT                   NYYWILVEGLYLHNLIFVSFFSDTKYLWGFISIGWGFPAVFVVAWAVARATLADTRCWE
FT                   LSAGDRWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHDMRKQYRKLAKSTLVL
FT                   VLVFGVHYIVFVCQPHSFSGLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQAEVKKM
FT                   WTRWNLSIDWKRAPPCGGQRYGSVLTTVTHSTSSQSQMGASTRLVLISGKPTKNACRQI
FT                   DSHVTLPGYVWSSSEQDCQTHSPPEETKEGHRRQGDDSPVMESSRPVAFTLDTEGCKGE
FT                   THPI"
FT   gap             13546008..13546641
FT                   /estimated_length=634
FT   mRNA            join(13552251..13552662,13562961..13563063,
FT                   13577740..13577850,13577966..13578081,13584473..13584570,
FT                   13586438..13586627,13587944..13588097,13592666..13592726,
FT                   13604599..13604662,13613627..13613721,13625201..13625339,
FT                   13627617..13627658,13629734..13630932)
FT                   /gene="Pthr2"
FT                   /locus_tag="mCG_123134"
FT                   /product="parathyroid hormone receptor 2, transcript
FT                   variant mCT124363"
FT                   /note="gene_id=mCG123134.1 transcript_id=mCT124363.1
FT                   created on 19-NOV-2002"
FT   mRNA            join(13552252..13552662,13562961..13563063,
FT                   13577740..13577850,13577966..13578081,13584473..13584570,
FT                   13586438..13586567,13587944..13588097,13592666..13592726,
FT                   13604599..13604662,13613627..13613721,13625201..13625339,
FT                   13627617..13627658,13629734..13630932)
FT                   /gene="Pthr2"
FT                   /locus_tag="mCG_123134"
FT                   /product="parathyroid hormone receptor 2, transcript
FT                   variant mCT176047"
FT                   /note="gene_id=mCG123134.1 transcript_id=mCT176047.0
FT                   created on 19-NOV-2002"
FT   CDS             join(13552588..13552662,13562961..13563063,
FT                   13577740..13577850,13577966..13578081,13584473..13584570,
FT                   13586438..13586627,13587944..13588097,13592666..13592726,
FT                   13604599..13604662,13613627..13613721,13625201..13625339,
FT                   13627617..13627658,13629734..13630126)
FT                   /codon_start=1
FT                   /gene="Pthr2"
FT                   /locus_tag="mCG_123134"
FT                   /product="parathyroid hormone receptor 2, isoform CRA_a"
FT                   /note="gene_id=mCG123134.1 transcript_id=mCT124363.1
FT                   protein_id=mCP74667.1 isoform=CRA_a"
FT                   /protein_id="EDL00227.1"
FT                   /translation="MAWLETFTYICGWLILSSCLLVRAQLDSDGTITIEEQIVLVMKAK
FT                   MQCELNITAQLQEGEGNCFPEWDGIICWPRGTVGKMSAVPCPPYVYDFNHKGVAFRHCT
FT                   PNGTWDSIHGSNKTWANYSDCFLQPDINIGKQEFFESLYILYTVGYSISFGSLAVAILI
FT                   IGYFRRLHCTRNYIHLHLFVSFMLRAMSIFVKDRVAQAHLGVEALQSLVMQGDLQNFIG
FT                   GPSVDKSQYVGCKIAVVMFIYFLATNYYWILVEGLYLHNLIFVSFFSDTKYLWGFISIG
FT                   WGFPAVFVVAWAVARATLADTRCWELSAGDRWIYQAPILAAIGLNFILFLNTVRVLATK
FT                   IWETNAVGHDMRKQYRKLAKSTLVLVLVFGVHYIVFVCQPHSFSGLWWEIRMHCELFFN
FT                   SFQGFFVSIVYCYCNGEVQAEVKKMWTRWNLSIDWKRAPPCGGQRYGSVLTTVTHSTSS
FT                   QSQMGASTRLVLISGKPTKNACRQIDSHVTLPGYVWSSSEQDCQTHSPPEETKEGHRRQ
FT                   GDDSPVMESSRPVAFTLDTEGCKGETHPI"
FT   CDS             join(13552588..13552662,13562961..13563063,
FT                   13577740..13577850,13577966..13578081,13584473..13584570,
FT                   13586438..13586567,13587944..13588097,13592666..13592726,
FT                   13604599..13604662,13613627..13613721,13625201..13625339,
FT                   13627617..13627658,13629734..13630126)
FT                   /codon_start=1
FT                   /gene="Pthr2"
FT                   /locus_tag="mCG_123134"
FT                   /product="parathyroid hormone receptor 2, isoform CRA_b"
FT                   /note="gene_id=mCG123134.1 transcript_id=mCT176047.0
FT                   protein_id=mCP98970.0 isoform=CRA_b"
FT                   /protein_id="EDL00228.1"
FT                   /translation="MAWLETFTYICGWLILSSCLLVRAQLDSDGTITIEEQIVLVMKAK
FT                   MQCELNITAQLQEGEGNCFPEWDGIICWPRGTVGKMSAVPCPPYVYDFNHKGVAFRHCT
FT                   PNGTWDSIHGSNKTWANYSDCFLQPDINIGKQEFFESLYILYTVGYSISFGSLAVAILI
FT                   IGYFRRLHCTRNYIHLHLFVSFMLRAMSIFVKDRVAQAHLGVEALQSLVGCKIAVVMFI
FT                   YFLATNYYWILVEGLYLHNLIFVSFFSDTKYLWGFISIGWGFPAVFVVAWAVARATLAD
FT                   TRCWELSAGDRWIYQAPILAAIGLNFILFLNTVRVLATKIWETNAVGHDMRKQYRKLAK
FT                   STLVLVLVFGVHYIVFVCQPHSFSGLWWEIRMHCELFFNSFQGFFVSIVYCYCNGEVQA
FT                   EVKKMWTRWNLSIDWKRAPPCGGQRYGSVLTTVTHSTSSQSQMGASTRLVLISGKPTKN
FT                   ACRQIDSHVTLPGYVWSSSEQDCQTHSPPEETKEGHRRQGDDSPVMESSRPVAFTLDTE
FT                   GCKGETHPI"
FT   gap             13585870..13586248
FT                   /estimated_length=379
FT   gap             13593862..13594129
FT                   /estimated_length=268
FT   gap             13645325..13645344
FT                   /estimated_length=20
FT   gap             13654509..13655572
FT                   /estimated_length=1064
FT   gap             13657582..13658332
FT                   /estimated_length=751
FT   gap             13664728..13666118
FT                   /estimated_length=1391
FT   gap             13733239..13733258
FT                   /estimated_length=20
FT   gap             13734774..13734937
FT                   /estimated_length=164
FT   gap             13736862..13737365
FT                   /estimated_length=504
FT   gap             13738224..13741588
FT                   /estimated_length=3365
FT   gap             13744680..13744699
FT                   /estimated_length=20
FT   gap             13753825..13754437
FT                   /estimated_length=613
FT   gap             13759792..13759833
FT                   /estimated_length=42
FT   gap             13768500..13769173
FT                   /estimated_length=674
FT   gene            complement(13789153..13789861)
FT                   /pseudo
FT                   /locus_tag="mCG_1035595"
FT                   /note="gene_id=mCG1035595.1"
FT   mRNA            complement(13789153..13789861)
FT                   /pseudo
FT                   /locus_tag="mCG_1035595"
FT                   /note="gene_id=mCG1035595.1 transcript_id=mCT153299.1
FT                   created on 19-MAR-2003"
FT   gap             13802828..13802847
FT                   /estimated_length=20
FT   gap             13830029..13830048
FT                   /estimated_length=20
FT   gap             13831435..13831454
FT                   /estimated_length=20
FT   gap             13834714..13837990
FT                   /estimated_length=3277
FT   gap             13839018..13839037
FT                   /estimated_length=20
FT   gap             13849321..13849632
FT                   /estimated_length=312
FT   gap             13854347..13855009
FT                   /estimated_length=663
FT   gap             13859831..13859876
FT                   /estimated_length=46
FT   gap             13865639..13865658
FT                   /estimated_length=20
FT   gap             13925110..13925129
FT                   /estimated_length=20
FT   gap             13926419..13933428
FT                   /estimated_length=7010
FT   gap             13934675..13934694
FT                   /estimated_length=20
FT   gap             13942661..13942680
FT                   /estimated_length=20
FT   gap             13943914..13944107
FT                   /estimated_length=194
FT   gap             13945244..13945349
FT                   /estimated_length=106
FT   gap             13953842..13953861
FT                   /estimated_length=20
FT   gap             13955056..13955075
FT                   /estimated_length=20
FT   gap             13956617..13956949
FT                   /estimated_length=333
FT   gap             13963947..13966884
FT                   /estimated_length=2938
FT   gap             13975452..13975471
FT                   /estimated_length=20
FT   gap             13993140..13993159
FT                   /estimated_length=20
FT   gap             14004774..14009148
FT                   /estimated_length=4375
FT   gap             14013879..14015707
FT                   /estimated_length=1829
FT   gap             14038141..14038160
FT                   /estimated_length=20
FT   gap             14043012..14043031
FT                   /estimated_length=20
FT   gap             14050433..14051639
FT                   /estimated_length=1207
FT   gap             14087827..14087846
FT                   /estimated_length=20
FT   gap             14110777..14110796
FT                   /estimated_length=20
FT   gap             14113203..14113745
FT                   /estimated_length=543
FT   gap             14114918..14114937
FT                   /estimated_length=20
FT   gap             14116120..14116139
FT                   /estimated_length=20
FT   gap             14126894..14128054
FT                   /estimated_length=1161
FT   gap             14129472..14129491
FT                   /estimated_length=20
FT   gap             14132430..14137680
FT                   /estimated_length=5251
FT   gap             14140447..14140466
FT                   /estimated_length=20
FT   gap             14142125..14142144
FT                   /estimated_length=20
FT   gap             14143213..14143232
FT                   /estimated_length=20
FT   gap             14144363..14144382
FT                   /estimated_length=20
FT   gap             14150530..14150549
FT                   /estimated_length=20
FT   gap             14170555..14170574
FT                   /estimated_length=20
FT   gap             14171678..14171697
FT                   /estimated_length=20
FT   gap             14173914..14173933
FT                   /estimated_length=20
FT   gap             14175459..14175478
FT                   /estimated_length=20
FT   gap             14176544..14176563
FT                   /estimated_length=20
FT   gap             14188535..14189222
FT                   /estimated_length=688
FT   gap             14194960..14194979
FT                   /estimated_length=20
FT   gap             14208449..14208468
FT                   /estimated_length=20
FT   gap             14211861..14211880
FT                   /estimated_length=20
FT   gene            14214759..14216526
FT                   /locus_tag="mCG_121681"
FT                   /note="gene_id=mCG121681.1"
FT   mRNA            join(14214759..14214787,14214869..14215111,
FT                   14216191..14216526)
FT                   /locus_tag="mCG_121681"
FT                   /product="mCG121681"
FT                   /note="gene_id=mCG121681.1 transcript_id=mCT122892.1
FT                   created on 17-JUL-2002"
FT   CDS             join(14214779..14214787,14214869..14215111,
FT                   14216191..14216463)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121681"
FT                   /product="mCG121681"
FT                   /note="gene_id=mCG121681.1 transcript_id=mCT122892.1
FT                   protein_id=mCP74763.1"
FT                   /protein_id="EDL00230.1"
FT                   /translation="MGKITFYEDRSFQGRHYECSTDHSNLQPYFSRCNSVRVDSGCWML
FT                   YEQPNFAGCQYFLRRGDYPDYQQWMGFSDSVRSCRLIPHSTSHRIRIYEREDYRGQMVE
FT                   ITDDCSHLQDRFHFSDFHSFHVMEGYWVLYEMPNYRGRQYLLRPGEYRRYHDWGAMNAR
FT                   VSSLRRIMDFY"
FT   gap             14218118..14218137
FT                   /estimated_length=20
FT   gap             14237530..14237752
FT                   /estimated_length=223
FT   gap             14252530..14252549
FT                   /estimated_length=20
FT   gap             14267142..14267161
FT                   /estimated_length=20
FT   gap             14276872..14276891
FT                   /estimated_length=20
FT   gap             14287212..14287415
FT                   /estimated_length=204
FT   gap             14295585..14296139
FT                   /estimated_length=555
FT   gap             14324955..14324974
FT                   /estimated_length=20
FT   gap             14331203..14331222
FT                   /estimated_length=20
FT   gap             14333540..14333559
FT                   /estimated_length=20
FT   gap             14334926..14334945
FT                   /estimated_length=20
FT   gap             14337095..14343858
FT                   /estimated_length=6764
FT   gap             14349246..14349462
FT                   /estimated_length=217
FT   gap             14370704..14370834
FT                   /estimated_length=131
FT   gap             14380270..14381000
FT                   /estimated_length=731
FT   gap             14446877..14447210
FT                   /estimated_length=334
FT   gap             14455620..14455639
FT                   /estimated_length=20
FT   gap             14458306..14458342
FT                   /estimated_length=37
FT   gap             14479187..14479451
FT                   /estimated_length=265
FT   gap             14532721..14532740
FT                   /estimated_length=20
FT   gap             14534198..14534217
FT                   /estimated_length=20
FT   gene            complement(14538779..14539242)
FT                   /locus_tag="mCG_1035690"
FT                   /note="gene_id=mCG1035690.1"
FT   mRNA            complement(join(14538779..14539151,14539176..14539242))
FT                   /locus_tag="mCG_1035690"
FT                   /product="mCG1035690"
FT                   /note="gene_id=mCG1035690.1 transcript_id=mCT153394.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(14538865..14539041)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035690"
FT                   /product="mCG1035690"
FT                   /note="gene_id=mCG1035690.1 transcript_id=mCT153394.0
FT                   protein_id=mCP74863.1"
FT                   /protein_id="EDL00231.1"
FT                   /translation="MGSFSAHIDTQEQFSKCLCKVEGKGKKQKLSSNLLVMSASHLIAF
FT                   SRQPQTSLKDVTQ"
FT   gap             14557341..14557360
FT                   /estimated_length=20
FT   gap             14561964..14561983
FT                   /estimated_length=20
FT   gene            14594540..14712235
FT                   /locus_tag="mCG_121680"
FT                   /note="gene_id=mCG121680.1"
FT   mRNA            join(14594540..14594681,14594943..14595007,
FT                   14634546..14634623,14652829..14653113,14671662..14671775,
FT                   14673723..14673800,14684816..14688556,14688753..14688959,
FT                   14689142..14689276,14692535..14692596,14694046..14694190,
FT                   14697598..14697929,14705901..14705982,14710540..14710652,
FT                   14711078..14712235)
FT                   /locus_tag="mCG_121680"
FT                   /product="mCG121680"
FT                   /note="gene_id=mCG121680.1 transcript_id=mCT122891.1
FT                   created on 17-JUL-2002"
FT   gap             14603714..14603733
FT                   /estimated_length=20
FT   gap             14612487..14612506
FT                   /estimated_length=20
FT   CDS             join(14652852..14653113,14671662..14671775,
FT                   14673723..14673800,14684816..14688556,14688753..14688959,
FT                   14689142..14689276,14692535..14692596,14694046..14694190,
FT                   14697598..14697929,14705901..14705982,14710540..14710652,
FT                   14711078..14711293)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121680"
FT                   /product="mCG121680"
FT                   /note="gene_id=mCG121680.1 transcript_id=mCT122891.1
FT                   protein_id=mCP74742.1"
FT                   /protein_id="EDL00232.1"
FT                   /translation="MADERKDEGKAPHWTSASLTEAAAHPHSPEMKDQGGAGEGLSRNA
FT                   NGFPYREEEEGAFGEHRSQGTYSDTKENGINGELTSADRETAEEVSARIVQVVTAEAVA
FT                   VLKGEQEKEAQYKDQPAALPLAAEETANLPPSPPPSPASEQTATVEEDLLTASKMEFPE
FT                   QEKFPSSFAEPLDKGEMEFKMPSKPGEDFEHAALVPDTSKTPQDKKDLQGMEGEKLPPV
FT                   PFAQTFGTNLEDRKQSTEPSIVMPSIGLSAEPPAPKEPKDWFIEMPTESKKDEWGLAAP
FT                   ISPGPLTPMREKDVLEDIPRWEGKQFDSPMPSPFHGGSFTLPLDTMKNERVSEGPRPFA
FT                   PVFFQSDDKVSLQDPSALATSKESSKDEEPLKDKADKVADVSISEVTTLLGNVHSPVVE
FT                   GYVGENISGEVKVTTDQEKKETSAPSVQEPTLTETEPQTKLDEKSTVSIEEAVAKEEES
FT                   LKLRDDKTGVIQTSTEQSFSKEDQKGQEHTIDELKQDSFPISLEQAVTDAAMTSKTLGK
FT                   VTSEPEAVSERREIQGLFEEKTADKNKLEGAGSATIAEVEMPFYEDKSGMSKYFETSAL
FT                   KEDMTRSTELGSDYYELSDSRGSAQESLDTISPKNQHDEKELQAKASQPSPPAQEAGYS
FT                   TLAQSYTPDHPSELPEEPSSPQERMFTIDPKVYGEKRDLHSKNKDDLTLSRSLGLGGRS
FT                   AIEQRSMSINLPMSCLDSIALGFNFGRGHDLSPLASDILTNTSGSMDEGDDYLPPTTPA
FT                   VEKMPCFPIESKEEEDKAEQAKVTGGQTIQVETSSESPFPAKEYYKNGTVMAPDLPEML
FT                   DLAGTRSRLASVSADAEVARRKSVPSEAMLAESSTSLPPVADESPVTVKPDSQLEDMGY
FT                   CVFNKYTVPLPSPVQDSENLSGESGSFYEGTDDKVRRDLATDLSLIEVKLAAAGRVKDE
FT                   FTAEKEASPPTSADKSGLSREFDHDRKANDKLDTVLEKSEEHIDSKEHAKESEEMGGKV
FT                   ELFGLGITYDQASTKELITTKDTSPEKTEKGLSSVPEVAEVEPTTKADQGLDFAATKAE
FT                   PSQLDIKVSDFGQMASGMNVDAGKAIELKFEVAQELTLSSEAPQEADSFMGVESGHIKE
FT                   GGKVNETEVKEKVTKPDLVHQEAVDKEESYESSGEHESLTMESLKPDEGKKETSPETSL
FT                   IQDEVALKLSVEIPCPPPVSEADLSTDEKGEVQMEFIQLPKEESTETPDIPAIPSDVTQ
FT                   PQPEAIVSEPAEVPSEEEEIEAGGEYDKLLFRSDTLQISDLLVSESREEFVETCPGELK
FT                   GVVESVVTIEDDFITVVQTTTDEGESGSHSVRFAAPAQPEEERRPRPHDEELEIEMAAE
FT                   AQAEPKDGSPDAPATPEKEEVAFSEYKTETYDDYKDETTIDDSIMDADSLWVDTQDDDR
FT                   SILTEQLETIPKEERAEKDARRPSLEKHRKEKPFKTGRGRISTPERKVAKKEPSTVSRD
FT                   EVRRKKAVYKKAELAKKSEVQAHSPSRKLILKPAIKYTRPTHLSCVKRKTTAASGDLAQ
FT                   APGAFKQAKDKVTDGISKSPEKRSSLPRPSSILPPRRGVSGDREENSFSLNSSISSARR
FT                   TTRSEPIRRAGKSGTSTPTTPGSTAITPGTPPSYSSRTPGTPGTPSYPRTPGTPKSGIL
FT                   VPSEKKVAIIRTPPKSPATPKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVT
FT                   KKIDLSHVTSKCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNV
FT                   KIDSQKLNFREHAKARVDHGAEIITQSPSRSSVASPRRLSNVSSSGSINLLESPQLATL
FT                   AEDVTAALAKQGL"
FT   gene            14740598..>14782171
FT                   /gene="C030018G13Rik"
FT                   /locus_tag="mCG_121683"
FT                   /note="gene_id=mCG121683.1"
FT   mRNA            join(14740598..14740790,14741716..14741764,
FT                   14744230..14744386,14745556..14745857,14755562..14755685,
FT                   14758093..14758169,14763382..14763521,14776138..14776399,
FT                   14777524..14777658,14779231..14779447,14779929..14780069,
FT                   14781870..>14782171)
FT                   /gene="C030018G13Rik"
FT                   /locus_tag="mCG_121683"
FT                   /product="RIKEN cDNA C030018G13"
FT                   /note="gene_id=mCG121683.1 transcript_id=mCT122894.1
FT                   created on 19-NOV-2002"
FT   CDS             join(14740699..14740790,14741716..14741764,
FT                   14744230..14744386,14745556..14745857,14755562..14755685,
FT                   14758093..14758169,14763382..14763521,14776138..14776399,
FT                   14777524..14777658,14779231..14779447,14779929..14780069,
FT                   14781870..14782171)
FT                   /codon_start=1
FT                   /gene="C030018G13Rik"
FT                   /locus_tag="mCG_121683"
FT                   /product="RIKEN cDNA C030018G13"
FT                   /note="gene_id=mCG121683.1 transcript_id=mCT122894.1
FT                   protein_id=mCP74775.1"
FT                   /protein_id="EDL00233.1"
FT                   /translation="MVKRKSSEGQEQDGGRGIPLPIQTFLWRQTSAFLRPKLGKQYEAS
FT                   CVSFERVLVENKLHGLSPALSEAIQSISRWELVQAALPHVLHCTATLLSNRNKLGHQDK
FT                   LGVAETKLLHTLHWMLLEAPQDCNNDQFGGTDRGSSWGGSSSAFIHQIENQGSPGQPCR
FT                   SSSHDEEENNRRKTFQNSMATVELFVFLFAPLVHRIKESDLTFRLASGLVIWQPMWEHR
FT                   QPEVSGFTALVKPIRNIITAKRSSPINSQSQTCESPNQDTRQQGEGLQVVSEALQSDSI
FT                   SPKATISGCHQGNSFDGSLSSQTSQERGPSHSRASLVIPPCQRSRYATYFDVAVLRCLL
FT                   QPHWSEEGTQWSLMYYLQRLRHMLEEKPEKTPDPDIPLLPRPRSSSMVAAAPSLVNTHK
FT                   TQDLTMKCNEEEKSLSPEAFSKVSLTNLRRSAVPDLSSDLGMNIFKKFKSRKEDRERKG
FT                   SIPFHHTGKRRPRRMGVPFLLHEDHLDVSPTRSTFSFGSFSGLGEDRRGIEKGGWQTTI
FT                   LGKLTRRGSSDAATEMESLSARHSHSHHTLVSDLPDHSNSHGENTVKEVRSQISTITVA
FT                   TFNTTLASFNVGYADFFSEHMRKLCSQVPIPEMPHEPLACANLPRSLTDSCINYSYLED
FT                   TEHIDGTNNFVHKNGMLDLSVRGSTFPNED"
FT   gap             14762109..14762244
FT                   /estimated_length=136
FT   gap             14783459..14783478
FT                   /estimated_length=20
FT   gap             14793908..14794158
FT                   /estimated_length=251
FT   gap             14800205..14801384
FT                   /estimated_length=1180
FT   gap             14808124..14808143
FT                   /estimated_length=20
FT   gap             14811815..14811834
FT                   /estimated_length=20
FT   gap             14837541..14839952
FT                   /estimated_length=2412
FT   gap             14848092..14848359
FT                   /estimated_length=268
FT   gene            14851621..14961368
FT                   /locus_tag="mCG_121565"
FT                   /note="gene_id=mCG121565.1"
FT   mRNA            join(14851621..14851749,14858216..14858381,
FT                   14863277..14863480,14865217..14865317,14869147..14869347,
FT                   14875175..14875282,14882782..14882920,14885820..14886001,
FT                   14886574..14886705,14889792..14889978,14896292..14896438,
FT                   14900922..14901022,14901994..14902080,14902980..14903163,
FT                   14904312..14904406,14905634..14905723,14906689..14906790,
FT                   14909292..14909472,14911369..14911637,14913383..14913517,
FT                   14913903..14914041,14914673..14914769,14916457..14916627,
FT                   14919023..14919058,14919397..14919615,14934138..14934338,
FT                   14936729..14936756,14937800..14937836,14939907..14940113,
FT                   14942330..14942514,14943079..14943244,14944581..14944760,
FT                   14947731..14947869,14950206..14950262,14957092..14957173,
FT                   14958276..14958387,14958949..14959148,14959915..14961368)
FT                   /locus_tag="mCG_121565"
FT                   /product="mCG121565"
FT                   /note="gene_id=mCG121565.1 transcript_id=mCT122771.1
FT                   created on 19-NOV-2002"
FT   CDS             join(14851660..14851749,14858216..14858381,
FT                   14863277..14863480,14865217..14865317,14869147..14869347,
FT                   14875175..14875282,14882782..14882920,14885820..14886001,
FT                   14886574..14886705,14889792..14889978,14896292..14896438,
FT                   14900922..14901022,14901994..14902080,14902980..14903163,
FT                   14904312..14904406,14905634..14905723,14906689..14906790,
FT                   14909292..14909472,14911369..14911637,14913383..14913517,
FT                   14913903..14914041,14914673..14914769,14916457..14916627,
FT                   14919023..14919058,14919397..14919615,14934138..14934338,
FT                   14936729..14936756,14937800..14937836,14939907..14940113,
FT                   14942330..14942514,14943079..14943244,14944581..14944760,
FT                   14947731..14947869,14950206..14950262,14957092..14957173,
FT                   14958276..14958387,14958949..14959148,14959915..14960181)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121565"
FT                   /product="mCG121565"
FT                   /note="gene_id=mCG121565.1 transcript_id=mCT122771.1
FT                   protein_id=mCP74566.1"
FT                   /protein_id="EDL00234.1"
FT                   /translation="MAACQLLLEITTFLRETFSCLPRPRTEPLVDLESCRLRLDPELDR
FT                   HRYERKISFAGVLDENEDSKDSLHSSSHTIKSDAGAEEKKVPSRKIRIGGSRLLQIKGT
FT                   RSFQVKKGGSLSSIRRVGSLKSSKLSRQDSESEAEELQLSQSRDTVTDLEGSPWSASEP
FT                   SIEPEGLSNAGTEENYHRNMSWLHVMILLCNQQSFICTHVDYCHPHCYLHHSRSCARLV
FT                   RAIKLLYGDSVDSLRESNHISNVALRGKKQKECSDKSCLRTPSLKKRVSDVNLEGKKDS
FT                   GMLKYIRFQVMSLSPAPLSLLIKAAPILTEEMYGDIQPAAWELLLSMDEHMAGAAAAMF
FT                   LLCAVKVPDAVSDMLMSEFHHAETVQRLNAVLKFHTLWRFRYQVWPRMEEGAQQIFKIP
FT                   PPSINFTLPSPVLGMPSVPMFDPPWVPQCSGSVQDPINEDQSKSFSARAVSRSHQRAEH
FT                   ILKNLQQEEEKKRLGREASLITAIPITQEACYEPTCTPNSEPEEEEMRSTPLSTPRTTM
FT                   CLSLRKQYSPACICAAVLPIVHLMEDGEVREDGVAVSAVAQQVLWNCLIEDPSTVLRHF
FT                   LEKLTISNRQDELMYMLRKLLLNIGDFPAQTSHILFNYLVGLIMYFVRTPCEWGMDAIS
FT                   ATLTFLWEVVGYVEGLFFKDLKQTMKKEQCEVKLLVTASMPGTKTLVVHGQNECDIPTQ
FT                   LPVHEDTQFEALLKECLEFFNIPESQSTHYFLMDKRWNLIHYNKTYVRDIYPFRRSVSP
FT                   QLNLVHMHPEKGQELIQKQVFTRKLEEVGRVLFLISLTQKIPTAHKQSHVSMLQEDLLR
FT                   LPSFPRSAIDAEFSLFSDPQAGKELFGLDTLQKSLWIQLLEEMFLGMPSEFPWGDEIML
FT                   FLNVFNGALILHPEDSALLRQYAATVINTAVHFNHLFSLSGYQWILPTMLQVYSDYESN
FT                   PQLRRAIEFACHQFYILHRKPFVLQLFASVAPLLEFPDAANTGSSKGVSAQCLFDLLQS
FT                   LEGETTDILDILELVKAEKPLKSLDFCYGNEDLTFSISEAIKLCVTVVAYAPESFRSLQ
FT                   MLMVLEALVPCYLQKMKRQTSQVETVPAAREEIAATAALATSLQALLYSVEVLTRYPEQ
FT                   GAKLHFIRENLHLLEEGQGLPREELDERISREEFRRPRESLLNICTEFYKHCGPRLKIL
FT                   QNLAGEPRVTALELLDVKSHMRLAEIAHSLLKLAPYDTQTMESRGLRRYIMEMLPITDW
FT                   SAEAVRPALILILKRLDRMFNKIHKMPTLRSLINVCVNLHSCCPACSIADTDSPWLEQP
FT                   EVQLLLQTVINVLLPPRIISTSRSKNFMLESSPAHCSTPGDAGKDLRKEGLAESTSQAA
FT                   YLALKVILVCFERQLGSQWYWLSLQVKEMALRKVGGLALWDFLDFIVRTRIPIFVLLRP
FT                   FIQCKLLAQPAENHEELSARQHISDQLERRFIPRPLCKSSLIAEFNSELKILKEAVHSG
FT                   SAYQGKTSISTVGTSTSAYRLSLATMSRSNTGTGTVWEQDSEPSQQASQDTLSRTDEED
FT                   EENDSVSMPSVVSEQEACLLSTIGRRRFSSHVSSMSAPQAEVGMLPSQSEPNVLDDSQG
FT                   LAAEGSLSRVASIQSEPGQQNVLLQQPLGRKRGLRQLRRPLLSRQKTQTEPRNRHGARL
FT                   STTRRSIQPKTKPSVDQKRSVTFIEAQPEPTAAPTDIFPATGQPQSCSPGRARKPEGTE
FT                   KPVLTSSPAIIIADLHSLSPKQSEPLLAEEGEKKEDEEIQGATAHCPLSTQLSDPDDFT
FT                   GLETSSLLQHGDTVLHISEENGTENPLLSSQFTFTPPELGETDSALDESHV"
FT   gap             14862653..14862716
FT                   /estimated_length=64
FT   gap             14876440..14882623
FT                   /estimated_length=6184
FT   gap             14890352..14890371
FT                   /estimated_length=20
FT   gap             14891610..14891629
FT                   /estimated_length=20
FT   gap             14892818..14893432
FT                   /estimated_length=615
FT   gap             14894489..14894742
FT                   /estimated_length=254
FT   gap             14896128..14896147
FT                   /estimated_length=20
FT   gap             14898877..14898896
FT                   /estimated_length=20
FT   gap             14899978..14899997
FT                   /estimated_length=20
FT   gap             14908549..14908568
FT                   /estimated_length=20
FT   gap             14929840..14929859
FT                   /estimated_length=20
FT   gene            14965462..14983999
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /note="gene_id=mCG121562.2"
FT   mRNA            join(14965462..14965968,14965983..14966034,
FT                   14970890..14970969,14978990..14979129,14979526..14979660,
FT                   14980068..14980154,14981936..14983999)
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, transcript
FT                   variant mCT170706"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT170706.1
FT                   created on 16-JUN-2003"
FT   mRNA            join(14965465..14965632,14970890..14970969,
FT                   14978990..14979129,14979526..14979660,14980068..14980154,
FT                   14981936..14983999)
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, transcript
FT                   variant mCT122768"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT122768.2
FT                   created on 16-JUN-2003"
FT   mRNA            join(14965465..14965621,14966234..14966265,
FT                   14970890..14970969,14978990..14979129,14979526..14979660,
FT                   14980068..14980154,14981936..14983999)
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, transcript
FT                   variant mCT170707"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT170707.1
FT                   created on 16-JUN-2003"
FT   mRNA            join(14965487..14965621,14970890..14970969,
FT                   14978990..14979129,14979526..14979660,14980068..14980154,
FT                   14981936..14983999)
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, transcript
FT                   variant mCT185775"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT185775.0
FT                   created on 16-JUN-2003"
FT   CDS             join(14965511..14965632,14970890..14970969,
FT                   14978990..14979129,14979526..14979660,14980068..14980154,
FT                   14981936..14982058)
FT                   /codon_start=1
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, isoform CRA_a"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT122768.2
FT                   protein_id=mCP74753.2 isoform=CRA_a"
FT                   /protein_id="EDL00235.1"
FT                   /translation="MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVP
FT                   NITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGAL
FT                   IKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWL
FT                   RTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQ
FT                   KRSLDR"
FT   CDS             join(14965511..14965621,14966234..14966265,
FT                   14970890..14970969,14978990..14979129,14979526..14979660,
FT                   14980068..14980154,14981936..14982058)
FT                   /codon_start=1
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, isoform CRA_e"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT170707.1
FT                   protein_id=mCP93625.1 isoform=CRA_e"
FT                   /db_xref="GOA:B2KGF0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="MGI:MGI:1913896"
FT                   /db_xref="UniProtKB/TrEMBL:B2KGF0"
FT                   /protein_id="EDL00239.1"
FT                   /translation="MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDAPCSSGRS
FT                   VFLHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEA
FT                   TENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDM
FT                   MPKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRN
FT                   VCSEAAQKRSLDR"
FT   mRNA            join(<14965524..14965632,14966234..14966265,
FT                   14970890..14970969,14978990..14979129,14979526..14979660,
FT                   14980068..14980154,14981936..>14982035)
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, transcript
FT                   variant mCT189308"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT189308.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<14965525..14965632,14966234..14966265,
FT                   14970890..14970969,14978990..14979129,14979526..14979660,
FT                   14980068..14980154,14981936..>14982035)
FT                   /codon_start=1
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, isoform CRA_d"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT189308.0
FT                   protein_id=mCP110304.0 isoform=CRA_d"
FT                   /protein_id="EDL00238.1"
FT                   /translation="QDRPVHPQQRPGQPGGRVPAHAGLGGRLPAPGCNGRAPCSSGRSV
FT                   FLHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEAT
FT                   ENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMM
FT                   PKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNV
FT                   CSEAA"
FT   CDS             join(14965620..14965621,14970890..14970969,
FT                   14978990..14979129,14979526..14979660,14980068..14980154,
FT                   14981936..14982058)
FT                   /codon_start=1
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, isoform CRA_c"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT185775.0
FT                   protein_id=mCP107033.0 isoform=CRA_c"
FT                   /protein_id="EDL00237.1"
FT                   /translation="MHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAV
FT                   AGANQYTFHLEATENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVE
FT                   PGFGGQKFMEDMMPKVHWLRTQFPTLDIEVDGGVGPDTVQKCAEAGANMIVSGSAIMRS
FT                   DDPRAVINLLRNVCSEAAQKRSLDR"
FT   CDS             join(14978992..14979129,14979526..14979660,
FT                   14980068..14980154,14981936..14982058)
FT                   /codon_start=1
FT                   /gene="Rpe"
FT                   /locus_tag="mCG_121562"
FT                   /product="ribulose-5-phosphate-3-epimerase, isoform CRA_b"
FT                   /note="gene_id=mCG121562.2 transcript_id=mCT170706.1
FT                   protein_id=mCP93624.1 isoform=CRA_b"
FT                   /protein_id="EDL00236.1"
FT                   /translation="MHMMVSRPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGM
FT                   KVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPTLDI
FT                   EVDGGVGPDTVQKCAEAGANMIVSGSAIMRSDDPRAVINLLRNVCSEAAQKRSLDR"
FT   gene            complement(14983441..15074606)
FT                   /locus_tag="mCG_144005"
FT                   /note="gene_id=mCG144005.0"
FT   mRNA            complement(join(14983441..14985196,14985995..14986161,
FT                   14987495..14987611,14988791..14988845,14990106..14990230,
FT                   14990919..14991040,14992674..14992805,14999832..14999939,
FT                   15002256..15002418,15027497..15027701,15038401..15038522,
FT                   15038923..15039015,15043477..15043618,15066876..15067995,
FT                   15073327..15073406,15074116..15074606))
FT                   /locus_tag="mCG_144005"
FT                   /product="mCG144005, transcript variant mCT183429"
FT                   /note="gene_id=mCG144005.0 transcript_id=mCT183429.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(14986123..14986161,14987495..14987611,
FT                   14988791..14988845,14990106..14990230,14990919..14991040,
FT                   14992674..14992805,14999832..14999939,15002256..15002418,
FT                   15027497..15027701,15038401..15038522,15038923..15039015,
FT                   15043477..15043618,15066876..15067966))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144005"
FT                   /product="mCG144005, isoform CRA_a"
FT                   /note="gene_id=mCG144005.0 transcript_id=mCT183429.0
FT                   protein_id=mCP106105.0 isoform=CRA_a"
FT                   /protein_id="EDL00240.1"
FT                   /translation="MTPALKEATTKGICFSSLPNTMESDKMLCMESPRTVDEKLKGGDT
FT                   FSQMLGFPTPEPTLNTNFVNLKHFASPQASKHFQTVLLMSSNSTLNKYNENYNQKKVME
FT                   SNCSKLKNVLCNGSSIQLSKICPSHSENEFIKKELSDTTSQCMKDIQIVLDSNLTKDTN
FT                   VDRLHLQNCKWYQKNALLDKFTDTKIKKGLLQCTQKKIGPSHSDVPTSSSAAEKEEEVN
FT                   ARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKFSMKHQLPTMKIFHEPTT
FT                   VLSNSLLEHTEIKPEVNILASENKFWDDTNNGFSQCTAAEIQRFALSATGLLSHVEEGL
FT                   DSDATDSSSDDELDEYTIRKNVAVNSSTEWKWLVDRAQVGSRWTWLQAQISELEYKIQQ
FT                   LTDIHRQIRASKVPQRSEEPLPEHDFEMSPSSPTLLLRNIEKQSAQLTEIINSLIAPLN
FT                   LSPTSSPLSSKSCSHKCLANGISRSASENLDELSSSSSWLLNQKHSKKRRKDRTRLKSP
FT                   SLAIMSTAARTRPLQSFHKRKLYRLSPTFYWTPETLPSKEAFLSSTQTPYTGSPFSWDN
FT                   WEQSSRSHLLREQVSKLDSSFHPVLSLPSEIPLHLHFETLFKKTDMKGELAENQFVGDC
FT                   LISPPPVQGTSSLNQWRNGYSPICKPQIRSQPSVQLLQGRKKRHLSETALAGERTRFEE
FT                   FAFQRSEPGSHCNFTAVSNANVTSRTQNPSSQNTSRRRLRSESSYDIDNIVIPMSLVAP
FT                   AKLEKLQYKEILTPRWRKVVLQPLDEHNLNKEEIEDLSDDVFSLRHRKYEEREQARWSL
FT                   WEQSKWHRRNNRQLTVKMWKGRTWF"
FT   gap             15017189..15017208
FT                   /estimated_length=20
FT   gap             15021136..15021155
FT                   /estimated_length=20
FT   mRNA            complement(join(15042508..15043618,15066876..15067995,
FT                   15073327..15073406,15074116..15074606))
FT                   /locus_tag="mCG_144005"
FT                   /product="mCG144005, transcript variant mCT184318"
FT                   /note="gene_id=mCG144005.0 transcript_id=mCT184318.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(15043456..15043618,15066876..15067966))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144005"
FT                   /product="mCG144005, isoform CRA_b"
FT                   /note="gene_id=mCG144005.0 transcript_id=mCT184318.0
FT                   protein_id=mCP106123.0 isoform=CRA_b"
FT                   /protein_id="EDL00241.1"
FT                   /translation="MTPALKEATTKGICFSSLPNTMESDKMLCMESPRTVDEKLKGGDT
FT                   FSQMLGFPTPEPTLNTNFVNLKHFASPQASKHFQTVLLMSSNSTLNKYNENYNQKKVME
FT                   SNCSKLKNVLCNGSSIQLSKICPSHSENEFIKKELSDTTSQCMKDIQIVLDSNLTKDTN
FT                   VDRLHLQNCKWYQKNALLDKFTDTKIKKGLLQCTQKKIGPSHSDVPTSSSAAEKEEEVN
FT                   ARLLHCVSKQKILLSQARRTQKHLQMLLAKHVVKHYGQQMKFSMKHQLPTMKIFHEPTT
FT                   VLSNSLLEHTEIKPEVNILASENKFWDDTNNGFSQCTAAEIQRFALSATGLLSHVEEGL
FT                   DSDATDSSSDDELDEYTIRKNVAVNSSTEWKWLVDRAQVGSRWTWLQAQISELEYKIQQ
FT                   LTDIHRQIRASKVLLVFC"
FT   gap             15055769..15055788
FT                   /estimated_length=20
FT   gap             15091161..15091180
FT                   /estimated_length=20
FT   gene            complement(15096494..15127649)
FT                   /locus_tag="mCG_121561"
FT                   /note="gene_id=mCG121561.1"
FT   mRNA            complement(join(15096494..15097404,15102698..15102784,
FT                   15104012..15104139,15107503..15107616,15108915..15109016,
FT                   15109952..15110116,15113179..15113245,15117227..15117391,
FT                   15118731..15118868,15121773..15121928,15127530..15127649))
FT                   /locus_tag="mCG_121561"
FT                   /product="mCG121561"
FT                   /note="gene_id=mCG121561.1 transcript_id=mCT122767.1
FT                   created on 18-JUL-2002"
FT   CDS             complement(join(15097311..15097404,15102698..15102784,
FT                   15104012..15104139,15107503..15107616,15108915..15109016,
FT                   15109952..15110116,15113179..15113245,15117227..15117391,
FT                   15118731..15118868,15121773..15121928,15127530..15127606))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121561"
FT                   /product="mCG121561"
FT                   /note="gene_id=mCG121561.1 transcript_id=mCT122767.1
FT                   protein_id=mCP74741.0"
FT                   /protein_id="EDL00242.1"
FT                   /translation="MAARLLLRSLRVLSARSAPRPLPSARCSHSGAEARLETPSAKKLT
FT                   DVGIRRIFSSEHDIFRESVRKFFQEEVIPHHTEWEKAGEVSREVWEKAGKQGLLGINIA
FT                   EKHGGIGGDLLSTAVTWEEQAYSNCTGPGFSLHSDIVMPYIANYGTKEQIEKFIPQMTA
FT                   GKCIGAIAMTEPGAGSDLQGVRTNAKRSGSDWILNGSKVFITNGWLSDLVIVVAVTNRE
FT                   ARSPAHGISLFLVENGMKGFIKGRKLHKMGMKAQDTAELFFEDVRLPANALLGEENKGF
FT                   YYLMQELPQERLLIAELAISACEFMFEETRNYVKQRKAFGKTVAHIQTVQHKLAELKTH
FT                   ICVTRAFVDSCLQLHETKRLDSGSASMAKYWASELQNSVAYECVQLHGGWGYMWEYPIA
FT                   KAYVDARVQPIYGGTNEIMKELIARQIVSDS"
FT   gap             15104517..15104671
FT                   /estimated_length=155
FT   gap             15108365..15108436
FT                   /estimated_length=72
FT   gap             15135771..15135790
FT                   /estimated_length=20
FT   gap             15137750..15137769
FT                   /estimated_length=20
FT   gap             15139876..15139895
FT                   /estimated_length=20
FT   gap             15153134..15153153
FT                   /estimated_length=20
FT   gap             15154660..15154679
FT                   /estimated_length=20
FT   gap             15169304..15171706
FT                   /estimated_length=2403
FT   gap             15173799..15173818
FT                   /estimated_length=20
FT   gap             15174901..15176575
FT                   /estimated_length=1675
FT   gap             15178826..15179025
FT                   /estimated_length=200
FT   gap             15180575..15180594
FT                   /estimated_length=20
FT   gap             15191197..15191818
FT                   /estimated_length=622
FT   gene            complement(15192486..15213393)
FT                   /locus_tag="mCG_121569"
FT                   /note="gene_id=mCG121569.1"
FT   mRNA            complement(join(15192486..15192748,15193195..15193237,
FT                   15194381..15194458,15194745..15194918,15198140..15198283,
FT                   15202224..15202251,15212801..15213026,15213296..15213393))
FT                   /locus_tag="mCG_121569"
FT                   /product="mCG121569, transcript variant mCT122775"
FT                   /note="gene_id=mCG121569.1 transcript_id=mCT122775.1
FT                   created on 09-SEP-2002"
FT   mRNA            complement(join(15192487..15192748,15193195..15193237,
FT                   15194381..15194458,15194745..15194918,15198140..15198283,
FT                   15202496..15202520,15203262..15203328))
FT                   /locus_tag="mCG_121569"
FT                   /product="mCG121569, transcript variant mCT173268"
FT                   /note="gene_id=mCG121569.1 transcript_id=mCT173268.0
FT                   created on 09-SEP-2002"
FT   CDS             complement(join(15193209..15193237,15194381..15194458,
FT                   15194745..15194918,15198140..15198283,15202224..15202251,
FT                   15212801..15212914))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121569"
FT                   /product="mCG121569, isoform CRA_a"
FT                   /note="gene_id=mCG121569.1 transcript_id=mCT122775.1
FT                   protein_id=mCP74804.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q545T7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="MGI:MGI:97269"
FT                   /db_xref="UniProtKB/TrEMBL:Q545T7"
FT                   /protein_id="EDL00243.1"
FT                   /translation="MAPKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQ
FT                   QEDFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEF
FT                   EQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVE
FT                   ALLAGQEDSNGCINYEAFVKHIMSV"
FT   CDS             complement(join(15193209..15193237,15194381..15194458,
FT                   15194745..15194918,15198140..15198283,15202496..15202520,
FT                   15203262..15203264))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121569"
FT                   /product="mCG121569, isoform CRA_b"
FT                   /note="gene_id=mCG121569.1 transcript_id=mCT173268.0
FT                   protein_id=mCP96187.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q545G5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="MGI:MGI:97269"
FT                   /db_xref="UniProtKB/TrEMBL:Q545G5"
FT                   /protein_id="EDL00244.1"
FT                   /translation="MSFSADQIADFKEAFLLFDRTGECKITLSQVGDVLRALGTNPTNA
FT                   EVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQGGYEDFVEGLRVFDKEGNGTVM
FT                   GAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEAFVKHIMSV"
FT   gap             15217746..15217765
FT                   /estimated_length=20
FT   gap             15236630..15236649
FT                   /estimated_length=20
FT   gap             15248061..15248080
FT                   /estimated_length=20
FT   gap             15250101..15250120
FT                   /estimated_length=20
FT   gap             15251349..15251368
FT                   /estimated_length=20
FT   gene            complement(15268980..15307155)
FT                   /gene="Lancl1"
FT                   /locus_tag="mCG_121566"
FT                   /note="gene_id=mCG121566.1"
FT   mRNA            complement(join(15268980..15272005,15272787..15272859,
FT                   15273229..15273405,15275317..15275499,15277698..15277844,
FT                   15278381..15278516,15289211..15289418,15302451..15302568,
FT                   15306794..15306890,15307075..15307155))
FT                   /gene="Lancl1"
FT                   /locus_tag="mCG_121566"
FT                   /product="LanC (bacterial lantibiotic synthetase component
FT                   C)-like 1, transcript variant mCT122772"
FT                   /note="gene_id=mCG121566.1 transcript_id=mCT122772.1
FT                   created on 19-NOV-2002"
FT   mRNA            complement(join(15271825..15272005,15272787..15272859,
FT                   15273229..15273405,15275317..15275499,15277698..15277844,
FT                   15278381..15278516,15289211..15289418,15302451..15302568,
FT                   15306794..15306890,15307071..>15307133))
FT                   /gene="Lancl1"
FT                   /locus_tag="mCG_121566"
FT                   /product="LanC (bacterial lantibiotic synthetase component
FT                   C)-like 1, transcript variant mCT189309"
FT                   /note="gene_id=mCG121566.1 transcript_id=mCT189309.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(15271929..15272005,15272787..15272859,
FT                   15273229..15273405,15275317..15275499,15277698..15277844,
FT                   15278381..15278516,15289211..15289418,15302451..15302568,
FT                   15306794..15306890,15307071..>15307132))
FT                   /codon_start=1
FT                   /gene="Lancl1"
FT                   /locus_tag="mCG_121566"
FT                   /product="LanC (bacterial lantibiotic synthetase component
FT                   C)-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG121566.1 transcript_id=mCT189309.0
FT                   protein_id=mCP110305.0 isoform=CRA_b"
FT                   /protein_id="EDL00246.1"
FT                   /translation="LERRAGSIISVYSPLVGVGRGFACGVMAQRAFPNPYADYNKSLAE
FT                   NYFDSTGRLTPEFSHRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLHNV
FT                   FGDPAYLQMAHSYVKQSLNCLSRRSITFLCGDAGPLAVAAVLYHKMNSEKQAEECITRL
FT                   IHLNKIDPHVPNEMLYGRIGYIFALLFVNKNFGEEKIPQSHIQQICENILTSGENLSRK
FT                   RNFAAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVNQGKLHSLVKPSVDFVCRLK
FT                   FPSGNYPPCLDDTRDLLVHWCHGAPGVIYMLIQAYKVFKEERYLCDAQQCADVIWQYGL
FT                   LKKGYGLCHGAAGNAYAFLALYNLTQDLKYLYRACKFAEWCLDYGEHGCRTADTPFSLF
FT                   EGMAGTIYFLADLLVPTKAKFPAFEL"
FT   CDS             complement(join(15271929..15272005,15272787..15272859,
FT                   15273229..15273405,15275317..15275499,15277698..15277844,
FT                   15278381..15278516,15289211..15289418,15302451..15302568,
FT                   15306794..15306874))
FT                   /codon_start=1
FT                   /gene="Lancl1"
FT                   /locus_tag="mCG_121566"
FT                   /product="LanC (bacterial lantibiotic synthetase component
FT                   C)-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG121566.1 transcript_id=mCT122772.1
FT                   protein_id=mCP74786.1 isoform=CRA_a"
FT                   /protein_id="EDL00245.1"
FT                   /translation="MAQRAFPNPYADYNKSLAENYFDSTGRLTPEFSHRLTNKIRELLQ
FT                   QMERGLKSADPRDGTGYTGWAGIAVLYLHLHNVFGDPAYLQMAHSYVKQSLNCLSRRSI
FT                   TFLCGDAGPLAVAAVLYHKMNSEKQAEECITRLIHLNKIDPHVPNEMLYGRIGYIFALL
FT                   FVNKNFGEEKIPQSHIQQICENILTSGENLSRKRNFAAKSPLMYEWYQEYYVGAAHGLA
FT                   GIYYYLMQPSLQVNQGKLHSLVKPSVDFVCRLKFPSGNYPPCLDDTRDLLVHWCHGAPG
FT                   VIYMLIQAYKVFKEERYLCDAQQCADVIWQYGLLKKGYGLCHGAAGNAYAFLALYNLTQ
FT                   DLKYLYRACKFAEWCLDYGEHGCRTADTPFSLFEGMAGTIYFLADLLVPTKAKFPAFEL
FT                   "
FT   gap             15279477..15279648
FT                   /estimated_length=172
FT   gap             15284150..15284483
FT                   /estimated_length=334
FT   gap             15313098..15313117
FT                   /estimated_length=20
FT   gap             15337836..15338001
FT                   /estimated_length=166
FT   gap             15342088..15342107
FT                   /estimated_length=20
FT   gap             15343870..15349210
FT                   /estimated_length=5341
FT   gap             15350802..15351082
FT                   /estimated_length=281
FT   gap             15353019..15353038
FT                   /estimated_length=20
FT   gap             15354306..15354325
FT                   /estimated_length=20
FT   gap             15355633..15357297
FT                   /estimated_length=1665
FT   gap             15365029..15365165
FT                   /estimated_length=137
FT   gap             15370553..15370936
FT                   /estimated_length=384
FT   gap             15373495..15373986
FT                   /estimated_length=492
FT   gap             15379209..15379228
FT                   /estimated_length=20
FT   gap             15397638..15397925
FT                   /estimated_length=288
FT   gene            15399701..15507900
FT                   /locus_tag="mCG_121563"
FT                   /note="gene_id=mCG121563.1"
FT   mRNA            join(15399701..15399963,15416190..15416299,
FT                   15419339..15419483,15420341..15420430,15422271..15422327,
FT                   15425208..15425300,15428811..15428900,15432547..15432675,
FT                   15433238..15433344,15434153..15434291,15437578..15437676,
FT                   15439261..15439356,15441814..15442003,15442797..15442954,
FT                   15444612..15444740,15447221..15447365,15449027..15449237,
FT                   15450680..15450878,15453753..15453929,15456913..15457031,
FT                   15472010..15472151,15473399..15473464,15473866..15473929,
FT                   15475160..15475341,15481119..15481313,15481743..15481810,
FT                   15483372..15483447,15486219..15486296,15489016..15489123,
FT                   15490634..15490723,15492078..15492248,15497169..15497267,
FT                   15504869..15504981,15506016..15506145,15506849..15507900)
FT                   /locus_tag="mCG_121563"
FT                   /product="mCG121563"
FT                   /note="gene_id=mCG121563.1 transcript_id=mCT122769.0
FT                   created on 19-NOV-2002"
FT   CDS             join(15399838..15399963,15416190..15416299,
FT                   15419339..15419483,15420341..15420430,15422271..15422327,
FT                   15425208..15425300,15428811..15428900,15432547..15432675,
FT                   15433238..15433344,15434153..15434291,15437578..15437676,
FT                   15439261..15439356,15441814..15442003,15442797..15442954,
FT                   15444612..15444740,15447221..15447365,15449027..15449237,
FT                   15450680..15450878,15453753..15453929,15456913..15457031,
FT                   15472010..15472151,15473399..15473464,15473866..15473929,
FT                   15475160..15475341,15481119..15481313,15481743..15481810,
FT                   15483372..15483447,15486219..15486296,15489016..15489123,
FT                   15490634..15490723,15492078..15492248,15497169..15497267,
FT                   15504869..15504981,15506016..15506145,15506849..15506977)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121563"
FT                   /product="mCG121563"
FT                   /note="gene_id=mCG121563.1 transcript_id=mCT122769.0
FT                   protein_id=mCP74761.1"
FT                   /protein_id="EDL00247.1"
FT                   /translation="MTRILTACKVVKTLKSGFGFANVTTKRQWDFSRPGIRLLSVKAKT
FT                   AHIVLEDGTKMKGYSFGHPSSVAGEVVFNTGLGGYPEALTDPAYKGQILTMANPIIGNG
FT                   GAPDTTARDELGLNKYMESDGIKVAGLLVLNYSNDYNHWLATKSLGQWLQEEKVPAIYG
FT                   VDTRMLTKIIRDKGTMLGKIEFEGQSVDFVDPNKQNLIAEVSTKDVKVFGKGNPTKVVA
FT                   VDCGIKNNVIRLLVKRGAEVHLVPWNHDFTQMEYDGLLIAGGPGNPALAQPLIQNVKKI
FT                   LESDRKEPLFGISTGNIITGLAAGAKSYKMSMANRGQNQPVLNITNRQAFITAQNHGYA
FT                   LDNTLPAGWKPLFVNVNDQTNEYLFDSFFSLIKKGKGTTITSVLPKPALVASRVEVSKV
FT                   LILGSGGLSIGQAGEFDYSGSQAVKAMKEENVKTVLMNPNIASVQTNEVGLKQADAVYF
FT                   LPITPQFVTEVIKAERPDGLILGMGGQTALNCGVELFKRGVLKEYGVKVLGTSVESIMA
FT                   TEDRQLFSDKLNEINEKIAPSFAVESMEDALKAADTIGYPVMIRSAYALGGLGSGICPN
FT                   KETLIDLGTKAFAMTNQILVERSVTGWKEIEYEVVRDADDNCVTVCNMENVDAMGVHTG
FT                   DSVVVAPAQTLSNAEFQMLRRTSVNVVRHLGIVGECNIQFALHPTSMEYCIIEVNARLS
FT                   RSSALASKATGYPLAFIAAKIALGIPLPEIKNVVSGKTSACFEPSLDYMVTKIPRWDLD
FT                   RFHGTSSRIGSSMKSVGEVMAIGRTFEESFQKALRMCHPSVDGFTPRLPMNKEWPANLD
FT                   LKKELSEPSSTRIYAIAKALENNMPLDEIVRLTSIDKWFLYKMRDILNMDKTLKGLNSD
FT                   SVTEETLRKAKEIGFSDKQISKCLGLTEAQTRELRLKKNIHPWVKQIDTLAAEYPSVTN
FT                   YLYVTYNGQEHDIKFDEHGIMVLGCGPYHIGSSVEFDWCAVSSIRTLRQLGKKTVVVNC
FT                   NPETVSTDFDECDKLYFEELSLERILDIYHQEACNGCIISVGGQIPNNLAVPLYKNGVK
FT                   IMGTSPLQIDRAEDRSIFSAVLDELKVAQAPWKAVNTLNEALEFANSVGYPCLLRPSYV
FT                   LSGSAMNVVFSEDEMKRFLEEATRVSQEHPVVLTKFVEGAREVEMDAVGKEGRVISHAI
FT                   SEHVEDAGVHSGDATLMLPTQTISQGAIEKVKDATRKIAKAFAISGPFNVQFLVKGNDV
FT                   LVIECNLRASRSFPFVSKTLGVDFIDVATKVMIGESIDEKRLPTLEQPIIPSDYVAIKV
FT                   ACFGEGIHTAFLKAMLSTGFKIPQKGILIGIQLFATEATSDWLNANNVPATPVAWPSQE
FT                   GQNPSLSSIRKLIRDGSIDLVINLPNNNTKFVHDNYVIRRTAVDSGIALLTNFQVANIL
FT                   DIFFQVTKLFAEAVQKSRTVDSKSLFHYRQYSAGKAA"
FT   gap             15409187..15409234
FT                   /estimated_length=48
FT   gap             15430132..15430179
FT                   /estimated_length=48
FT   gap             15436036..15436055
FT                   /estimated_length=20
FT   gap             15440039..15440058
FT                   /estimated_length=20
FT   gap             15477802..15478001
FT                   /estimated_length=200
FT   gap             15515367..15516028
FT                   /estimated_length=662
FT   gap             15517180..15517199
FT                   /estimated_length=20
FT   gap             15518855..15520275
FT                   /estimated_length=1421
FT   gap             15521224..15524036
FT                   /estimated_length=2813
FT   gap             15525118..15525137
FT                   /estimated_length=20
FT   gap             15526627..15527604
FT                   /estimated_length=978
FT   gap             15528657..15536371
FT                   /estimated_length=7715
FT   gap             15544842..15544861
FT                   /estimated_length=20
FT   gap             15565206..15566430
FT                   /estimated_length=1225
FT   gap             15596268..15596287
FT                   /estimated_length=20
FT   gap             15604053..15604083
FT                   /estimated_length=31
FT   gap             15608572..15608591
FT                   /estimated_length=20
FT   gap             15611702..15617067
FT                   /estimated_length=5366
FT   gap             15628994..15629106
FT                   /estimated_length=113
FT   gap             15640273..15640488
FT                   /estimated_length=216
FT   gap             15661072..15664434
FT                   /estimated_length=3363
FT   gap             15665750..15665769
FT                   /estimated_length=20
FT   gap             15666860..15670635
FT                   /estimated_length=3776
FT   gap             15671415..15673351
FT                   /estimated_length=1937
FT   gap             15715662..15715681
FT                   /estimated_length=20
FT   gap             15719033..15720032
FT                   /estimated_length=1000
FT   gap             15729129..15729193
FT                   /estimated_length=65
FT   gap             15743160..15743179
FT                   /estimated_length=20
FT   gap             15781880..15781899
FT                   /estimated_length=20
FT   gap             15793585..15793604
FT                   /estimated_length=20
FT   gap             15794685..15794704
FT                   /estimated_length=20
FT   gap             15798746..15798765
FT                   /estimated_length=20
FT   gap             15831868..15831887
FT                   /estimated_length=20
FT   gap             15840476..15840495
FT                   /estimated_length=20
FT   gap             15842965..15842984
FT                   /estimated_length=20
FT   gap             15848712..15852179
FT                   /estimated_length=3468
FT   gap             15856585..15858958
FT                   /estimated_length=2374
FT   gap             15869212..15869231
FT                   /estimated_length=20
FT   gap             15884031..15884066
FT                   /estimated_length=36
FT   gap             15917225..15919884
FT                   /estimated_length=2660
FT   gap             15922510..15922635
FT                   /estimated_length=126
FT   gap             15933917..15938685
FT                   /estimated_length=4769
FT   gap             16003654..16003673
FT                   /estimated_length=20
FT   gap             16006448..16006467
FT                   /estimated_length=20
FT   gap             16008462..16010526
FT                   /estimated_length=2065
FT   gap             16011318..16011337
FT                   /estimated_length=20
FT   gap             16014127..16014146
FT                   /estimated_length=20
FT   gap             16028074..16034788
FT                   /estimated_length=6715
FT   gap             16043833..16044049
FT                   /estimated_length=217
FT   gap             16047400..16047419
FT                   /estimated_length=20
FT   gap             16048581..16048600
FT                   /estimated_length=20
FT   gap             16060388..16060407
FT                   /estimated_length=20
FT   gap             16086054..16086082
FT                   /estimated_length=29
FT   gap             16097702..16097721
FT                   /estimated_length=20
FT   gap             16124678..16124697
FT                   /estimated_length=20
FT   gap             16130982..16131103
FT                   /estimated_length=122
FT   gap             16139528..16141455
FT                   /estimated_length=1928
FT   gap             16143343..16143470
FT                   /estimated_length=128
FT   gap             16146636..16146655
FT                   /estimated_length=20
FT   gap             16157237..16157446
FT                   /estimated_length=210
FT   gap             16172643..16172662
FT                   /estimated_length=20
FT   gap             16176345..16195243
FT                   /estimated_length=18899
FT   gap             16216453..16218752
FT                   /estimated_length=2300
FT   gap             16220044..16220063
FT                   /estimated_length=20
FT   gap             16223787..16223936
FT                   /estimated_length=150
FT   gap             16230800..16230819
FT                   /estimated_length=20
FT   gap             16232189..16232208
FT                   /estimated_length=20
FT   gap             16275772..16275791
FT                   /estimated_length=20
FT   gap             16299836..16299855
FT                   /estimated_length=20
FT   gap             16328122..16328141
FT                   /estimated_length=20
FT   gap             16329717..16329736
FT                   /estimated_length=20
FT   gap             16332315..16332334
FT                   /estimated_length=20
FT   gene            complement(16342521..16724359)
FT                   /locus_tag="mCG_122138"
FT                   /note="gene_id=mCG122138.1"
FT   mRNA            complement(join(16342521..16342526,16355110..16355555,
FT                   16357498..16357795,16358965..16359012,16387521..16387691,
FT                   16389103..16389200,16391428..16391574,16396143..16396302,
FT                   16519822..16520007,16580423..16580521,16584372..16584494,
FT                   16589029..16589161,16614188..16614232,16622097..16622251,
FT                   16629658..16629751,16633419..16633551,16652210..16652409,
FT                   16654363..16654453,16655346..16655419,16663763..16663925,
FT                   16667844..16667957,16670545..16670686,16673299..16673417,
FT                   16698185..16698250,16724225..16724359))
FT                   /locus_tag="mCG_122138"
FT                   /product="mCG122138"
FT                   /note="gene_id=mCG122138.1 transcript_id=mCT123353.1
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(16355110..16355555,16357498..16357795,
FT                   16358965..16359012,16387521..16387691,16389103..16389200,
FT                   16391428..16391574,16396143..16396302,16519822..16520007,
FT                   16580423..16580521,16584372..16584494,16589029..16589161,
FT                   16614188..16614232,16622097..16622251,16629658..16629751,
FT                   16633419..16633551,16652210..16652409,16654363..16654453,
FT                   16655346..16655419,16663763..16663925,16667844..16667957,
FT                   16670545..16670686,16673299..16673417,16698185..16698250,
FT                   16724225..16724258))
FT                   /codon_start=1
FT                   /locus_tag="mCG_122138"
FT                   /product="mCG122138"
FT                   /note="gene_id=mCG122138.1 transcript_id=mCT123353.1
FT                   protein_id=mCP74686.1"
FT                   /protein_id="EDL00248.1"
FT                   /translation="MTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDG
FT                   RCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHN
FT                   FNAKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGI
FT                   GTGSLMSAQTVDSSNIDKFINCTKINGNLIFLVTGIHGSVFNAVQYCSVKDPYNAIDAI
FT                   DPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNLVTIGGRVLYSGLSLLILKQQGIT
FT                   SLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDNRRAENCTAEGMV
FT                   CNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYDGEFREFENGSICVECDSQCEK
FT                   MEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPN
FT                   CTQGCIGSSIEDCIGLTDRTPLIAAGVIGGLFILVIMALTFAVYVRRKSIKKKRALRRF
FT                   LETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPV
FT                   AIKILNETTGPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDY
FT                   VHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAARNVLVKSPNHVKITDFGLAR
FT                   LLEGDEKEYNADGGKVGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDV
FT                   YMVMVKCWMIDADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLL
FT                   DEEDLEDMMDAEEYLVPQAFNIPPPIYTSRTRIDSNRSEIGHSPPPAYTPMSGNQFVYQ
FT                   DGGFATQQGMPMPYRATTSTIPEAPVAQGATAEMFDDSCCNGTLRKPVAPHVQEDSSTQ
FT                   RYSADPTVFAPERNPRGELDEEGYMTPMHDKPKQEYLNPVEENPFVSRRKNGDLQALDN
FT                   PEYHSASSGPPKAEDEYVNEPLYLNTFANALGSAEYMKNSVLSVPEKAKKAFDNPDYWN
FT                   HSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTMLPPPPYRH
FT                   RNTVV"
FT   gap             16361550..16361569
FT                   /estimated_length=20
FT   gap             16380337..16380356
FT                   /estimated_length=20
FT   gap             16384147..16384166
FT                   /estimated_length=20
FT   gap             16408644..16408663
FT                   /estimated_length=20
FT   gene            16434531..16436848
FT                   /locus_tag="mCG_1035695"
FT                   /note="gene_id=mCG1035695.1"
FT   mRNA            join(16434531..16434707,16436337..16436848)
FT                   /locus_tag="mCG_1035695"
FT                   /product="mCG1035695"
FT                   /note="gene_id=mCG1035695.1 transcript_id=mCT153399.0
FT                   created on 19-MAR-2003"
FT   CDS             16436443..16436565
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035695"
FT                   /product="mCG1035695"
FT                   /note="gene_id=mCG1035695.1 transcript_id=mCT153399.0
FT                   protein_id=mCP74604.0"
FT                   /protein_id="EDL00249.1"
FT                   /translation="MKIYLDGSHLLKSMCSDESRVLDICRNSTLHLPIEALWRC"
FT   gap             16441435..16441454
FT                   /estimated_length=20
FT   gap             16442918..16442937
FT                   /estimated_length=20
FT   gene            complement(16444917..16447470)
FT                   /locus_tag="mCG_1035696"
FT                   /note="gene_id=mCG1035696.1"
FT   mRNA            complement(join(16444917..16445420,16447190..16447470))
FT                   /locus_tag="mCG_1035696"
FT                   /product="mCG1035696"
FT                   /note="gene_id=mCG1035696.1 transcript_id=mCT153400.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(16445278..16445415)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035696"
FT                   /product="mCG1035696"
FT                   /note="gene_id=mCG1035696.1 transcript_id=mCT153400.0
FT                   protein_id=mCP74610.1"
FT                   /protein_id="EDL00250.1"
FT                   /translation="MDTIPRGNETITSITCVFIWGVNTRVKFSLTSPLLGNDFHALIGI
FT                   "
FT   gap             16446004..16446023
FT                   /estimated_length=20
FT   gap             16447147..16447166
FT                   /estimated_length=20
FT   gap             16451653..16451672
FT                   /estimated_length=20
FT   gap             16464119..16464138
FT                   /estimated_length=20
FT   gap             16465493..16465512
FT                   /estimated_length=20
FT   gap             16466551..16468887
FT                   /estimated_length=2337
FT   gap             16470098..16470117
FT                   /estimated_length=20
FT   gap             16475138..16475704
FT                   /estimated_length=567
FT   gap             16476732..16477828
FT                   /estimated_length=1097
FT   gap             16535761..16535821
FT                   /estimated_length=61
FT   gap             16544562..16544581
FT                   /estimated_length=20
FT   gap             16553620..16554395
FT                   /estimated_length=776
FT   gap             16567346..16567365
FT                   /estimated_length=20
FT   gap             16568673..16568692
FT                   /estimated_length=20
FT   gap             16572967..16572986
FT                   /estimated_length=20
FT   gap             16575505..16576240
FT                   /estimated_length=736
FT   gap             16578119..16578138
FT                   /estimated_length=20
FT   gap             16603778..16603816
FT                   /estimated_length=39
FT   gap             16639604..16639821
FT                   /estimated_length=218
FT   gap             16645162..16645181
FT                   /estimated_length=20
FT   gap             16661421..16661471
FT                   /estimated_length=51
FT   gap             16662595..16663154
FT                   /estimated_length=560
FT   gap             16691274..16691293
FT                   /estimated_length=20
FT   gap             16694047..16694066
FT                   /estimated_length=20
FT   gap             16699044..16699063
FT                   /estimated_length=20
FT   gap             16715923..16715959
FT                   /estimated_length=37
FT   gap             16734820..16734839
FT                   /estimated_length=20
FT   gap             16743187..16743282
FT                   /estimated_length=96
FT   gap             16748837..16751443
FT                   /estimated_length=2607
FT   gap             16752328..16753473
FT                   /estimated_length=1146
FT   gap             16781120..16781139
FT                   /estimated_length=20
FT   gap             16782876..16803896
FT                   /estimated_length=21021
FT   gap             16822082..16822101
FT                   /estimated_length=20
FT   gap             16842523..16842542
FT                   /estimated_length=20
FT   gap             16845481..16845500
FT                   /estimated_length=20
FT   gap             16848418..16848437
FT                   /estimated_length=20
FT   gap             16853487..16853789
FT                   /estimated_length=303
FT   gap             16859146..16859165
FT                   /estimated_length=20
FT   gap             16878673..16878692
FT                   /estimated_length=20
FT   gap             16903094..16904172
FT                   /estimated_length=1079
FT   gap             16980152..16980171
FT                   /estimated_length=20
FT   gap             17006638..17006657
FT                   /estimated_length=20
FT   gap             17019929..17020676
FT                   /estimated_length=748
FT   gap             17025823..17026153
FT                   /estimated_length=331
FT   gap             17027797..17027816
FT                   /estimated_length=20
FT   gap             17043856..17043875
FT                   /estimated_length=20
FT   gap             17064192..17068822
FT                   /estimated_length=4631
FT   gap             17124278..17124297
FT                   /estimated_length=20
FT   gap             17150411..17150445
FT                   /estimated_length=35
FT   gap             17198469..17198488
FT                   /estimated_length=20
FT   gap             17220789..17221475
FT                   /estimated_length=687
FT   gap             17222990..17223009
FT                   /estimated_length=20
FT   gap             17237190..17237209
FT                   /estimated_length=20
FT   gap             17238189..17238782
FT                   /estimated_length=594
FT   gap             17248161..17248180
FT                   /estimated_length=20
FT   gap             17258966..17259350
FT                   /estimated_length=385
FT   gap             17264453..17264472
FT                   /estimated_length=20
FT   gap             17283426..17283666
FT                   /estimated_length=241
FT   gap             17318054..17318073
FT                   /estimated_length=20
FT   gap             17326390..17326409
FT                   /estimated_length=20
FT   gap             17327441..17327478
FT                   /estimated_length=38
FT   gap             17343346..17343975
FT                   /estimated_length=630
FT   gap             17345623..17345642
FT                   /estimated_length=20
FT   gap             17348489..17348508
FT                   /estimated_length=20
FT   gap             17375328..17375364
FT                   /estimated_length=37
FT   gap             17427848..17427896
FT                   /estimated_length=49
FT   gap             17434602..17434621
FT                   /estimated_length=20
FT   gap             17444058..17444152
FT                   /estimated_length=95
FT   gap             17446783..17446802
FT                   /estimated_length=20
FT   gap             17447966..17447985
FT                   /estimated_length=20
FT   gene            complement(17453313..17453624)
FT                   /pseudo
FT                   /locus_tag="mCG_1035558"
FT                   /note="gene_id=mCG1035558.1"
FT   mRNA            complement(17453313..17453624)
FT                   /pseudo
FT                   /locus_tag="mCG_1035558"
FT                   /note="gene_id=mCG1035558.1 transcript_id=mCT153262.0
FT                   created on 19-MAR-2003"
FT   gap             17468176..17468195
FT                   /estimated_length=20
FT   gap             17476346..17476536
FT                   /estimated_length=191
FT   gap             17480238..17480257
FT                   /estimated_length=20
FT   gap             17481386..17481405
FT                   /estimated_length=20
FT   gap             17499688..17499707
FT                   /estimated_length=20
FT   gap             17500734..17500753
FT                   /estimated_length=20
FT   gap             17513604..17513623
FT                   /estimated_length=20
FT   gap             17520730..17521086
FT                   /estimated_length=357
FT   gap             17548993..17549012
FT                   /estimated_length=20
FT   gap             17554979..17555114
FT                   /estimated_length=136
FT   gap             17558129..17558453
FT                   /estimated_length=325
FT   gap             17559502..17559521
FT                   /estimated_length=20
FT   gap             17567315..17567334
FT                   /estimated_length=20
FT   gap             17568072..17568091
FT                   /estimated_length=20
FT   gap             17570063..17570082
FT                   /estimated_length=20
FT   gap             17571171..17571190
FT                   /estimated_length=20
FT   gap             17574717..17574771
FT                   /estimated_length=55
FT   gap             17577426..17578728
FT                   /estimated_length=1303
FT   gap             17579626..17580691
FT                   /estimated_length=1066
FT   gap             17590026..17590404
FT                   /estimated_length=379
FT   gap             17649119..17649138
FT                   /estimated_length=20
FT   gap             17680434..17680453
FT                   /estimated_length=20
FT   gap             17690844..17691015
FT                   /estimated_length=172
FT   gap             17726700..17726879
FT                   /estimated_length=180
FT   gap             17734751..17735006
FT                   /estimated_length=256
FT   gap             17767265..17767284
FT                   /estimated_length=20
FT   gap             17820938..17820968
FT                   /estimated_length=31
FT   gene            <17821327..17855108
FT                   /locus_tag="mCG_145855"
FT                   /note="gene_id=mCG145855.0"
FT   mRNA            join(<17821327..17821367,17847912..17848303,
FT                   17849598..17849829,17853262..17855108)
FT                   /locus_tag="mCG_145855"
FT                   /product="mCG145855"
FT                   /note="gene_id=mCG145855.0 transcript_id=mCT185963.0
FT                   created on 03-JUL-2003"
FT   gene            complement(17834971..17993600)
FT                   /gene="Zfpn1a2"
FT                   /locus_tag="mCG_120348"
FT                   /note="gene_id=mCG120348.1"
FT   mRNA            complement(join(17834971..17835280,17849626..17849769,
FT                   17855998..17856135,17877891..17878058,17885179..17885445,
FT                   17990971..17991075,17991885..17991933,17993455..17993600))
FT                   /gene="Zfpn1a2"
FT                   /locus_tag="mCG_120348"
FT                   /product="zinc finger protein, subfamily 1A, 2 (Helios),
FT                   transcript variant mCT176041"
FT                   /note="gene_id=mCG120348.1 transcript_id=mCT176041.0
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(17835126..17835280,17849626..17849769,
FT                   17855998..17856135,17877891..17878058,17885179..17885445,
FT                   17990971..17991075,17991885..17991918))
FT                   /codon_start=1
FT                   /gene="Zfpn1a2"
FT                   /locus_tag="mCG_120348"
FT                   /product="zinc finger protein, subfamily 1A, 2 (Helios),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG120348.1 transcript_id=mCT176041.0
FT                   protein_id=mCP98962.0 isoform=CRA_b"
FT                   /protein_id="EDL00253.1"
FT                   /translation="METDAIDGYITCDNELSPEGEHANMAIDLTSSTPNGQHASPSHMT
FT                   STNSVKLEMQSDEECDRQPLSREDEIRGHDEGSSLEEPLIESSEVADNRKVQDLQGEGG
FT                   IRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHS
FT                   GEKPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSSLEEHKERCHNYL
FT                   QNVSMEAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTANMGKRKSSTP
FT                   QKFVGMRHRIYCHLDVHGFDLEIASVFQYGCWSHAYHRVLLVFYNLSKSSFFVLQ"
FT   mRNA            complement(join(17843365..17843610,17849626..17849769,
FT                   17855998..17856135,17877891..17878058,17885179..17885445,
FT                   17990971..17991075,17991885..17991933,17993455..17993600))
FT                   /gene="Zfpn1a2"
FT                   /locus_tag="mCG_120348"
FT                   /product="zinc finger protein, subfamily 1A, 2 (Helios),
FT                   transcript variant mCT121530"
FT                   /note="gene_id=mCG120348.1 transcript_id=mCT121530.1
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(17843579..17843610,17849626..17849769,
FT                   17855998..17856135,17877891..17878058,17885179..17885445,
FT                   17990971..17991075,17991885..17991918))
FT                   /codon_start=1
FT                   /gene="Zfpn1a2"
FT                   /locus_tag="mCG_120348"
FT                   /product="zinc finger protein, subfamily 1A, 2 (Helios),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG120348.1 transcript_id=mCT121530.1
FT                   protein_id=mCP74776.1 isoform=CRA_c"
FT                   /protein_id="EDL00254.1"
FT                   /translation="METDAIDGYITCDNELSPEGEHANMAIDLTSSTPNGQHASPSHMT
FT                   STNSVKLEMQSDEECDRQPLSREDEIRGHDEGSSLEEPLIESSEVADNRKVQDLQGEGG
FT                   IRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHS
FT                   GEKPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSSLEEHKERCHNYL
FT                   QNVSMEAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTANMGKRKSSTP
FT                   QKFVAAWHKIQKKK"
FT   mRNA            complement(join(17846077..17846890,17849626..17849769,
FT                   17855998..17856135,17877891..17878058,17885179..17885445,
FT                   17990971..17991075,17991885..17991933,17993455..17993600))
FT                   /gene="Zfpn1a2"
FT                   /locus_tag="mCG_120348"
FT                   /product="zinc finger protein, subfamily 1A, 2 (Helios),
FT                   transcript variant mCT176040"
FT                   /note="gene_id=mCG120348.1 transcript_id=mCT176040.0
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(17846166..17846890,17849626..17849769,
FT                   17855998..17856135,17877891..17878058,17885179..17885445,
FT                   17990971..17991075,17991885..17991918))
FT                   /codon_start=1
FT                   /gene="Zfpn1a2"
FT                   /locus_tag="mCG_120348"
FT                   /product="zinc finger protein, subfamily 1A, 2 (Helios),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG120348.1 transcript_id=mCT176040.0
FT                   protein_id=mCP98963.0 isoform=CRA_a"
FT                   /db_xref="GOA:P81183"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1342541"
FT                   /db_xref="UniProtKB/Swiss-Prot:P81183"
FT                   /protein_id="EDL00252.1"
FT                   /translation="METDAIDGYITCDNELSPEGEHANMAIDLTSSTPNGQHASPSHMT
FT                   STNSVKLEMQSDEECDRQPLSREDEIRGHDEGSSLEEPLIESSEVADNRKVQDLQGEGG
FT                   IRLPNGKLKCDVCGMVCIGPNVLMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHS
FT                   GEKPFKCPFCSYACRRRDALTGHLRTHSVGKPHKCNYCGRSYKQRSSLEEHKERCHNYL
FT                   QNVSMEAAGQVMSHHVPPMEDCKEQEPIMDNNISLVPFERPAVIEKLTANMGKRKSSTP
FT                   QKFVGEKLMRFSYPDIHFDMNLTYEKEAELMQSHMMDQAINNAITYLGAEALHPLMQHA
FT                   PSTIAEVAPVISSAYSQVYHPNRIERPISRETSDSHENNMDGPISLIRPKSRPQEREAS
FT                   PSNSCLDSTDSESSHDDRQSYQGNPALNPKRKQSPAYMKEDVKALDATKAPKGSLKDIY
FT                   KVFNGEGEQIRAFKCEHCRVLFLDHVMYTIHMGCHGYRDPLECNICGYRSQDRYEFSSH
FT                   IVRGEHTFH"
FT   CDS             join(<17848261..17848303,17849598..17849803)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145855"
FT                   /product="mCG145855"
FT                   /note="gene_id=mCG145855.0 transcript_id=mCT185963.0
FT                   protein_id=mCP107688.0"
FT                   /protein_id="EDL00251.1"
FT                   /translation="DLSNSGPPTRQHTPGSTHPSALLTHKLLRSGAFALSHICRELLYD
FT                   SRSLKRHQRNIVVHDRLLFLTIFHRRYYRKSYKKATW"
FT   gap             17891332..17891351
FT                   /estimated_length=20
FT   gap             17909057..17909076
FT                   /estimated_length=20
FT   gap             17916574..17916647
FT                   /estimated_length=74
FT   gap             17928683..17928702
FT                   /estimated_length=20
FT   gap             17966844..17966863
FT                   /estimated_length=20
FT   gap             17980843..17980862
FT                   /estimated_length=20
FT   gap             17993743..17993953
FT                   /estimated_length=211
FT   gap             17995284..17995387
FT                   /estimated_length=104
FT   gap             18004039..18004640
FT                   /estimated_length=602
FT   gap             18008136..18008455
FT                   /estimated_length=320
FT   gap             18048603..18048622
FT                   /estimated_length=20
FT   gap             18099460..18099622
FT                   /estimated_length=163
FT   gap             18100787..18100828
FT                   /estimated_length=42
FT   gene            <18135111..19031264
FT                   /gene="Spag16"
FT                   /locus_tag="mCG_120345"
FT                   /note="gene_id=mCG120345.1"
FT   mRNA            join(<18135111..18135180,18152397..18152492,
FT                   18161440..18161558,18166590..18166727,18178381..18178488,
FT                   18181251..18181368,18195611..18195677,18203343..18203387,
FT                   18204588..18204697,18305232..18305359,18570522..18570665,
FT                   18576919..18577014,18586442..18587661)
FT                   /gene="Spag16"
FT                   /locus_tag="mCG_120345"
FT                   /product="sperm associated antigen 16, transcript variant
FT                   mCT181338"
FT                   /note="gene_id=mCG120345.1 transcript_id=mCT181338.0
FT                   created on 21-MAR-2003"
FT   gap             18135181..18135200
FT                   /estimated_length=20
FT   gap             18145149..18145168
FT                   /estimated_length=20
FT   mRNA            join(<18151087..18151133,18152397..18152492,
FT                   18161440..18161558,18166590..18166727,18178381..18178488,
FT                   18181251..18181368,18195611..18195677,18203343..18203387,
FT                   18204588..18204697,18305232..18305359,18570522..18570665,
FT                   18572842..18573002)
FT                   /gene="Spag16"
FT                   /locus_tag="mCG_120345"
FT                   /product="sperm associated antigen 16, transcript variant
FT                   mCT181339"
FT                   /note="gene_id=mCG120345.1 transcript_id=mCT181339.0
FT                   created on 21-MAR-2003"
FT   CDS             join(<18151119..18151133,18152397..18152492,
FT                   18161440..18161558,18166590..18166727,18178381..18178488,
FT                   18181251..18181368,18195611..18195677,18203343..18203387,
FT                   18204588..18204697,18305232..18305359,18570522..18570665,
FT                   18572842..18572851)
FT                   /codon_start=1
FT                   /gene="Spag16"
FT                   /locus_tag="mCG_120345"
FT                   /product="sperm associated antigen 16, isoform CRA_c"
FT                   /note="gene_id=mCG120345.1 transcript_id=mCT181339.0
FT                   protein_id=mCP104261.0 isoform=CRA_c"
FT                   /protein_id="EDL00257.1"
FT                   /translation="CEYEEIPDDNFSIPEGEEDLEKAIHIIGEQARDIHILEQQTILPA
FT                   RNVMQEAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLL
FT                   ETENKNLKKELKHFKQAAEKAKEDLLRTQKERDFHRMHHKRIVQEKNKLIADLKGLKLH
FT                   YASYEPTIRVLHEKHHALLKEKMLTSLERDRAVGKISGLQATLKNIDMGHIQVPVIKGS
FT                   YESASITRESGDRAGHSCEKENSSEGPTQKSLREAREEVGYKSKLKNEKKDSEFPVDMQ
FT                   PDPNVTSCTENVSAAKFDYKLNNIFRLHELPVSCIVMHPCRDYLISCSEDRLWKMVGLP
FT                   QGNVLLTGSGHTDWLSGCCFHPSLT"
FT   CDS             join(<18152397..18152492,18161440..18161558,
FT                   18166590..18166727,18178381..18178488,18181251..18181368,
FT                   18195611..18195677,18203343..18203387,18204588..18204697,
FT                   18305232..18305359,18570522..18570665,18576919..18577014,
FT                   18586442..18586523)
FT                   /codon_start=1
FT                   /gene="Spag16"
FT                   /locus_tag="mCG_120345"
FT                   /product="sperm associated antigen 16, isoform CRA_b"
FT                   /note="gene_id=mCG120345.1 transcript_id=mCT181338.0
FT                   protein_id=mCP104260.0 isoform=CRA_b"
FT                   /protein_id="EDL00256.1"
FT                   /translation="IPDDNFSIPEGEEDLEKAIHIIGEQARDIHILEQQTILPARNVMQ
FT                   EAIEDFLCNFLIKMGMTRTLDCFQAEWYELIQKKGSDFKGLGNVPDVYSQVMLLETENK
FT                   NLKKELKHFKQAAEKAKEDLLRTQKERDFHRMHHKRIVQEKNKLIADLKGLKLHYASYE
FT                   PTIRVLHEKHHALLKEKMLTSLERDRAVGKISGLQATLKNIDMGHIQVPVIKGSYESAS
FT                   ITRESGDRAGHSCEKENSSEGPTQKSLREAREEVGYKSKLKNEKKDSEFPVDMQPDPNV
FT                   TSCTENVSAAKFDYKLNNIFRLHELPVSCIVMHPCRDYLISCSEDRLWKMVGLPQGNVL
FT                   LTGSGHTDWLSGCCFHPRLSLKLPGVLAGEAGPEDPPISFLPSPNCGQYRLGVFSQKAQ
FT                   AQRLASPIMQEINQQCS"
FT   gap             18225142..18225544
FT                   /estimated_length=403
FT   gap             18248840..18252096
FT                   /estimated_length=3257
FT   gap             18259078..18259097
FT                   /estimated_length=20
FT   mRNA            join(18259627..18259772,18305232..18305359,
FT                   18570522..18570665,18605233..18605418,18686946..18687072,
FT                   18766768..18766833,18799382..18799508,19030900..19031264)
FT                   /gene="Spag16"
FT                   /locus_tag="mCG_120345"
FT                   /product="sperm associated antigen 16, transcript variant
FT                   mCT121522"
FT                   /note="gene_id=mCG120345.1 transcript_id=mCT121522.1
FT                   created on 21-MAR-2003"
FT   gap             18272495..18274815
FT                   /estimated_length=2321
FT   gap             18292220..18293921
FT                   /estimated_length=1702
FT   gap             18303929..18303948
FT                   /estimated_length=20
FT   CDS             join(18305253..18305359,18570522..18570665,
FT                   18605233..18605418,18686946..18687072,18766768..18766833,
FT                   18799382..18799508,19030900..19031075)
FT                   /codon_start=1
FT                   /gene="Spag16"
FT                   /locus_tag="mCG_120345"
FT                   /product="sperm associated antigen 16, isoform CRA_a"
FT                   /note="gene_id=mCG120345.1 transcript_id=mCT121522.1
FT                   protein_id=mCP74754.1 isoform=CRA_a"
FT                   /protein_id="EDL00255.1"
FT                   /translation="MQPDPNVTSCTENVSAAKFDYKLNNIFRLHELPVSCIVMHPCRDY
FT                   LISCSEDRLWKMVGLPQGNVLLTGSGHTDWLSGCCFHPSGSKLATSSGDSTIKLWDLNK
FT                   GECTLTLEGHNHAVWSCTWHSCGDFVASASLDMTSKIWDVNSERCRYTLYGHTDSVNSI
FT                   EFFPFSNILLTASADKTLSVWDARTGKCEQSLYGHMHSVNDATFTPRGHIIASCDARGV
FT                   TKLWDFRKLIPIVSIDVGPSSGNEVNFDQSGRVLAQASANGIIHLLDLKSGQIHKLVGH
FT                   ESEVHSVVFSHLGENLYSGGSDGTIRLWI"
FT   gap             18374897..18374916
FT                   /estimated_length=20
FT   gap             18424220..18424239
FT                   /estimated_length=20
FT   gap             18430509..18431092
FT                   /estimated_length=584
FT   gap             18470943..18470962
FT                   /estimated_length=20
FT   gap             18477512..18477720
FT                   /estimated_length=209
FT   gap             18478916..18479227
FT                   /estimated_length=312
FT   gap             18510528..18510547
FT                   /estimated_length=20
FT   gap             18513875..18514387
FT                   /estimated_length=513
FT   gap             18516290..18519885
FT                   /estimated_length=3596
FT   gap             18572356..18572520
FT                   /estimated_length=165
FT   gap             18620113..18620134
FT                   /estimated_length=22
FT   gap             18682049..18682086
FT                   /estimated_length=38
FT   gap             18687338..18687357
FT                   /estimated_length=20
FT   gap             18688742..18688872
FT                   /estimated_length=131
FT   gap             18690795..18690927
FT                   /estimated_length=133
FT   gap             18706609..18706628
FT                   /estimated_length=20
FT   gap             18760932..18760951
FT                   /estimated_length=20
FT   gap             18762754..18764049
FT                   /estimated_length=1296
FT   gap             18775331..18775350
FT                   /estimated_length=20
FT   gap             18838160..18838179
FT                   /estimated_length=20
FT   gap             18850718..18854141
FT                   /estimated_length=3424
FT   gap             18863188..18863207
FT                   /estimated_length=20
FT   gap             18866648..18866667
FT                   /estimated_length=20
FT   gap             18893054..18893494
FT                   /estimated_length=441
FT   gap             18910874..18910893
FT                   /estimated_length=20
FT   gap             18911970..18911989
FT                   /estimated_length=20
FT   gap             18917762..18917781
FT                   /estimated_length=20
FT   gap             18921718..18921779
FT                   /estimated_length=62
FT   gap             18935815..18940446
FT                   /estimated_length=4632
FT   gap             18946125..18946269
FT                   /estimated_length=145
FT   gap             18955733..18955833
FT                   /estimated_length=101
FT   gap             18981542..18981561
FT                   /estimated_length=20
FT   gap             19016562..19016648
FT                   /estimated_length=87
FT   gap             19020488..19020711
FT                   /estimated_length=224
FT   gene            19032055..19188559
FT                   /gene="A830006F12Rik"
FT                   /locus_tag="mCG_1035562"
FT                   /note="gene_id=mCG1035562.1"
FT   mRNA            join(19032055..19032182,19032386..19032571,
FT                   19034832..19035011,19035153..19035301,19057070..19057199,
FT                   19188135..19188559)
FT                   /gene="A830006F12Rik"
FT                   /locus_tag="mCG_1035562"
FT                   /product="RIKEN cDNA A830006F12"
FT                   /note="gene_id=mCG1035562.1 transcript_id=mCT153266.1
FT                   created on 02-APR-2003"
FT   CDS             join(19034912..19035011,19035153..19035301,
FT                   19057070..19057199,19188135..19188283)
FT                   /codon_start=1
FT                   /gene="A830006F12Rik"
FT                   /locus_tag="mCG_1035562"
FT                   /product="RIKEN cDNA A830006F12"
FT                   /note="gene_id=mCG1035562.1 transcript_id=mCT153266.1
FT                   protein_id=mCP74767.1"
FT                   /protein_id="EDL00258.1"
FT                   /translation="MALHIHEACILLLVIPGLVTSAAISHEDYPADEDGPVCDQPECPK
FT                   IHPKCTKVEHNGCCPECKEVKNFCEYHGKNYKILEEFKPSPCEWCRCEPSNEVHCVVAD
FT                   CAVPECVNPIYEPEQCCPVCKNGPNCFAGTTIIPAGIEVKVDDCNICHCHNGDWWKPAQ
FT                   CSKRECQGKQTV"
FT   gap             19088028..19088218
FT                   /estimated_length=191
FT   gap             19112601..19112677
FT                   /estimated_length=77
FT   gap             19123345..19123873
FT                   /estimated_length=529
FT   gap             19150728..19151004
FT                   /estimated_length=277
FT   gap             19167789..19167892
FT                   /estimated_length=104
FT   gap             19176714..19176861
FT                   /estimated_length=148
FT   gap             19179374..19180581
FT                   /estimated_length=1208
FT   gap             19197294..19197320
FT                   /estimated_length=27
FT   gap             19210116..19210198
FT                   /estimated_length=83
FT   gap             19217759..19217778
FT                   /estimated_length=20
FT   gap             19246693..19247252
FT                   /estimated_length=560
FT   gap             19255196..19256037
FT                   /estimated_length=842
FT   gap             19272959..19272978
FT                   /estimated_length=20
FT   gap             19281274..19281293
FT                   /estimated_length=20
FT   gap             19323650..19323819
FT                   /estimated_length=170
FT   gap             19336127..19336146
FT                   /estimated_length=20
FT   gene            complement(19336912..>19409433)
FT                   /gene="Bard1"
FT                   /locus_tag="mCG_120093"
FT                   /note="gene_id=mCG120093.1"
FT   mRNA            complement(join(19336912..19337402,19337909..19338006,
FT                   19353228..19353320,19354190..19354322,19360163..19360271,
FT                   19372029..19372201,19373658..19373738,19381093..19382030,
FT                   19394135..19394277,19395497..19395553,19408694..>19408944))
FT                   /gene="Bard1"
FT                   /locus_tag="mCG_120093"
FT                   /product="BRCA1 associated RING domain 1, transcript
FT                   variant mCT121274"
FT                   /note="gene_id=mCG120093.1 transcript_id=mCT121274.0
FT                   created on 18-JUL-2002"
FT   CDS             complement(join(19337070..19337402,19337909..19338006,
FT                   19353228..19353320,19354190..19354322,19360163..19360271,
FT                   19372029..19372201,19373658..19373738,19381093..19382030,
FT                   19394135..19394277,19395497..19395553,19408694..>19408863))
FT                   /codon_start=1
FT                   /gene="Bard1"
FT                   /locus_tag="mCG_120093"
FT                   /product="BRCA1 associated RING domain 1, isoform CRA_a"
FT                   /note="gene_id=mCG120093.1 transcript_id=mCT121274.0
FT                   protein_id=mCP74845.0 isoform=CRA_a"
FT                   /protein_id="EDL00259.1"
FT                   /translation="SKPDLPSSVGMPRRPPRVCSGNQPAPVPAMEPATDGLWAHSRAAL
FT                   ARLEKLLRCSRCANILKEPVCLGGCEHIFCSGCISDCVGSGCPVCYTPAWILDLKINRQ
FT                   LDSMIQLSSKLQNLLHDNKDSKDNTSRASLFGDAERKKNSIKMWFSPRSKKVRYVVTKV
FT                   SVQTQPQKAKDDKAQEASMYEFVSATPPVAVPKSAKTASRTSAKKHPKKSVAKINREEN
FT                   LRPETKDSRFDSKEELKEEKVVSCSQIPVMERPRVNGEIDLLASGSVVEPECSGSLTEV
FT                   SLPLAEHIVSPDTVSKNEETPEKKVCVKDLRSGGSNGNRKGCHRPTTSTSDSCGSNIPS
FT                   TSRGIGEPALLAENVVLVDCSSLPSGQLQVDVTLRRKSNASDDPLSLSPGTPPPLLNNS
FT                   THRQMMSSPSTVKLSSGMPARKRNHRGETLLHIASIKGDIPSVEYLLQNGNDPNVKDHA
FT                   GWTPLHEACSHGHLKVVELLLQHNALVNTPGYQNDSPLHDAVKSGHIDIVKVLLSHGAS
FT                   RNAVNIFGVRPVDYTDNENIRSLLLLPEENESFSTSQCSIVNTGQRKNGPLVFIGSGLS
FT                   SQQQKMLSKLETVLKAKKCMEFDSTVTHVIVPDEEAQSTLKCMLGILSGCWILKFDWVK
FT                   ACLDSKVREQEEKYEVPGGPQRSRLNREQLLPKLFDGCYFFLGGNFKHHPRDDLLKLIA
FT                   AAGGKVLSRKPKPDSDVTQTINTVAYHAKPESDQRFCTQYIVYEDLFNCHPERVRQGKV
FT                   WMAPSTWLISCIMAFELLPLDS"
FT   gap             19390525..19390544
FT                   /estimated_length=20
FT   mRNA            complement(19408323..>19409433)
FT                   /gene="Bard1"
FT                   /locus_tag="mCG_120093"
FT                   /product="BRCA1 associated RING domain 1, transcript
FT                   variant mCT170705"
FT                   /note="gene_id=mCG120093.1 transcript_id=mCT170705.0
FT                   created on 18-JUL-2002"
FT   CDS             complement(19408599..>19408883)
FT                   /codon_start=1
FT                   /gene="Bard1"
FT                   /locus_tag="mCG_120093"
FT                   /product="BRCA1 associated RING domain 1, isoform CRA_b"
FT                   /note="gene_id=mCG120093.1 transcript_id=mCT170705.0
FT                   protein_id=mCP93623.0 isoform=CRA_b"
FT                   /protein_id="EDL00260.1"
FT                   /translation="PAGCGARANLTSPPLWECHAGRRGSALGTSLLPCPPWSRLPTGFG
FT                   PTAARRLPAWRSCCAAPAGKDRPGDLVSSVPPCPTPEFSEWLPSHLQRR"
FT   gap             19469772..19470313
FT                   /estimated_length=542
FT   gap             19473685..19473704
FT                   /estimated_length=20
FT   gap             19517487..19517513
FT                   /estimated_length=27
FT   gene            complement(19549226..19642091)
FT                   /locus_tag="mCG_120094"
FT                   /note="gene_id=mCG120094.1"
FT   mRNA            complement(join(19549226..19549540,19550868..19551005,
FT                   19553268..19553373,19554481..19554573,19555991..19556094,
FT                   19564231..19564365,19565498..19565639,19565929..19566038,
FT                   19566921..19567125,19569552..19569805,19570864..19571023,
FT                   19572002..19572117,19573569..19573746,19574322..19574376,
FT                   19578504..19578609,19580553..19580640,19582211..19582338,
FT                   19584952..19585045,19586481..19586733,19588942..19589092,
FT                   19590089..19590325,19591722..19591882,19592603..19592799,
FT                   19594682..19594900,19597554..19597740,19598636..19598791,
FT                   19599823..19599892,19600949..19601278,19607142..19607256,
FT                   19608853..19609168,19609688..19609867,19613258..19613348,
FT                   19615990..19616109,19618783..19618922,19620181..19620450,
FT                   19620700..19620864,19623318..19623495,19626095..19626216,
FT                   19627622..19627734,19627817..19628073,19635495..19635601,
FT                   19636578..19636696,19642024..19642091))
FT                   /locus_tag="mCG_120094"
FT                   /product="mCG120094"
FT                   /note="gene_id=mCG120094.1 transcript_id=mCT121275.1
FT                   created on 20-NOV-2002"
FT   CDS             complement(join(19549433..19549540,19550868..19551005,
FT                   19553268..19553373,19554481..19554573,19555991..19556094,
FT                   19564231..19564365,19565498..19565639,19565929..19566038,
FT                   19566921..19567125,19569552..19569805,19570864..19571023,
FT                   19572002..19572117,19573569..19573746,19574322..19574376,
FT                   19578504..19578609,19580553..19580640,19582211..19582338,
FT                   19584952..19585045,19586481..19586733,19588942..19589092,
FT                   19590089..19590325,19591722..19591882,19592603..19592799,
FT                   19594682..19594900,19597554..19597740,19598636..19598791,
FT                   19599823..19599892,19600949..19601278,19607142..19607256,
FT                   19608853..19609168,19609688..19609867,19613258..19613348,
FT                   19615990..19616109,19618783..19618922,19620181..19620450,
FT                   19620700..19620864,19623318..19623495,19626095..19626216,
FT                   19627622..19627734,19627817..19628073,19635495..19635601,
FT                   19636578..19636608))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120094"
FT                   /product="mCG120094"
FT                   /note="gene_id=mCG120094.1 transcript_id=mCT121275.1
FT                   protein_id=mCP74857.1"
FT                   /protein_id="EDL00261.1"
FT                   /translation="MTDNLAKGSPDNLKLLQSTIHFRKSFLQNGSSEDSFPPFLEILKS
FT                   KLSQLRNLTELLCESETFSSIKKSCQFSNMSFERLCEDHAFHVQLIEAAELGTDLTTGL
FT                   LYHDNIISAKLRGLLTGDPSKINLNVDWLLEQALQMNYLENITRLIPTVEAMLHVNTSA
FT                   DASEKPGQLREMFKNIDLLKEDLRAIGMSNTSIDKLLAIPIPDNRAEIISRVFWLHSCD
FT                   TNVTNPKLEDAMKEFCKLPLPERSHQSYLIGLTLLHYLDIYNFTYKASVFPKEGSKANG
FT                   KDDGAFHKAERDSQSVGFRHTSTAGQNEIPETNAPAQECSINTARVAQVASGNINNFLD
FT                   IVSQAMYRNTRMNSPAGSFSTISQALCSQGITTEYLTAMLPSSQKPKGNHTKDFLTYKL
FT                   TKEEIASKYGIPLNATPFCFSLYKDIINMPAGPVIWAFLKPMLLGKILYSPYNPTTKAI
FT                   MEKSNVTLRQLAELREKSQEWMDKSPIFMNSFHLLNQTIPMLQNTLRNPFVQVFVKFSV
FT                   GLDAVELLKQIDDLDVLRLKLVNNIDIIDQLNTLSSLTVNISSCVLYDRIQASDTVEEM
FT                   ETVAEQLYKSNELFGSVIFKLPSNGSLHRGFDPEKVSLPPIVRYTIRMSLKTAQTTRSI
FT                   RTKIWAPGPHNSPSHNQIYGRAFIYLQDSIERAIIELQTGRNSQEVAVQVQAVPYPCFM
FT                   KDNFLTSVSYSLPIVLMVAWVVFIAAFVKKLVYEKDLRLHEYMKMMGVNSCSHFFAWLI
FT                   ESIGFLLVTIAILIVILKFGNILPKTNGFILFLYFSDYSFSVIAMSYLISVFFNNTNIA
FT                   ALIGSLIYVIAFFPFIVLVTVEDELSYVIKVFMSLLSPTAFSYASQYIARYEEQGVGTY
FT                   GMAAPWYFPILPSYWKERFGCAEVKHEKSNGLMFTNIMMQNTNPSASKTSPDCAFPSNI
FT                   EPEPKDLQVGVALHGVTKIYGSKTAVENLNLNFYEGHITSLLGPNGAGKTTTISMLTGL
FT                   FGATAGTIFVYGKDIKTDLNTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKT
FT                   QLHEEVKRTLKDTGLYSHRHKRVGTLSGGMKRKLSISIALIGGSRVVILDEPSTGVDPC
FT                   SRRSIWDVISKNKTARTIILSTHHLDEAEVLSDRIAFLEQGGLRCCGSPFYLKEAFGDG
FT                   YHLTLTKKKSPNLDTNAICDTVAVTAMIQSHLPEAYLKEDIGGELVYVLPPFSTKVSGA
FT                   YLSLLRALDKGMGKLNIGCYGISDTTVEEVFLNLTKDSQKSSNMSLEHLTQRKVGNPSA
FT                   NGTSTPDDLSVSSSNFTDRDDKVLTRSEKLEGFGLLLKKIMAILIKRFHHTRRNWKGLI
FT                   AQVILPIVFVATAMGLGTLRDSSNSYPEIMISPSIYGTSEQTAFYAQCLKKDDLGKWNT
FT                   SGEAIDNFGVCSCSDNVQECPKFNYHPPHRRTYSSQVIYNLTGKHMENYLITTANHFVQ
FT                   KRYGGWSFGMKLTNDLRFDVTAVPDNRTLAKVWYDPEGYHSLPAYLNSLNNFLLRVNMS
FT                   EYDAARHGIIMYSHPYPGVQDQEQATISSLIDILVALSILMGYSVTTASFVTYIVREHQ
FT                   TKAKQLQHISGIGVTCYWVTNFIYDMVFYLVPVAFSIGVIAIFKLPAFYSGNNLGAVSL
FT                   LLLLFGYATFSWMYLLAGLFHETGMAFITYVCVNLFFGINSIVSLSVVYFLSKEKPNDP
FT                   TLELISETLKRIFLIFPQFCFGYGLIELSQQQAVLDFLKAYGVEYPSETFEMDKLGAMF
FT                   VALVSQGTMFFLLRLLINEWLIKKLRLFFRKFTSSPIMETVDEDEDVRAERFRVESGAA
FT                   EFDLVQLHRLTKTYQLIHKKIIAVNNISLGIPAGECFGLLGVNGAGKTTIFKMLTGDII
FT                   PSSGNILIRNKSGSLGHVDSHSSLVGYCPQEDALDDLVTVEEHLYFYARVHGIPEKDIK
FT                   DTVHKLLRRLHLMAYKDRSTSMCSYGTKRKLSTALALIGKPSILLLDEPSSGMDPKSKR
FT                   HLWRIISEEVQNKCSVILTSHSMEECEALCTRLAIMVNGRFQCIGSLQHIKSRFGRGFT
FT                   VKVHLKNNKVSMETLTKFMQLHFPKTYLKDQHLSMLEYHVPVTAGGVANIFDLLETNKT
FT                   ALNITNFLVSQTTLEEVFINFAKDQKSYENVDTSSQGSTISVDSQEDQLDS"
FT   gap             19558243..19562857
FT                   /estimated_length=4615
FT   gap             19595507..19595902
FT                   /estimated_length=396
FT   gap             19632969..19633350
FT                   /estimated_length=382
FT   gap             19647833..19647852
FT                   /estimated_length=20
FT   gene            complement(19668102..19721279)
FT                   /locus_tag="mCG_120095"
FT                   /note="gene_id=mCG120095.1"
FT   mRNA            complement(join(19668102..19669114,19708051..19708144,
FT                   19720897..19721279))
FT                   /locus_tag="mCG_120095"
FT                   /product="mCG120095"
FT                   /note="gene_id=mCG120095.1 transcript_id=mCT121276.0
FT                   created on 10-SEP-2002"
FT   CDS             complement(join(19668957..19669114,19708051..19708144,
FT                   19720897..19720965))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120095"
FT                   /product="mCG120095"
FT                   /note="gene_id=mCG120095.1 transcript_id=mCT121276.0
FT                   protein_id=mCP74440.1"
FT                   /protein_id="EDL00262.1"
FT                   /translation="MASQFHQLRILVWKNWLGVKRQPLWTLVLILWPVIIFIILAITRT
FT                   KFPPTAKPTCYLAPRNLPSAGFFPFLQTLLCDTDSKCKDTPYGPRDLLRRKGIDGPLFK
FT                   ER"
FT   gap             19679249..19679322
FT                   /estimated_length=74
FT   gap             19705076..19705242
FT                   /estimated_length=167
FT   gap             19720695..19720781
FT                   /estimated_length=87
FT   gap             19728475..19728494
FT                   /estimated_length=20
FT   gap             19757800..19758180
FT                   /estimated_length=381
FT   gap             19768921..19770698
FT                   /estimated_length=1778
FT   gap             19775107..19775126
FT                   /estimated_length=20
FT   gene            complement(19799619..>19800111)
FT                   /locus_tag="mCG_120092"
FT                   /note="gene_id=mCG120092.1"
FT   mRNA            complement(19799619..>19800111)
FT                   /locus_tag="mCG_120092"
FT                   /product="mCG120092"
FT                   /note="gene_id=mCG120092.1 transcript_id=mCT121273.1
FT                   created on 18-JUL-2002"
FT   CDS             complement(19799633..>19800103)
FT                   /codon_start=1
FT                   /locus_tag="mCG_120092"
FT                   /product="mCG120092"
FT                   /note="gene_id=mCG120092.1 transcript_id=mCT121273.1
FT                   protein_id=mCP74663.1"
FT                   /protein_id="EDL00263.1"
FT                   /translation="GLHRNMAEVGSKSVLFVCLGNICRSPIAEAGFRKLVTDEKVSGNW
FT                   AIDSSAVSDWNVGRPPDPRAVSCLRNRGISTAHKARQITKEDFENNLRDLNRKSNQVKN
FT                   CKAKIELFGSYDPQKQLIIEDPHMAMTLTSRWCTSNALGAARPSWRSLTSWS"
FT   gap             19840169..19841728
FT                   /estimated_length=1560
FT   gap             19845058..19845228
FT                   /estimated_length=171
FT   gene            19862861..19885490
FT                   /gene="Atic"
FT                   /locus_tag="mCG_121784"
FT                   /note="gene_id=mCG121784.1"
FT   mRNA            join(19862861..19862973,19863196..19863322,
FT                   19864925..19865001,19866588..19866654,19869458..19869546,
FT                   19870105..19870256,19870510..19870666,19873513..19873638,
FT                   19874676..19874783,19875553..19875638,19876553..19876642,
FT                   19878621..19878749,19881754..19881846,19882330..19882512,
FT                   19883499..19883654,19884349..19884628,19884820..19885490)
FT                   /gene="Atic"
FT                   /locus_tag="mCG_121784"
FT                   /product="5-aminoimidazole-4-carboxamide ribonucleotide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /note="gene_id=mCG121784.1 transcript_id=mCT122996.1
FT                   created on 10-SEP-2002"
FT   CDS             join(19862955..19862973,19863196..19863322,
FT                   19864925..19865001,19866588..19866654,19869458..19869546,
FT                   19870105..19870256,19870510..19870666,19873513..19873638,
FT                   19874676..19874783,19875553..19875638,19876553..19876642,
FT                   19878621..19878749,19881754..19881846,19882330..19882512,
FT                   19883499..19883654,19884349..19884468)
FT                   /codon_start=1
FT                   /gene="Atic"
FT                   /locus_tag="mCG_121784"
FT                   /product="5-aminoimidazole-4-carboxamide ribonucleotide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /note="gene_id=mCG121784.1 transcript_id=mCT122996.1
FT                   protein_id=mCP74453.1"
FT                   /protein_id="EDL00264.1"
FT                   /translation="MAPSQLALFSVSDKTGLVEFARSLASLGLSLVASGGTAKAIRDAG
FT                   LAVRDVSELTGFPEMLGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLVRVVVCNLY
FT                   PFVKTVASPDVTVEAAVEQIDIGGVTLLRAAAKNHARVTVVCEPEDYAGVAAEMHGSDS
FT                   KDTSLETRRHLALKAFTHTAQYDEAISDYFRKQYSKGISQMPLRYGMNPHQTPAQLYTL
FT                   KPKLPITVLNGAPGFINLCDALNAWQLVTELRGAVDIPAAASFKHVSPAGAAVGVPLSE
FT                   DEARVCMVYDLYPTLTPLAVAYARARGADRMSSFGDFVALSDICDVPTAKIISREVSDG
FT                   IVAPGYEEEALKILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSL
FT                   FSNIVTKNKDLPESALRDLIVATVAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLA
FT                   GDKANSWWLRHHPRVLSMKFKAGVKRAEISNAIDQYVTGTIGEGEDLVKWEALFEEVPE
FT                   LLTEAEKKEWVDKLSGVSVSSDAFFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACD
FT                   ELGIVLAHTDLRLFHH"
FT   gap             19874250..19874269
FT                   /estimated_length=20
FT   gap             19883951..19884072
FT                   /estimated_length=122
FT   gap             19884629..19884819
FT                   /estimated_length=191
FT   gene            complement(19891378..19959354)
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /note="gene_id=mCG121782.1"
FT   mRNA            complement(join(19891378..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19898932..19899096,
FT                   19901525..19901663,19903142..19903608,19904235..19904324,
FT                   19905076..19905255,19905464..19905553,19906151..19906327,
FT                   19907062..19907149,19908171..19908358,19910831..19910944,
FT                   19911746..19911901,19912564..19912728,19913769..19913885,
FT                   19915278..19915547,19916794..19916883,19918333..19918515,
FT                   19921225..19921416,19924444..19924530,19925249..19925417,
FT                   19926590..19926684,19929943..19930209,19931839..19932111,
FT                   19933027..19933221,19933921..19934010,19934272..19934400,
FT                   19935180..19935356,19935530..19935707,19938066..19938187,
FT                   19943291..19943434,19944496..19944624,19946475..19946627,
FT                   19947335..19947511,19948135..19948314,19949143..19949334,
FT                   19951730..19951885,19954192..19954329,19955377..19955508,
FT                   19956745..19956882,19957704..19957832,19959014..19959354))
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, transcript variant mCT176044"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT176044.0
FT                   created on 21-NOV-2002"
FT   mRNA            complement(join(19891378..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19898932..19899096,
FT                   19901525..19901663,19903142..19903608,19904235..19904324,
FT                   19905076..19905255,19905464..19905553,19906151..19906327,
FT                   19907062..19907149,19908171..19908358,19909521..19909790,
FT                   19910831..19910944,19911746..19911901,19912564..19912728,
FT                   19913769..19913885,19915278..19915547,19916794..19916883,
FT                   19918333..19918515,19921225..19921416,19924444..19924530,
FT                   19925249..19925417,19926590..19926684,19929943..19930209,
FT                   19931839..19932111,19933027..19933221,19933921..19934010,
FT                   19934272..19934400,19935180..19935356,19935530..19935707,
FT                   19938066..19938187,19943291..19943434,19944496..19944624,
FT                   19946475..19946627,19947335..19947511,19948135..19948314,
FT                   19949143..19949334,19951730..19951885,19954192..19954329,
FT                   19955377..19955508,19956745..19956882,19957704..19957832,
FT                   19959014..19959354))
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, transcript variant mCT176045"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT176045.0
FT                   created on 21-NOV-2002"
FT   mRNA            complement(join(19891378..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19898932..19899096,
FT                   19901525..19901663,19903142..19903608,19904235..19904324,
FT                   19905076..19905255,19905464..19905553,19906151..19906327,
FT                   19907062..19907149,19908171..19908358,19910831..19910944,
FT                   19911746..19911901,19912564..19912728,19913769..19913885,
FT                   19915278..19915547,19916794..19916883,19918333..19918515,
FT                   19919628..19919900,19921225..19921416,19924444..19924530,
FT                   19925249..19925417,19926590..19926684,19929943..19930209,
FT                   19931839..19932111,19933027..19933221,19933921..19934010,
FT                   19934272..19934400,19935180..19935356,19935530..19935707,
FT                   19938066..19938187,19943291..19943434,19944496..19944624,
FT                   19946475..19946627,19947335..19947511,19948135..19948314,
FT                   19949143..19949334,19951730..19951885,19954192..19954329,
FT                   19955377..19955508,19956745..19956882,19957704..19957832,
FT                   19959014..19959354))
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, transcript variant mCT176043"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT176043.0
FT                   created on 21-NOV-2002"
FT   mRNA            complement(join(19891378..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19901525..19901663,
FT                   19903142..19903248,19904235..19904324,19905076..19905255,
FT                   19905464..19905553,19906151..19906327,19907062..19907149,
FT                   19908171..19908358,19909521..19909790,19910831..19910944,
FT                   19911746..19911901,19912564..19912728,19913769..19913885,
FT                   19915278..19915547,19916794..19916883,19918333..19918515,
FT                   19919628..19919900,19921225..19921416,19924444..19924530,
FT                   19925249..19925417,19926590..19926684,19929943..19930209,
FT                   19931839..19932111,19933027..19933221,19933921..19934010,
FT                   19934272..19934400,19935180..19935356,19935530..19935707,
FT                   19938066..19938187,19943291..19943434,19944496..19944624,
FT                   19946475..19946627,19947335..19947511,19948135..19948314,
FT                   19949143..19949334,19951730..19951885,19954192..19954329,
FT                   19955377..19955508,19956745..19956882,19957704..19957832,
FT                   19959014..19959354))
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, transcript variant mCT176046"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT176046.0
FT                   created on 21-NOV-2002"
FT   mRNA            complement(join(19891378..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19898932..19899096,
FT                   19901525..19901663,19903142..19903608,19904235..19904324,
FT                   19905076..19905255,19905464..19905553,19906151..19906327,
FT                   19907062..19907149,19908171..19908358,19909521..19909790,
FT                   19910831..19910944,19911746..19911901,19912564..19912728,
FT                   19913769..19913885,19915278..19915547,19916794..19916883,
FT                   19918333..19918515,19919628..19919900,19921225..19921416,
FT                   19924444..19924530,19925249..19925417,19926590..19926684,
FT                   19929943..19930209,19931839..19932111,19933027..19933221,
FT                   19933921..19934010,19934272..19934400,19935180..19935356,
FT                   19935530..19935707,19938066..19938187,19943291..19943434,
FT                   19944496..19944624,19946475..19946627,19947335..19947511,
FT                   19948135..19948314,19949143..19949334,19951730..19951885,
FT                   19954192..19954329,19955377..19955508,19956745..19956882,
FT                   19957704..19957832,19959014..19959354))
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, transcript variant mCT122994"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT122994.0
FT                   created on 21-NOV-2002"
FT   CDS             complement(join(19892073..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19898932..19899096,
FT                   19901525..19901663,19903142..19903608,19904235..19904324,
FT                   19905076..19905255,19905464..19905553,19906151..19906327,
FT                   19907062..19907149,19908171..19908358,19910831..19910944,
FT                   19911746..19911901,19912564..19912728,19913769..19913885,
FT                   19915278..19915547,19916794..19916883,19918333..19918515,
FT                   19921225..19921416,19924444..19924530,19925249..19925417,
FT                   19926590..19926684,19929943..19930209,19931839..19932111,
FT                   19933027..19933221,19933921..19934010,19934272..19934400,
FT                   19935180..19935356,19935530..19935707,19938066..19938187,
FT                   19943291..19943434,19944496..19944624,19946475..19946627,
FT                   19947335..19947511,19948135..19948314,19949143..19949334,
FT                   19951730..19951885,19954192..19954329,19955377..19955508,
FT                   19956745..19956882,19957704..19957832,19959014..19959164))
FT                   /codon_start=1
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, isoform CRA_c"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT176044.0
FT                   protein_id=mCP98967.0 isoform=CRA_c"
FT                   /protein_id="EDL00267.1"
FT                   /translation="MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVA
FT                   VSQSKPGCFDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTG
FT                   NTYKVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGG
FT                   YMLECLCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNG
FT                   RITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASA
FT                   GSGSFTDVRTAIYQPQTHPQPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGV
FT                   SCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYS
FT                   FCTDHAVLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKF
FT                   GFCPMAAHEEICTTNEGVMYRIGDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQ
FT                   CIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSW
FT                   EKFVHGVRYQCYCYGRGIGEWHCQPLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEP
FT                   SHITKYILRWRPKTSTGRWKEATIPGHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTR
FT                   FDFTTSASTPVTSNTVTGETAPYSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEY
FT                   ELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDA
FT                   PPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQP
FT                   GVQYNITIYAVEENQESTPVFIQQETTGTPRSDNVPPPTDLQFVELTDVKVTIMWTPPD
FT                   SVVSGYRVEVLPVSLPGEHGQRLPVNRNTFAEITGLSPGVTYLFKVFAVHQGRESNPLT
FT                   AQQTTKLDAPTNLQFVNETDRTVLVTWTPPRARIAGYRLTAGLTRGGQPKQYNVGPLAS
FT                   KYPLRNLQPGSEYTVTLVAVKGNQQSPKATGVFTTLQPLRSIPPYNTEVTETTIVITWT
FT                   PAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYTYTIQVLRDGQERDAPIV
FT                   NRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGTSLEEVVH
FT                   ADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISDTVVPAVPPPTDLRFTNIGPDTMRV
FT                   TWAPPPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQ
FT                   HESIPLRGRQKTGLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQ
FT                   DRVPPSRNSITLTNLNPGTEYVVSIIAVNGREESPPLIGQQATVSDIPRDLEVIASTPT
FT                   SLLISWEPPAVSVRYYRITYGETGGNSPVQEFTVPGSKSTATINNIKPGADYTITLYAV
FT                   TGRGDSPASSKPVSINYKTEIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTTPKN
FT                   GLGPSKTKTASPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTTIPAPTNLK
FT                   FSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINLSPDSSSVIVSGLMVATKY
FT                   EVSVYALKDTLTSRPAQGVITTLENVSPPRRARVTDATETTITISWRTKTETITGFQVD
FT                   AIPANGQTPVQRSISPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVIIDASTAIDAP
FT                   SNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEP
FT                   GTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFIT
FT                   NPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPVRLRPRPYLPNVDEE
FT                   VQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESSEYIISCQPVGTD
FT                   EEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEGLNQP
FT                   TDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKI
FT                   GEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSC
FT                   TCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFMPLDV
FT                   QADRDDSRE"
FT   CDS             complement(join(19892073..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19898932..19899096,
FT                   19901525..19901663,19903142..19903608,19904235..19904324,
FT                   19905076..19905255,19905464..19905553,19906151..19906327,
FT                   19907062..19907149,19908171..19908358,19909521..19909790,
FT                   19910831..19910944,19911746..19911901,19912564..19912728,
FT                   19913769..19913885,19915278..19915547,19916794..19916883,
FT                   19918333..19918515,19921225..19921416,19924444..19924530,
FT                   19925249..19925417,19926590..19926684,19929943..19930209,
FT                   19931839..19932111,19933027..19933221,19933921..19934010,
FT                   19934272..19934400,19935180..19935356,19935530..19935707,
FT                   19938066..19938187,19943291..19943434,19944496..19944624,
FT                   19946475..19946627,19947335..19947511,19948135..19948314,
FT                   19949143..19949334,19951730..19951885,19954192..19954329,
FT                   19955377..19955508,19956745..19956882,19957704..19957832,
FT                   19959014..19959164))
FT                   /codon_start=1
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, isoform CRA_d"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT176045.0
FT                   protein_id=mCP98965.0 isoform=CRA_d"
FT                   /protein_id="EDL00268.1"
FT                   /translation="MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVA
FT                   VSQSKPGCFDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTG
FT                   NTYKVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGG
FT                   YMLECLCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNG
FT                   RITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASA
FT                   GSGSFTDVRTAIYQPQTHPQPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGV
FT                   SCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYS
FT                   FCTDHAVLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKF
FT                   GFCPMAAHEEICTTNEGVMYRIGDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQ
FT                   CIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSW
FT                   EKFVHGVRYQCYCYGRGIGEWHCQPLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEP
FT                   SHITKYILRWRPKTSTGRWKEATIPGHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTR
FT                   FDFTTSASTPVTSNTVTGETAPYSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEY
FT                   ELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDA
FT                   PPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQP
FT                   GVQYNITIYAVEENQESTPVFIQQETTGTPRSDNVPPPTDLQFVELTDVKVTIMWTPPD
FT                   SVVSGYRVEVLPVSLPGEHGQRLPVNRNTFAEITGLSPGVTYLFKVFAVHQGRESNPLT
FT                   AQQTTKLDAPTNLQFVNETDRTVLVTWTPPRARIAGYRLTAGLTRGGQPKQYNVGPLAS
FT                   KYPLRNLQPGSEYTVTLVAVKGNQQSPKATGVFTTLQPLRSIPPYNTEVTETTIVITWT
FT                   PAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYTYTIQVLRDGQERDAPIV
FT                   NRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGTSLEEVVH
FT                   ADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISDTVVPAVPPPTDLRFTNIGPDTMRV
FT                   TWAPPPSIELTNLLVRYSPVKNEEDVAELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQ
FT                   HESIPLRGRQKTGLDSPTGFDSSDITANSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQ
FT                   DRVPPSRNSITLTNLNPGTEYVVSIIAVNGREESPPLIGQQATVSDIPRDLEVIASTPT
FT                   SLLISWEPPAVSVRYYRITYGETGGNSPVQEFTVPGSKSTATINNIKPGADYTITLYAV
FT                   TGRGDSPASSKPVSINYKTEIDKPSQMQVTDVQDNSISVRWLPSTSPVTGYRVTTTPKN
FT                   GLGPSKTKTASPDQTEMTIEGLQPTVEYVVSVYAQNRNGESQPLVQTAVTNIDRPKGLA
FT                   FTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIRELFPAPDGEDDTAELQGLRPGSEY
FT                   TVSVVALHDDMESQPLIGIQSTAIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVN
FT                   PKEKTGPMKEINLSPDSSSVIVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENVSP
FT                   PRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPVQRSISPDVRSYTITGLQP
FT                   GTDYKIHLYTLNDNARSSPVIIDASTAIDAPSNLRFLTTTPNSLLVSWQAPRARITGYI
FT                   IKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTDE
FT                   LPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMIF
FT                   EEHGFRRTTPPTAATPVRLRPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNAST
FT                   GQEALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYNI
FT                   IVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAGF
FT                   KLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKC
FT                   DPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTT
FT                   GHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE"
FT   CDS             complement(join(19892073..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19898932..19899096,
FT                   19901525..19901663,19903142..19903608,19904235..19904324,
FT                   19905076..19905255,19905464..19905553,19906151..19906327,
FT                   19907062..19907149,19908171..19908358,19910831..19910944,
FT                   19911746..19911901,19912564..19912728,19913769..19913885,
FT                   19915278..19915547,19916794..19916883,19918333..19918515,
FT                   19919628..19919900,19921225..19921416,19924444..19924530,
FT                   19925249..19925417,19926590..19926684,19929943..19930209,
FT                   19931839..19932111,19933027..19933221,19933921..19934010,
FT                   19934272..19934400,19935180..19935356,19935530..19935707,
FT                   19938066..19938187,19943291..19943434,19944496..19944624,
FT                   19946475..19946627,19947335..19947511,19948135..19948314,
FT                   19949143..19949334,19951730..19951885,19954192..19954329,
FT                   19955377..19955508,19956745..19956882,19957704..19957832,
FT                   19959014..19959164))
FT                   /codon_start=1
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, isoform CRA_b"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT176043.0
FT                   protein_id=mCP98966.0 isoform=CRA_b"
FT                   /protein_id="EDL00266.1"
FT                   /translation="MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVA
FT                   VSQSKPGCFDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTG
FT                   NTYKVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGG
FT                   YMLECLCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNG
FT                   RITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASA
FT                   GSGSFTDVRTAIYQPQTHPQPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGV
FT                   SCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYS
FT                   FCTDHAVLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKF
FT                   GFCPMAAHEEICTTNEGVMYRIGDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQ
FT                   CIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSW
FT                   EKFVHGVRYQCYCYGRGIGEWHCQPLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEP
FT                   SHITKYILRWRPKTSTGRWKEATIPGHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTR
FT                   FDFTTSASTPVTSNTVTGETAPYSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEY
FT                   ELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDA
FT                   PPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQP
FT                   GVQYNITIYAVEENQESTPVFIQQETTGTPRSDNVPPPTDLQFVELTDVKVTIMWTPPD
FT                   SVVSGYRVEVLPVSLPGEHGQRLPVNRNTFAEITGLSPGVTYLFKVFAVHQGRESNPLT
FT                   AQQTTKLDAPTNLQFVNETDRTVLVTWTPPRARIAGYRLTAGLTRGGQPKQYNVGPLAS
FT                   KYPLRNLQPGSEYTVTLVAVKGNQQSPKATGVFTTLQPLRSIPPYNTEVTETTIVITWT
FT                   PAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYTYTIQVLRDGQERDAPIV
FT                   NRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGTSLEEVVH
FT                   ADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISDTVVPEVPQLTDLSFVDITDSSIGL
FT                   RWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLING
FT                   GESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVA
FT                   ELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTGLDSPTGFDSSDITA
FT                   NSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSRNSITLTNLNPGTEYVVSIIA
FT                   VNGREESPPLIGQQATVSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETGGNS
FT                   PVQEFTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTEIDKPSQM
FT                   QVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTASPDQTEMTIEGLQPTVE
FT                   YVVSVYAQNRNGESQPLVQTAVTTIPAPTNLKFSQVTPTSFTAQWIAPSVQLTGYRVRV
FT                   NPKEKTGPMKEINLSPDSSSVIVSGLMVATKYEVSVYALKDTLTSRPAQGVITTLENVS
FT                   PPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQTPVQRSISPDVRSYTITGLQ
FT                   PGTDYKIHLYTLNDNARSSPVIIDASTAIDAPSNLRFLTTTPNSLLVSWQAPRARITGY
FT                   IIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIYVIALKNNQKSEPLIGRKKTD
FT                   ELPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTENGIQLPGTTHQQPSVGQQMI
FT                   FEEHGFRRTTPPTAATPVRLRPRPYLPNVDEEVQIGHVPRGDVDYHLYPHVPGLNPNAS
FT                   TGQEALSQTTISWTPFQESSEYIISCQPVGTDEEPLQFQVPGTSTSATLTGLTRGVTYN
FT                   IIVEALQNQRRHKVREEVVTVGNAVSEGLNQPTDDSCFDPYTVSHYAIGEEWERLSDAG
FT                   FKLTCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFK
FT                   CDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGT
FT                   TGHTYNQYTQRYNQRTNTNVNCPIECFMPLDVQADRDDSRE"
FT   CDS             complement(join(19892073..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19901525..19901663,
FT                   19903142..19903248,19904235..19904324,19905076..19905255,
FT                   19905464..19905553,19906151..19906327,19907062..19907149,
FT                   19908171..19908358,19909521..19909790,19910831..19910944,
FT                   19911746..19911901,19912564..19912728,19913769..19913885,
FT                   19915278..19915547,19916794..19916883,19918333..19918515,
FT                   19919628..19919900,19921225..19921416,19924444..19924530,
FT                   19925249..19925417,19926590..19926684,19929943..19930209,
FT                   19931839..19932111,19933027..19933221,19933921..19934010,
FT                   19934272..19934400,19935180..19935356,19935530..19935707,
FT                   19938066..19938187,19943291..19943434,19944496..19944624,
FT                   19946475..19946627,19947335..19947511,19948135..19948314,
FT                   19949143..19949334,19951730..19951885,19954192..19954329,
FT                   19955377..19955508,19956745..19956882,19957704..19957832,
FT                   19959014..19959164))
FT                   /codon_start=1
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, isoform CRA_e"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT176046.0
FT                   protein_id=mCP98968.0 isoform=CRA_e"
FT                   /protein_id="EDL00269.1"
FT                   /translation="MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVA
FT                   VSQSKPGCFDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTG
FT                   NTYKVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGG
FT                   YMLECLCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNG
FT                   RITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASA
FT                   GSGSFTDVRTAIYQPQTHPQPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGV
FT                   SCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYS
FT                   FCTDHAVLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKF
FT                   GFCPMAAHEEICTTNEGVMYRIGDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQ
FT                   CIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSW
FT                   EKFVHGVRYQCYCYGRGIGEWHCQPLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEP
FT                   SHITKYILRWRPKTSTGRWKEATIPGHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTR
FT                   FDFTTSASTPVTSNTVTGETAPYSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEY
FT                   ELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDA
FT                   PPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQP
FT                   GVQYNITIYAVEENQESTPVFIQQETTGTPRSDNVPPPTDLQFVELTDVKVTIMWTPPD
FT                   SVVSGYRVEVLPVSLPGEHGQRLPVNRNTFAEITGLSPGVTYLFKVFAVHQGRESNPLT
FT                   AQQTTKLDAPTNLQFVNETDRTVLVTWTPPRARIAGYRLTAGLTRGGQPKQYNVGPLAS
FT                   KYPLRNLQPGSEYTVTLVAVKGNQQSPKATGVFTTLQPLRSIPPYNTEVTETTIVITWT
FT                   PAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYTYTIQVLRDGQERDAPIV
FT                   NRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGTSLEEVVH
FT                   ADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISDTVVPEVPQLTDLSFVDITDSSIGL
FT                   RWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLING
FT                   GESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVA
FT                   ELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTGLDSPTGFDSSDITA
FT                   NSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSRNSITLTNLNPGTEYVVSIIA
FT                   VNGREESPPLIGQQATVSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETGGNS
FT                   PVQEFTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTEIDKPSQM
FT                   QVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTASPDQTEMTIEGLQPTVE
FT                   YVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTY
FT                   SSPEDGIRELFPAPDGEDDTAELQGLRPGSEYTVSVVALHDDMESQPLIGIQSTAIPAP
FT                   TNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINLSPDSSSVIVSGLMV
FT                   ATKYEVSVYALKDTLTSRPAQGVITTLENVSPPRRARVTDATETTITISWRTKTETITG
FT                   FQVDAIPANGQTPVQRSISPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVIIDASTA
FT                   IDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT
FT                   GLEPGTEYTIYVIALKNNQKSEPLIGRKKTGQEALSQTTISWTPFQESSEYIISCQPVG
FT                   TDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAEWCHDN
FT                   GVNYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYL
FT                   GAICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIEC
FT                   FMPLDVQADRDDSRE"
FT   CDS             complement(join(19892073..19892144,19892691..19892804,
FT                   19895959..19896065,19896628..19896753,19898932..19899096,
FT                   19901525..19901663,19903142..19903608,19904235..19904324,
FT                   19905076..19905255,19905464..19905553,19906151..19906327,
FT                   19907062..19907149,19908171..19908358,19909521..19909790,
FT                   19910831..19910944,19911746..19911901,19912564..19912728,
FT                   19913769..19913885,19915278..19915547,19916794..19916883,
FT                   19918333..19918515,19919628..19919900,19921225..19921416,
FT                   19924444..19924530,19925249..19925417,19926590..19926684,
FT                   19929943..19930209,19931839..19932111,19933027..19933221,
FT                   19933921..19934010,19934272..19934400,19935180..19935356,
FT                   19935530..19935707,19938066..19938187,19943291..19943434,
FT                   19944496..19944624,19946475..19946627,19947335..19947511,
FT                   19948135..19948314,19949143..19949334,19951730..19951885,
FT                   19954192..19954329,19955377..19955508,19956745..19956882,
FT                   19957704..19957832,19959014..19959164))
FT                   /codon_start=1
FT                   /gene="Fn1"
FT                   /locus_tag="mCG_121782"
FT                   /product="fibronectin 1, isoform CRA_a"
FT                   /note="gene_id=mCG121782.1 transcript_id=mCT122994.0
FT                   protein_id=mCP74866.1 isoform=CRA_a"
FT                   /db_xref="GOA:P11276"
FT                   /db_xref="InterPro:IPR000083"
FT                   /db_xref="InterPro:IPR000562"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013806"
FT                   /db_xref="MGI:MGI:95566"
FT                   /db_xref="PDB:1MFN"
FT                   /db_xref="PDB:2MFN"
FT                   /db_xref="UniProtKB/Swiss-Prot:P11276"
FT                   /protein_id="EDL00265.1"
FT                   /translation="MLRGPGPGRLLLLAVLCLGTSVRCTEAGKSKRQAQQIVQPQSPVA
FT                   VSQSKPGCFDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCESKPEPEETCFDKYTG
FT                   NTYKVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDKWRRPHETGG
FT                   YMLECLCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWMMVDCTCLGEGNG
FT                   RITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCVCTGNGRGEWKCERHALQSASA
FT                   GSGSFTDVRTAIYQPQTHPQPAPYGHCVTDSGVVYSVGMQWLKSQGNKQMLCTCLGNGV
FT                   SCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTTSNYEQDQKYS
FT                   FCTDHAVLVQTRGGNSNGALCHFPFLYNNRNYTDCTSEGRRDNMKWCGTTQNYDADQKF
FT                   GFCPMAAHEEICTTNEGVMYRIGDQWDKQHDLGHMMRCTCVGNGRGEWACIPYSQLRDQ
FT                   CIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTFYQIGDSW
FT                   EKFVHGVRYQCYCYGRGIGEWHCQPLQTYPGTTGPVQVIITETPSQPNSHPIQWNAPEP
FT                   SHITKYILRWRPKTSTGRWKEATIPGHLNSYTIKGLTPGVIYEGQLISIQQYGHREVTR
FT                   FDFTTSASTPVTSNTVTGETAPYSPVVATSESVTEITASSFVVSWVSASDTVSGFRVEY
FT                   ELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGKQSLILSTSQTTAPDA
FT                   PPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQP
FT                   GVQYNITIYAVEENQESTPVFIQQETTGTPRSDNVPPPTDLQFVELTDVKVTIMWTPPD
FT                   SVVSGYRVEVLPVSLPGEHGQRLPVNRNTFAEITGLSPGVTYLFKVFAVHQGRESNPLT
FT                   AQQTTKLDAPTNLQFVNETDRTVLVTWTPPRARIAGYRLTAGLTRGGQPKQYNVGPLAS
FT                   KYPLRNLQPGSEYTVTLVAVKGNQQSPKATGVFTTLQPLRSIPPYNTEVTETTIVITWT
FT                   PAPRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYTYTIQVLRDGQERDAPIV
FT                   NRVVTPLSPPTNLHLEANPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGTSLEEVVH
FT                   ADQSSCTFENLNPGLEYNVSVYTVKDDKESAPISDTVVPEVPQLTDLSFVDITDSSIGL
FT                   RWTPLNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLING
FT                   GESAPTTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNLLVRYSPVKNEEDVA
FT                   ELSISPSDNAVVLTNLLPGTEYLVSVSSVYEQHESIPLRGRQKTGLDSPTGFDSSDITA
FT                   NSFTVHWVAPRAPITGYIIRHHAEHSVGRPRQDRVPPSRNSITLTNLNPGTEYVVSIIA
FT                   VNGREESPPLIGQQATVSDIPRDLEVIASTPTSLLISWEPPAVSVRYYRITYGETGGNS
FT                   PVQEFTVPGSKSTATINNIKPGADYTITLYAVTGRGDSPASSKPVSINYKTEIDKPSQM
FT                   QVTDVQDNSISVRWLPSTSPVTGYRVTTTPKNGLGPSKTKTASPDQTEMTIEGLQPTVE
FT                   YVVSVYAQNRNGESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTY
FT                   SSPEDGIRELFPAPDGEDDTAELQGLRPGSEYTVSVVALHDDMESQPLIGIQSTAIPAP
FT                   TNLKFSQVTPTSFTAQWIAPSVQLTGYRVRVNPKEKTGPMKEINLSPDSSSVIVSGLMV
FT                   ATKYEVSVYALKDTLTSRPAQGVITTLENVSPPRRARVTDATETTITISWRTKTETITG
FT                   FQVDAIPANGQTPVQRSISPDVRSYTITGLQPGTDYKIHLYTLNDNARSSPVIIDASTA
FT                   IDAPSNLRFLTTTPNSLLVSWQAPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATIT
FT                   GLEPGTEYTIYVIALKNNQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKT
FT                   PFITNPGYDTENGIQLPGTTHQQPSVGQQMIFEEHGFRRTTPPTAATPVRLRPRPYLPN
FT                   VDEEVQIGHVPRGDVDYHLYPHVPGLNPNASTGQEALSQTTISWTPFQESSEYIISCQP
FT                   VGTDEEPLQFQVPGTSTSATLTGLTRGVTYNIIVEALQNQRRHKVREEVVTVGNAVSEG
FT                   LNQPTDDSCFDPYTVSHYAIGEEWERLSDAGFKLTCQCLGFGSGHFRCDSSKWCHDNGV
FT                   NYKIGEKWDRQGENGQRMSCTCLGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGA
FT                   ICSCTCFGGQRGWRCDNCRRPGAAEPSPDGTTGHTYNQYTQRYNQRTNTNVNCPIECFM
FT                   PLDVQADRDDSRE"
FT   gap             19913634..19913653
FT                   /estimated_length=20
FT   gap             19946010..19946029
FT                   /estimated_length=20
FT   gene            <19959516..19969024
FT                   /locus_tag="mCG_144898"
FT                   /note="gene_id=mCG144898.0"
FT   mRNA            join(<19959516..19959568,19963225..19963346,
FT                   19966932..19967125,19968199..19969024)
FT                   /locus_tag="mCG_144898"
FT                   /product="mCG144898"
FT                   /note="gene_id=mCG144898.0 transcript_id=mCT184322.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<19967069..19967125,19968199..19968432)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144898"
FT                   /product="mCG144898"
FT                   /note="gene_id=mCG144898.0 transcript_id=mCT184322.0
FT                   protein_id=mCP106127.0"
FT                   /protein_id="EDL00270.1"
FT                   /translation="LKPLQFRRAIQSEHSVEFWHFETSSSLCCIPLAVTISARRPALNI
FT                   LLHGMVASCEGTICSLSHVSSYQGGSCVTSSLNLLVNNWEKNILFGTILQL"
FT   gap             20014780..20014799
FT                   /estimated_length=20
FT   gene            complement(20015308..20016239)
FT                   /locus_tag="mCG_121775"
FT                   /note="gene_id=mCG121775.1"
FT   mRNA            complement(20015308..20016239)
FT                   /locus_tag="mCG_121775"
FT                   /product="mCG121775"
FT                   /note="gene_id=mCG121775.1 transcript_id=mCT122987.0
FT                   created on 18-JUL-2002"
FT   CDS             complement(20015824..20016177)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121775"
FT                   /product="mCG121775"
FT                   /note="gene_id=mCG121775.1 transcript_id=mCT122987.0
FT                   protein_id=mCP74820.1"
FT                   /protein_id="EDL00271.1"
FT                   /translation="MKWMFKEDHSLEHRCVESAKIRAKYPDRLPVIVEKVSGSQIVDIN
FT                   RRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGF
FT                   LYVAYSGENAFGF"
FT   gap             20049841..20050221
FT                   /estimated_length=381
FT   gap             20054532..20054621
FT                   /estimated_length=90
FT   gap             20073740..20073929
FT                   /estimated_length=190
FT   gap             20083653..20083879
FT                   /estimated_length=227
FT   gap             20097270..20097617
FT                   /estimated_length=348
FT   gap             20098767..20098786
FT                   /estimated_length=20
FT   gap             20104467..20104486
FT                   /estimated_length=20
FT   gap             20106139..20106977
FT                   /estimated_length=839
FT   gap             20116103..20116144
FT                   /estimated_length=42
FT   gap             20116429..20116502
FT                   /estimated_length=74
FT   gap             20119821..20119961
FT                   /estimated_length=141
FT   gap             20163046..20163065
FT                   /estimated_length=20
FT   gap             20164360..20164379
FT                   /estimated_length=20
FT   gap             20176648..20176800
FT                   /estimated_length=153
FT   gap             20207358..20207518
FT                   /estimated_length=161
FT   gap             20211527..20211656
FT                   /estimated_length=130
FT   gap             20217617..20217719
FT                   /estimated_length=103
FT   gap             20221340..20221484
FT                   /estimated_length=145
FT   gap             20240659..20240678
FT                   /estimated_length=20
FT   gap             20243131..20243213
FT                   /estimated_length=83
FT   gap             20245287..20245306
FT                   /estimated_length=20
FT   gap             20252215..20252234
FT                   /estimated_length=20
FT   gap             20254114..20254133
FT                   /estimated_length=20
FT   gap             20257683..20257702
FT                   /estimated_length=20
FT   gap             20259585..20259604
FT                   /estimated_length=20
FT   gene            complement(20267360..>20313536)
FT                   /locus_tag="mCG_144893"
FT                   /note="gene_id=mCG144893.0"
FT   mRNA            complement(join(20267360..20267989,20271876..20272154,
FT                   20313352..>20313536))
FT                   /locus_tag="mCG_144893"
FT                   /product="mCG144893"
FT                   /note="gene_id=mCG144893.0 transcript_id=mCT184317.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(20267564..>20267893)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144893"
FT                   /product="mCG144893"
FT                   /note="gene_id=mCG144893.0 transcript_id=mCT184317.0
FT                   protein_id=mCP106122.0"
FT                   /protein_id="EDL00272.1"
FT                   /translation="CGKDRCVLNLTWEQPEDTERKSCTNPTISGYKHLESHSRDKHRTA
FT                   RILVEVTPLSTSCAQKPYSPRPSLTIVNLLPSHLLLEGGGRPIRFSKERKLTGVNRLIG
FT                   AKQAL"
FT   gap             20281086..20281105
FT                   /estimated_length=20
FT   gene            complement(20292016..20347152)
FT                   /locus_tag="mCG_146954"
FT                   /note="gene_id=mCG146954.0"
FT   mRNA            complement(join(20292016..20292409,20346805..20347152))
FT                   /locus_tag="mCG_146954"
FT                   /product="mCG146954"
FT                   /note="gene_id=mCG146954.0 transcript_id=mCT187217.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(20292281..20292409)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146954"
FT                   /product="mCG146954"
FT                   /note="gene_id=mCG146954.0 transcript_id=mCT187217.0
FT                   protein_id=mCP109553.0"
FT                   /protein_id="EDL00273.1"
FT                   /translation="MLRRPEEGIGSPWSCNYKRFIVSPSEEVLGMQQSLCEISPRS"
FT   gene            20312596..20313156
FT                   /pseudo
FT                   /locus_tag="mCG_121776"
FT                   /note="gene_id=mCG121776.1"
FT   mRNA            20312596..20313156
FT                   /pseudo
FT                   /locus_tag="mCG_121776"
FT                   /note="gene_id=mCG121776.1 transcript_id=mCT122988.0
FT                   created on 19-JUL-2002"
FT   gap             20340144..20340167
FT                   /estimated_length=24
FT   gap             20342727..20342746
FT                   /estimated_length=20
FT   gene            20396208..20396900
FT                   /pseudo
FT                   /locus_tag="mCG_121778"
FT                   /note="gene_id=mCG121778.1"
FT   mRNA            20396208..20396900
FT                   /pseudo
FT                   /locus_tag="mCG_121778"
FT                   /note="gene_id=mCG121778.1 transcript_id=mCT122990.1
FT                   created on 19-JUL-2002"
FT   gap             20407053..20407072
FT                   /estimated_length=20
FT   gap             20414012..20414031
FT                   /estimated_length=20
FT   gene            complement(20417859..>20433326)
FT                   /locus_tag="mCG_144887"
FT                   /note="gene_id=mCG144887.0"
FT   mRNA            complement(join(20417859..20419721,20425820..20425908,
FT                   20432561..20432599,20433269..>20433326))
FT                   /locus_tag="mCG_144887"
FT                   /product="mCG144887"
FT                   /note="gene_id=mCG144887.0 transcript_id=mCT184311.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(20419338..>20419583)
FT                   /codon_start=1
FT                   /locus_tag="mCG_144887"
FT                   /product="mCG144887"
FT                   /note="gene_id=mCG144887.0 transcript_id=mCT184311.0
FT                   protein_id=mCP106117.0"
FT                   /protein_id="EDL00274.1"
FT                   /translation="WPWSYKSRPLLRHGGKKVSGSSLDTCTALWCKVKLTNSGGQNKQM
FT                   FSRLSVKRWGNDFMGLWLRCFHLNVIHRKSSGSGII"
FT   gap             20422706..20422725
FT                   /estimated_length=20
FT   gap             20434102..20434121
FT                   /estimated_length=20
FT   gap             20439901..20440066
FT                   /estimated_length=166
FT   gap             20442767..20442786
FT                   /estimated_length=20
FT   gap             20446272..20446514
FT                   /estimated_length=243
FT   gap             20466513..20466532
FT                   /estimated_length=20
FT   gene            complement(20472287..20528478)
FT                   /gene="Mreg"
FT                   /locus_tag="mCG_121783"
FT                   /note="gene_id=mCG121783.1"
FT   mRNA            complement(join(20472287..20472793,20474567..20474730,
FT                   20476318..20476408,20508326..20508488,20528262..20528478))
FT                   /gene="Mreg"
FT                   /locus_tag="mCG_121783"
FT                   /product="melanoregulin"
FT                   /note="gene_id=mCG121783.1 transcript_id=mCT122995.1
FT                   created on 21-NOV-2002"
FT   CDS             complement(join(20472659..20472793,20474567..20474730,
FT                   20476318..20476408,20508326..20508488,20528262..20528437))
FT                   /codon_start=1
FT                   /gene="Mreg"
FT                   /locus_tag="mCG_121783"
FT                   /product="melanoregulin"
FT                   /note="gene_id=mCG121783.1 transcript_id=mCT122995.1
FT                   protein_id=mCP74444.1"
FT                   /protein_id="EDL00275.1"
FT                   /translation="MRTARPVTPRPSLSPSPRPRRHRAPGSGIPAPGLAPHGAAPLATE
FT                   RLLLLPVPVPGGARSGNNPYSSFGATLERDDEKNLWSMPHDVSHTEADDDRILYNLIVI
FT                   RNQQTKDSEEWQRLNYDIYTLRQIRREVRNRWRRILEDLGFQREAESLLSVTKLSTMSD
FT                   SKNTRKAREMLLKLAEETSIFPASWELSERYLLVVDRLIALDAAEDFFKIASQMYPKKP
FT                   GVPCLVDGQRKLHCLPFPSP"
FT   gap             20472921..20474010
FT                   /estimated_length=1090
FT   gap             20493372..20498526
FT                   /estimated_length=5155
FT   gap             20499611..20499630
FT                   /estimated_length=20
FT   gap             20527291..20528261
FT                   /estimated_length=971
FT   gap             20531841..20531860
FT                   /estimated_length=20
FT   gap             20535585..20535604
FT                   /estimated_length=20
FT   gene            20552243..20587214
FT                   /locus_tag="mCG_1035709"
FT                   /note="gene_id=mCG1035709.1"
FT   mRNA            join(20552243..20552307,20553649..20553706,
FT                   20557181..20557313,20580482..20580631,20581766..20581855,
FT                   20585369..20585450,20587033..20587214)
FT                   /locus_tag="mCG_1035709"
FT                   /product="mCG1035709"
FT                   /note="gene_id=mCG1035709.1 transcript_id=mCT153413.1
FT                   created on 18-MAR-2003"
FT   CDS             join(20553681..20553706,20557181..20557313,
FT                   20580482..20580631,20581766..20581855,20585369..20585450,
FT                   20587033..20587037)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035709"
FT                   /product="mCG1035709"
FT                   /note="gene_id=mCG1035709.1 transcript_id=mCT153413.1
FT                   protein_id=mCP74875.1"
FT                   /protein_id="EDL00276.1"
FT                   /translation="MSRAGYLSWASVTFYILSGSFTHSGDTGRACNSRYQRITRLETIS
FT                   FSSIPGAEAQSNGWRMAGASVWVTARSQRWGRQGGSTSTEVCREDRSSRYNHCDLPWKH
FT                   RAPKRGVRNTRRSVTDQIRDQLRDRRPGLGFSLSLELTVSHRADRPSWERPRTGVTG"
FT   gap             20555248..20555279
FT                   /estimated_length=32
FT   gap             20556066..20556481
FT                   /estimated_length=416
FT   gap             20569041..20569083
FT                   /estimated_length=43
FT   gene            complement(20574906..20603046)
FT                   /gene="Pecr"
FT                   /locus_tag="mCG_121777"
FT                   /note="gene_id=mCG121777.2"
FT   mRNA            complement(join(20574906..20575172,20577691..20577802,
FT                   20583126..20583236,20588816..20588912,20593664..20593745,
FT                   20594431..20594580,20596052..20596185,20602826..>20602992))
FT                   /gene="Pecr"
FT                   /locus_tag="mCG_121777"
FT                   /product="peroxisomal trans-2-enoyl-CoA reductase,
FT                   transcript variant mCT189272"
FT                   /note="gene_id=mCG121777.2 transcript_id=mCT189272.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(20574914..20575172,20577691..20577802,
FT                   20583126..20583236,20586344..20586440,20593664..20593745,
FT                   20594944..20595109,20596052..20596185,20602826..20603046))
FT                   /gene="Pecr"
FT                   /locus_tag="mCG_121777"
FT                   /product="peroxisomal trans-2-enoyl-CoA reductase,
FT                   transcript variant mCT170708"
FT                   /note="gene_id=mCG121777.2 transcript_id=mCT170708.0
FT                   created on 19-JUL-2002"
FT   mRNA            complement(join(20574914..20575172,20577691..20577802,
FT                   20583126..20583236,20588816..20588912,20593664..20593745,
FT                   20594944..20595109,20596052..20596185,20602826..20603037))
FT                   /gene="Pecr"
FT                   /locus_tag="mCG_121777"
FT                   /product="peroxisomal trans-2-enoyl-CoA reductase,
FT                   transcript variant mCT122989"
FT                   /note="gene_id=mCG121777.2 transcript_id=mCT122989.1
FT                   created on 19-JUL-2002"
FT   CDS             complement(join(20575087..20575172,20577691..20577802,
FT                   20583126..20583236,20586344..20586440,20593664..20593745,
FT                   20594944..20595109,20596052..20596185,20602826..20602949))
FT                   /codon_start=1
FT                   /gene="Pecr"
FT                   /locus_tag="mCG_121777"
FT                   /product="peroxisomal trans-2-enoyl-CoA reductase, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG121777.2 transcript_id=mCT170708.0
FT                   protein_id=mCP93626.0 isoform=CRA_c"
FT                   /protein_id="EDL00279.1"
FT                   /translation="MGSWKTGQSYLAAGLLKNQVAVVTGGGTGIGKAVSRELLHLGCNV
FT                   VIASRKLDRLTAAVDELRASLPPSSSAEVSAIQCNIRKEEEVSNLVKSTLAKYGKINFL
FT                   VNNGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMREHGGSIVNIIVLLNN
FT                   GFPTAAHTGAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSQTAVDNYGEMGQTLFE
FT                   MAFDSIPAKRLGVPEEISPLVCFLLSPAASYITGQLINVDGGQALYTHAFSIPDHDNWP
FT                   VGAGDLSIVKRIKESFKKKAKL"
FT   CDS             complement(join(20575087..20575172,20577691..20577802,
FT                   20583126..20583236,20588816..20588912,20593664..20593745,
FT                   20594944..20595109,20596052..20596185,20602826..20602949))
FT                   /codon_start=1
FT                   /gene="Pecr"
FT                   /locus_tag="mCG_121777"
FT                   /product="peroxisomal trans-2-enoyl-CoA reductase, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG121777.2 transcript_id=mCT122989.1
FT                   protein_id=mCP74825.1 isoform=CRA_b"
FT                   /protein_id="EDL00278.1"
FT                   /translation="MGSWKTGQSYLAAGLLKNQVAVVTGGGTGIGKAVSRELLHLGCNV
FT                   VIASRKLDRLTAAVDELRASLPPSSSAEVSAIQCNIRKEEEVSNLVKSTLAKYGKINFL
FT                   VNNGGGQFMAPVEDITAKGWHAVIETNLTGTFYMCKEVYNSWMREHGGSIVNIIVLLNN
FT                   GFPTAAHTGAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSQTAVDNYGEMGQTLFE
FT                   MAFDSIPAKRLGVPEEISPLVCFLLSPAASYITGQLINVDGGQALYTHAFSIPDHDNWP
FT                   VGAGDLSIVKRIKESFKKKAKL"
FT   CDS             complement(join(20575087..20575172,20577691..20577802,
FT                   20583126..20583236,20588816..20588912,20593664..20593745,
FT                   20594431..>20594482))
FT                   /codon_start=1
FT                   /gene="Pecr"
FT                   /locus_tag="mCG_121777"
FT                   /product="peroxisomal trans-2-enoyl-CoA reductase, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG121777.2 transcript_id=mCT189272.0
FT                   protein_id=mCP110264.0 isoform=CRA_a"
FT                   /protein_id="EDL00277.1"
FT                   /translation="DQGPAPPLPPNWLCPFRVYNSWMREHGGSIVNIIVLLNNGFPTAA
FT                   HTGAAREGVYNLTKSMALAWASSGVRINCVAPGTIYSQTAVDNYGEMGQTLFEMAFDSI
FT                   PAKRLGVPEEISPLVCFLLSPAASYITGQLINVDGGQALYTHAFSIPDHDNWPVGAGDL
FT                   SIVKRIKESFKKKAKL"
FT   gap             20586501..20586520
FT                   /estimated_length=20
FT   gap             20587945..20587964
FT                   /estimated_length=20
FT   gap             20589241..20590460
FT                   /estimated_length=1220
FT   gene            20603102..20620138
FT                   /gene="A830020B06Rik"
FT                   /locus_tag="mCG_121780"
FT                   /note="gene_id=mCG121780.1"
FT   mRNA            join(20603102..20603199,20616456..20616865,
FT                   20619295..20620138)
FT                   /gene="A830020B06Rik"
FT                   /locus_tag="mCG_121780"
FT                   /product="RIKEN cDNA A830020B06, transcript variant
FT                   mCT122992"
FT                   /note="gene_id=mCG121780.1 transcript_id=mCT122992.0
FT                   created on 21-NOV-2002"
FT   mRNA            join(20603108..20603199,20611614..20611739,
FT                   20616456..20616865,20619295..20620138)
FT                   /gene="A830020B06Rik"
FT                   /locus_tag="mCG_121780"
FT                   /product="RIKEN cDNA A830020B06, transcript variant
FT                   mCT176042"
FT                   /note="gene_id=mCG121780.1 transcript_id=mCT176042.0
FT                   created on 21-NOV-2002"
FT   CDS             join(20616595..20616865,20619295..20619917)
FT                   /codon_start=1
FT                   /gene="A830020B06Rik"
FT                   /locus_tag="mCG_121780"
FT                   /product="RIKEN cDNA A830020B06, isoform CRA_a"
FT                   /note="gene_id=mCG121780.1 transcript_id=mCT122992.0
FT                   protein_id=mCP74847.1 isoform=CRA_a"
FT                   /protein_id="EDL00280.1"
FT                   /translation="MEESAPVESQGQLPSPHHGSLRRAVAAVLALDGESTLGRRKKRRK
FT                   DSRPESIIIYRSDNEKTDEEPEESEGGDRPKEEEGEDFLDYPGDDGVWNMPLDSRYVTL
FT                   TGTITRGKKKGQMVDIHVTLTEKELQELTKPKELSREAAPEGRRACQVGADQGPHVVLW
FT                   TLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERTFWHKISCCPCLILFYPVLIMAMA
FT                   SSLGLYAAVAQLSWSWAAWWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNISG
FT                   NLSNKDPIQEVETSTV"
FT   CDS             join(20616595..20616865,20619295..20619917)
FT                   /codon_start=1
FT                   /gene="A830020B06Rik"
FT                   /locus_tag="mCG_121780"
FT                   /product="RIKEN cDNA A830020B06, isoform CRA_a"
FT                   /note="gene_id=mCG121780.1 transcript_id=mCT176042.0
FT                   protein_id=mCP98964.0 isoform=CRA_a"
FT                   /protein_id="EDL00281.1"
FT                   /translation="MEESAPVESQGQLPSPHHGSLRRAVAAVLALDGESTLGRRKKRRK
FT                   DSRPESIIIYRSDNEKTDEEPEESEGGDRPKEEEGEDFLDYPGDDGVWNMPLDSRYVTL
FT                   TGTITRGKKKGQMVDIHVTLTEKELQELTKPKELSREAAPEGRRACQVGADQGPHVVLW
FT                   TLVCLPVVFVLSFVVSFYYGTITWYNIFLVYNEERTFWHKISCCPCLILFYPVLIMAMA
FT                   SSLGLYAAVAQLSWSWAAWWRAACDMEKGFCGWLCSKLGLEDCSPYSIVELLESDNISG
FT                   NLSNKDPIQEVETSTV"
FT   gap             20617403..20617422
FT                   /estimated_length=20
FT   gene            20626050..20714079
FT                   /gene="Xrcc5"
FT                   /locus_tag="mCG_121781"
FT                   /note="gene_id=mCG121781.1"
FT   mRNA            join(20626050..20626196,20629064..20629177,
FT                   20631037..20631220,20632767..20632815,20634072..20634194,
FT                   20637612..20637803,20643945..20644059,20645087..20645225,
FT                   20648778..20648890,20653490..20653552,20657814..20657951,
FT                   20658843..20658933,20661900..20662033,20665120..20665316,
FT                   20673108..20673201,20675682..20675751,20700771..20700880,
FT                   20702510..20702606,20702850..20702917,20713023..20713094,
FT                   20713835..20714079)
FT                   /gene="Xrcc5"
FT                   /locus_tag="mCG_121781"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 5"
FT                   /note="gene_id=mCG121781.1 transcript_id=mCT122993.1
FT                   created on 10-SEP-2002"
FT   CDS             join(20626176..20626196,20629064..20629177,
FT                   20631037..20631220,20632767..20632815,20634072..20634194,
FT                   20637612..20637803,20643945..20644059,20645087..20645225,
FT                   20648778..20648890,20653490..20653552,20657814..20657951,
FT                   20658843..20658933,20661900..20662033,20665120..20665316,
FT                   20673108..20673201,20675682..20675751,20700771..20700880,
FT                   20702510..20702606,20702850..20702917,20713023..20713094,
FT                   20713835..20713849)
FT                   /codon_start=1
FT                   /gene="Xrcc5"
FT                   /locus_tag="mCG_121781"
FT                   /product="X-ray repair complementing defective repair in
FT                   Chinese hamster cells 5"
FT                   /note="gene_id=mCG121781.1 transcript_id=mCT122993.1
FT                   protein_id=mCP74850.1"
FT                   /protein_id="EDL00282.1"
FT                   /translation="MAWSGNKAAVVLCVDVGVAMGNSFPGEESPIEQAKKVMTMFVQRQ
FT                   VFSESKDEIALVLYGTDGTDNALAGKDQYQNITVCRHLMLPDFDLLEDIGNKIQPSSQQ
FT                   ADFLDALIVCMDLIQRETIGKKFGKKHIEVFTDLSSPFSQDQLDVIICNLKKSGISLQF
FT                   FLPFPIDKNGEPGERGDLDSGLDHLKPSFPQKGLTEQQKEGIRMVTRVMLSLEGEDGLD
FT                   EIYSFSESLRQLCVFKKIERRSMPWPCQLTIGPNLSIKIVAYKSIVQEKFKKSWVVVDA
FT                   RTLKKEDIQKETVYCLNDDDETEVSKEDTIQGYRYGSDIIPFSKVDEEQMKYKSEGKCF
FT                   SVLGFCKSSQVHRRFFMGHQVLKVFAAKDDEAAAVALSSLVHALDELNMVAIVRYAYDK
FT                   RSNPQVGVAFPYIKDAYECLVYVQLPFMEDLRQYMFSSLKNNKKCTPTEAQLSAIDDLI
FT                   DSMSLVKKNEEEDIVEDLFPTSKIPNPEFQRLYQCLLHRALHLQERLPPIQQHILNMLD
FT                   PPTEMKAKCESPLSKVKTLFPLTEVIKKKNQVTAQDVFQDNHEEGPAAKKYKTEKEEDH
FT                   ISISSLAEGNITKVGSVNPVENFRFLVRQKIASFEEASLQLISHIEQFLDTNETLYFMK
FT                   SMDCIKAFREEAIQFSEEQRFNSFLEALREKVEIKQLNHFWEIVVQDGVTLITKDEGPG
FT                   SSITAEEATKFLAPKDKAKEDTTGPEEAGDVDDLLDMI"
FT   gap             20640819..20641793
FT                   /estimated_length=975
FT   gap             20671929..20671948
FT                   /estimated_length=20
FT   gap             20689036..20689299
FT                   /estimated_length=264
FT   gap             20700141..20700313
FT                   /estimated_length=173
FT   gap             20708584..20708603
FT                   /estimated_length=20
FT   gap             20717311..20717330
FT                   /estimated_length=20
FT   gap             20719834..20719853
FT                   /estimated_length=20
FT   gap             20721371..20721390
FT                   /estimated_length=20
FT   gap             20728651..20728670
FT                   /estimated_length=20
FT   gap             20758379..20758398
FT                   /estimated_length=20
FT   gap             20769346..20775455
FT                   /estimated_length=6110
FT   gap             20776517..20776536
FT                   /estimated_length=20
FT   gap             20778307..20778326
FT                   /estimated_length=20
FT   gap             20783741..20783760
FT                   /estimated_length=20
FT   gap             20788975..20792850
FT                   /estimated_length=3876
FT   gap             20806668..20806897
FT                   /estimated_length=230
FT   gap             20808750..20808843
FT                   /estimated_length=94
FT   gap             20819000..20819260
FT                   /estimated_length=261
FT   gap             20826891..20826910
FT                   /estimated_length=20
FT   gap             20828369..20828485
FT                   /estimated_length=117
FT   gap             20831025..20831160
FT                   /estimated_length=136
FT   gene            complement(<20852866..20855172)
FT                   /locus_tag="mCG_146944"
FT                   /note="gene_id=mCG146944.0"
FT   mRNA            complement(<20852866..20855172)
FT                   /locus_tag="mCG_146944"
FT                   /product="mCG146944"
FT                   /note="gene_id=mCG146944.0 transcript_id=mCT187207.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(<20852866..20853379)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146944"
FT                   /product="mCG146944"
FT                   /note="gene_id=mCG146944.0 transcript_id=mCT187207.0
FT                   protein_id=mCP109544.0"
FT                   /protein_id="EDL00283.1"
FT                   /translation="MLMPLGGLLWWWCCCCGWYSCGLCTPAPQMLRHQGLLKCRCRMLF
FT                   NDLKVFLLRRPPPAPLPMHGDPQLPGVAANNNTLPALGAGGWAGWRGPREAVGRETPPL
FT                   PPPPPLPPSGDDDWDGPATGPPASLLSSASSDEFCKEKTEDCYSLGSSLDSGMRTPLCR
FT                   ICFQGPEQ"
FT   gap             20856051..20856323
FT                   /estimated_length=273
FT   gap             20861483..20863731
FT                   /estimated_length=2249
FT   gap             20867184..20867322
FT                   /estimated_length=139
FT   gene            20901681..20952056
FT                   /gene="Smarcal1"
FT                   /locus_tag="mCG_112977"
FT                   /note="gene_id=mCG112977.1"
FT   mRNA            join(20901681..20901848,20904048..20904814,
FT                   20905462..20905512,20909474..20909686,20910236..20910286,
FT                   20914199..20914385,20915805..20915955,20917200..20917358,
FT                   20919798..20919863,20930195..20930335,20931709..20931924,
FT                   20935411..20935481,20938935..20939037,20945366..20945548,
FT                   20947001..20947101,20948301..20948397,20951747..20952056)
FT                   /gene="Smarcal1"
FT                   /locus_tag="mCG_112977"
FT                   /product="Swi/SNF related matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a-like 1,
FT                   transcript variant mCT114054"
FT                   /note="gene_id=mCG112977.1 transcript_id=mCT114054.1
FT                   created on 19-JUL-2002"
FT   mRNA            join(<20901683..20901848,20904048..20904814,
FT                   20905462..20905512,20909474..20909686,20910236..20910286,
FT                   20914199..20914385,20915805..20915955,20917200..20917358,
FT                   20919798..20919863,20930195..20930335,20931709..20931924,
FT                   20935411..20935481,20938935..20939037,20945366..20945819)
FT                   /gene="Smarcal1"
FT                   /locus_tag="mCG_112977"
FT                   /product="Swi/SNF related matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a-like 1,
FT                   transcript variant mCT189279"
FT                   /note="gene_id=mCG112977.1 transcript_id=mCT189279.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<20902025..20902147,20904048..20904814,
FT                   20905462..20905512,20909474..20909686,20910236..20910286,
FT                   20914199..20914385,20915805..20915955,20917200..20917358,
FT                   20919798..20919863,20930195..20930335,20931709..20931924,
FT                   20935411..20935481,20938935..20939037,20945366..20945548,
FT                   20947001..20947101,20948301..20948397,20951747..20952056)
FT                   /gene="Smarcal1"
FT                   /locus_tag="mCG_112977"
FT                   /product="Swi/SNF related matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a-like 1,
FT                   transcript variant mCT189278"
FT                   /note="gene_id=mCG112977.1 transcript_id=mCT189278.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<20904070..20904814,20905462..20905512,
FT                   20909474..20909686,20910236..20910286,20914199..20914385,
FT                   20915805..20915955,20917200..20917358,20919798..20919863,
FT                   20930195..20930335,20931709..20931924,20935411..20935481,
FT                   20938935..20939037,20945366..20945548,20947001..20947101,
FT                   20948301..20948397,20951747..20951980)
FT                   /codon_start=1
FT                   /gene="Smarcal1"
FT                   /locus_tag="mCG_112977"
FT                   /product="Swi/SNF related matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a-like 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG112977.1 transcript_id=mCT189278.0
FT                   protein_id=mCP110233.0 isoform=CRA_a"
FT                   /protein_id="EDL00284.1"
FT                   /translation="RVTSLHEPILLKMSLPLTEEQRKKIEENRQKALARRAEKLSEQPQ
FT                   SAASGSSAAGPSQSKQGSLLNLLAEPSKPVGHASIFKQQNLSNSFPTDQRPHSSRCSQP
FT                   SPAEETTGLWKTQGEMSTACPKPNPSPPGASNQPLLGYKSSEGQPQATWDTGASSSGPF
FT                   PRDPELEAKAARPSTSRQSISDSFYVLGGKTPRTEGRPPNILQTTPQNTGFLRGACIKT
FT                   GDRFRVKIGYNQELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPLD
FT                   EAGGSVGGQTSLPSAPSLTFVTGKCMLISRVRFEVDIGYSEAVIGLFKQMESRSYDIKT
FT                   RKWSFLLEEHNKLIARSRELKQVQLDPLPKTVTLAFASQLEKTSPKLKADVPEADLSGV
FT                   DAKLVSSLMPFQREGVSFAISKRGRLLLADDMGLGKTVQAICIAAFYRKEWPLLVVVPS
FT                   SVRFTWEQAFLRWLPSLSPENINVVVTGKGRLTAGLVNIVSFDLLCKLERQLKTPFKVV
FT                   IIDESHFLKNIKTARCRAAVPILKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFPQF
FT                   HAFGLRYCDAKRLPWGWDYSGSSNLGELKLLLEEAIMLRRLKSDVLSQLPAKQRKMVVV
FT                   NPGRISSRAKAALDAAAKEMTKDKTKQQQKEALLVFFNRTAEAKIPCVVEYILDLLDSG
FT                   REKFLVFAHHKVILDAVAKELERKNVQHIRIDGSTPSADREAQCQRFQLSKGHTVALLS
FT                   ITAANMGLTFSTADLVVFAELFWNPGVLIQAEDRVHRIGQTNSVSIHYLVAKGTADDYL
FT                   WPLIQEKIKVLGEAGLSETNFSEMTEATDYVHKDPKQKTIYDLFQQSFEDDGNDMEFLE
FT                   AAESFELGSTSGTSGNISQDLGDLLDEDEGSPPKKSRFEFFDNWDSFSSPF"
FT   CDS             join(<20904070..20904814,20905462..20905512,
FT                   20909474..20909686,20910236..20910286,20914199..20914385,
FT                   20915805..20915955,20917200..20917358,20919798..20919863,
FT                   20930195..20930335,20931709..20931924,20935411..20935481,
FT                   20938935..20939037,20945366..20945614)
FT                   /codon_start=1
FT                   /gene="Smarcal1"
FT                   /locus_tag="mCG_112977"
FT                   /product="Swi/SNF related matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a-like 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG112977.1 transcript_id=mCT189279.0
FT                   protein_id=mCP110234.0 isoform=CRA_b"
FT                   /protein_id="EDL00285.1"
FT                   /translation="RVTSLHEPILLKMSLPLTEEQRKKIEENRQKALARRAEKLSEQPQ
FT                   SAASGSSAAGPSQSKQGSLLNLLAEPSKPVGHASIFKQQNLSNSFPTDQRPHSSRCSQP
FT                   SPAEETTGLWKTQGEMSTACPKPNPSPPGASNQPLLGYKSSEGQPQATWDTGASSSGPF
FT                   PRDPELEAKAARPSTSRQSISDSFYVLGGKTPRTEGRPPNILQTTPQNTGFLRGACIKT
FT                   GDRFRVKIGYNQELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPLD
FT                   EAGGSVGGQTSLPSAPSLTFVTGKCMLISRVRFEVDIGYSEAVIGLFKQMESRSYDIKT
FT                   RKWSFLLEEHNKLIARSRELKQVQLDPLPKTVTLAFASQLEKTSPKLKADVPEADLSGV
FT                   DAKLVSSLMPFQREGVSFAISKRGRLLLADDMGLGKTVQAICIAAFYRKEWPLLVVVPS
FT                   SVRFTWEQAFLRWLPSLSPENINVVVTGKGRLTAGLVNIVSFDLLCKLERQLKTPFKVV
FT                   IIDESHFLKNIKTARCRAAVPILKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFPQF
FT                   HAFGLRYCDAKRLPWGWDYSGSSNLGELKLLLEEAIMLRRLKSDVLSQLPAKQRKMVVV
FT                   NPGRISSRAKAALDAAAKEMTKDKTKQQQKEALLVFFNRTAEAKIPCVVEYILDLLDSG
FT                   REKFLVFAHHKVILDAVAKELERKNVQHIRIDGSTPSADREAQCQRFQLSKGHTVALLS
FT                   ITAANMGLTFSTADLVVFAELFWNPGVGNVARVPLGMPRAEKYKIRK"
FT   CDS             join(20904106..20904814,20905462..20905512,
FT                   20909474..20909686,20910236..20910286,20914199..20914385,
FT                   20915805..20915955,20917200..20917358,20919798..20919863,
FT                   20930195..20930335,20931709..20931924,20935411..20935481,
FT                   20938935..20939037,20945366..20945548,20947001..20947101,
FT                   20948301..20948397,20951747..20951980)
FT                   /codon_start=1
FT                   /gene="Smarcal1"
FT                   /locus_tag="mCG_112977"
FT                   /product="Swi/SNF related matrix associated, actin
FT                   dependent regulator of chromatin, subfamily a-like 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG112977.1 transcript_id=mCT114054.1
FT                   protein_id=mCP74595.1 isoform=CRA_c"
FT                   /protein_id="EDL00286.1"
FT                   /translation="MSLPLTEEQRKKIEENRQKALARRAEKLSEQPQSAASGSSAAGPS
FT                   QSKQGSLLNLLAEPSKPVGHASIFKQQNLSNSFPTDQRPHSSRCSQPSPAEETTGLWKT
FT                   QGEMSTACPKPNPSPPGASNQPLLGYKSSEGQPQATWDTGASSSGPFPRDPELEAKAAR
FT                   PSTSRQSISDSFYVLGGKTPRTEGRPPNILQTTPQNTGFLRGACIKTGDRFRVKIGYNQ
FT                   ELIAVFKSLPSRHYDSFTKTWDFSMSDYRALMKAVERLSTVSLKPLDEAGGSVGGQTSL
FT                   PSAPSLTFVTGKCMLISRVRFEVDIGYSEAVIGLFKQMESRSYDIKTRKWSFLLEEHNK
FT                   LIARSRELKQVQLDPLPKTVTLAFASQLEKTSPKLKADVPEADLSGVDAKLVSSLMPFQ
FT                   REGVSFAISKRGRLLLADDMGLGKTVQAICIAAFYRKEWPLLVVVPSSVRFTWEQAFLR
FT                   WLPSLSPENINVVVTGKGRLTAGLVNIVSFDLLCKLERQLKTPFKVVIIDESHFLKNIK
FT                   TARCRAAVPILKVAKRVILLSGTPAMSRPAELYTQIIAVKPTFFPQFHAFGLRYCDAKR
FT                   LPWGWDYSGSSNLGELKLLLEEAIMLRRLKSDVLSQLPAKQRKMVVVNPGRISSRAKAA
FT                   LDAAAKEMTKDKTKQQQKEALLVFFNRTAEAKIPCVVEYILDLLDSGREKFLVFAHHKV
FT                   ILDAVAKELERKNVQHIRIDGSTPSADREAQCQRFQLSKGHTVALLSITAANMGLTFST
FT                   ADLVVFAELFWNPGVLIQAEDRVHRIGQTNSVSIHYLVAKGTADDYLWPLIQEKIKVLG
FT                   EAGLSETNFSEMTEATDYVHKDPKQKTIYDLFQQSFEDDGNDMEFLEAAESFELGSTSG
FT                   TSGNISQDLGDLLDEDEGSPPKKSRFEFFDNWDSFSSPF"
FT   gap             20920553..20920572
FT                   /estimated_length=20
FT   gap             20922482..20922501
FT                   /estimated_length=20
FT   gene            complement(20961907..21019271)
FT                   /gene="Ankar"
FT                   /locus_tag="mCG_1035711"
FT                   /note="gene_id=mCG1035711.1"
FT   mRNA            complement(join(20961907..20962238,20963851..20963897,
FT                   20965921..20966117,20969001..20969110,20969811..20969928,
FT                   20970575..20970733,20971218..20971340,20974972..20975078,
FT                   20977280..20977441,20977519..20977672,20977847..20978088,
FT                   20983950..20984118,20985207..20985448,20988953..20989057,
FT                   20992836..20993044,20994534..20994735,20998440..20998478,
FT                   20998912..20999131,21000524..21000704,21006439..21006542,
FT                   21007264..21007427,21008646..21009083,21019143..21019271))
FT                   /gene="Ankar"
FT                   /locus_tag="mCG_1035711"
FT                   /product="ankyrin and armadillo repeat containing,
FT                   transcript variant mCT182078"
FT                   /note="gene_id=mCG1035711.1 transcript_id=mCT182078.0
FT                   created on 21-APR-2003"
FT   mRNA            complement(join(<20961934..20962238,20963851..20963897,
FT                   20965921..20966117,20969001..20969110,20969811..20969928,
FT                   20970575..20970733,20971218..20971340,20974972..20975078,
FT                   20977280..20977441,20977519..20977672,20977847..20978088,
FT                   20983950..20984118,20985207..20985448,20988953..20989057,
FT                   20992836..20993044,20994534..20994735,20998440..20998478,
FT                   20998912..20999131,21000524..21000704,21006439..21006542,
FT                   21007264..21007427,21008646..21009083,21017112..21017747,
FT                   21019143..21019257))
FT                   /gene="Ankar"
FT                   /locus_tag="mCG_1035711"
FT                   /product="ankyrin and armadillo repeat containing,
FT                   transcript variant mCT153415"
FT                   /note="gene_id=mCG1035711.1 transcript_id=mCT153415.1
FT                   created on 21-APR-2003"
FT   CDS             complement(join(20961934..20962238,20963851..20963897,
FT                   20965921..20966117,20969001..20969110,20969811..20969928,
FT                   20970575..20970733,20971218..20971340,20974972..20975078,
FT                   20977280..20977441,20977519..20977672,20977847..20978088,
FT                   20983950..20984118,20985207..20985448,20988953..20989057,
FT                   20992836..20993044,20994534..20994735,20998440..20998478,
FT                   20998912..20999131,21000524..21000704,21006439..21006542,
FT                   21007264..21007427,21008646..21009083,21017112..21017712))
FT                   /codon_start=1
FT                   /gene="Ankar"
FT                   /locus_tag="mCG_1035711"
FT                   /product="ankyrin and armadillo repeat containing, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1035711.1 transcript_id=mCT153415.1
FT                   protein_id=mCP74438.1 isoform=CRA_a"
FT                   /protein_id="EDL00287.1"
FT                   /translation="MSRIVKKGIVKIDQEQDEETFRENLAVQRNASAFFEKYDRTEVQE
FT                   LLTTTLVSWLAAKDDARSQLETPCGLMSQMNNAGFSTAILLTPVDPTALLDYREVHQIL
FT                   RELAIGIYCLNQIPSISLEANFDQSSSCQLPPAYYDTRVGQILIQIDYMLKALWHGIYM
FT                   PKEKRARFSELWRTIMDIDLDGKPQTTKNVFSEFSSAGLVDITNDPDFNGIYDEDMNED
FT                   PTYEPNSPEEKAVFMKYAESIMMKLTFSTVQIQQHENIFIFETAYWLSNAIKYNQDYLD
FT                   ICTYQRLQKRLYLQKKVIQKHFEKKKEIRRGMGYLKLICFLIPFLLSLKRKMKVPYLNS
FT                   LLPPFSDDKVKTERELPPFIYGRDFKCQNFDYKQHQYFHVHGGIEFDISTHPVESALDE
FT                   FKKNVEKIWECASSASAEDAGYKEVYPIPVMELNGKSYYVIHFELEIFYQQLYKTQWWV
FT                   AINETVNNLKVKRLPLTEDQLHEQFKKKFGLKKAMKCKSIPFGVKSAVERGLSAVFYTF
FT                   SRKTSSSTINVSDEAGYAIFHHAALHNRVSVICQLWSANFNVNQRRFIMFSQADSSKVD
FT                   MKKERNGPTPLHLAAQACSLEATICLLCFKADYTLTEKRGWMPIHFAAFYDNICILIAL
FT                   CRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSLGANWRKTDTKGNNIIHLSVL
FT                   AFHTEVLKYIIELNIPELPVWETLVEMLQCESSKRRMMAVMSLEVICLANDRYWQCILD
FT                   AGTIPALVNLLKSPQIKLQYKTVGLLSNISTHVSIVHAIVEAGGIPAVINLLTSDEPEL
FT                   HSRCAIILYDVAKCENKDVIAKYSGIPALINLLSLNKESVLVNVMNCIRVLCMGNESNQ
FT                   QSMKDNNGIQYLIQFLSSDSDVLKALSSATIAEVARDNKEVQDAIAKEGAIPPLVTLFK
FT                   GKQLSVQVKGAMAVESLANCNPLIQKEFLERELTKDLLKLLQAFQIDVKEQGAIALWAL
FT                   AGQTLKQQKYMAEQIGYNLIISMLLSPSAKMQYVGGEAVIALSKDSRMHQNQICEGKGI
FT                   APLVRLLRINKIPEGTLLSVIRAVGSICIGVAHTSNPMSQQFVVEENALPVLIQLLRNH
FT                   PSINIRVEVAFSLACIVLGNNSLKKELQNDEGFEYSDVLYLLHSKDKEVCLKAGYALTL
FT                   FAFNDRFQQHLILETGLITVSIFEPFLQSSVETERAMAAFQIIILAKAIIDVEHVTLYG
FT                   RGIQILADSLNSVHAPTIALTGNIIASLAHSRAGIPEAFVSLGTVQRLCYHLYARSEEV
FT                   RTACSCALGYLTYNAHAFRLLLTECRNKPNQFLRITNNISKDAKINPAFLKEFQLQQRM
FT                   GLPSLSLERNGGPPVIPVFKKGKEHRQKTRPKIQPRDSLTLLPPVTNVKELFRTTHKAN
FT                   ISHNTFSFPSGVSSDIINVSRPRIAFLNKLGKDEQKANPDPPAFLNKLGKDEQNANPDP
FT                   AESQ"
FT   CDS             complement(join(20961934..20962238,20963851..20963897,
FT                   20965921..20966117,20969001..20969110,20969811..20969928,
FT                   20970575..20970733,20971218..20971340,20974972..20975078,
FT                   20977280..20977441,20977519..20977672,20977847..20978088,
FT                   20983950..20984118,20985207..20985448,20988953..20989057,
FT                   20992836..20993044,20994534..20994735,20998440..20998478,
FT                   20998912..20999131,21000524..21000704,21006439..21006542,
FT                   21007264..21007427,21008646..21009030))
FT                   /codon_start=1
FT                   /gene="Ankar"
FT                   /locus_tag="mCG_1035711"
FT                   /product="ankyrin and armadillo repeat containing, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1035711.1 transcript_id=mCT182078.0
FT                   protein_id=mCP105000.0 isoform=CRA_b"
FT                   /protein_id="EDL00288.1"
FT                   /translation="MNEDPTYEPNSPEEKAVFMKYAESIMMKLTFSTVQIQQHENIFIF
FT                   ETAYWLSNAIKYNQDYLDICTYQRLQKRLYLQKKVIQKHFEKKKEIRRGMGYLKLICFL
FT                   IPFLLSLKRKMKVPYLNSLLPPFSDDKVKTERELPPFIYGRDFKCQNFDYKQHQYFHVH
FT                   GGIEFDISTHPVESALDEFKKNVEKIWECASSASAEDAGYKEVYPIPVMELNGKSYYVI
FT                   HFELEIFYQQLYKTQWWVAINETVNNLKVKRLPLTEDQLHEQFKKKFGLKKAMKCKSIP
FT                   FGVKSAVERGLSAVFYTFSRKTSSSTINVSDEAGYAIFHHAALHNRVSVICQLWSANFN
FT                   VNQRRFIMFSQADSSKVDMKKERNGPTPLHLAAQACSLEATICLLCFKADYTLTEKRGW
FT                   MPIHFAAFYDNICILIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFSLGA
FT                   NWRKTDTKGNNIIHLSVLAFHTEVLKYIIELNIPELPVWETLVEMLQCESSKRRMMAVM
FT                   SLEVICLANDRYWQCILDAGTIPALVNLLKSPQIKLQYKTVGLLSNISTHVSIVHAIVE
FT                   AGGIPAVINLLTSDEPELHSRCAIILYDVAKCENKDVIAKYSGIPALINLLSLNKESVL
FT                   VNVMNCIRVLCMGNESNQQSMKDNNGIQYLIQFLSSDSDVLKALSSATIAEVARDNKEV
FT                   QDAIAKEGAIPPLVTLFKGKQLSVQVKGAMAVESLANCNPLIQKEFLERELTKDLLKLL
FT                   QAFQIDVKEQGAIALWALAGQTLKQQKYMAEQIGYNLIISMLLSPSAKMQYVGGEAVIA
FT                   LSKDSRMHQNQICEGKGIAPLVRLLRINKIPEGTLLSVIRAVGSICIGVAHTSNPMSQQ
FT                   FVVEENALPVLIQLLRNHPSINIRVEVAFSLACIVLGNNSLKKELQNDEGFEYSDVLYL
FT                   LHSKDKEVCLKAGYALTLFAFNDRFQQHLILETGLITVSIFEPFLQSSVETERAMAAFQ
FT                   IIILAKAIIDVEHVTLYGRGIQILADSLNSVHAPTIALTGNIIASLAHSRAGIPEAFVS
FT                   LGTVQRLCYHLYARSEEVRTACSCALGYLTYNAHAFRLLLTECRNKPNQFLRITNNISK
FT                   DAKINPAFLKEFQLQQRMGLPSLSLERNGGPPVIPVFKKGKEHRQKTRPKIQPRDSLTL
FT                   LPPVTNVKELFRTTHKANISHNTFSFPSGVSSDIINVSRPRIAFLNKLGKDEQKANPDP
FT                   PAFLNKLGKDEQNANPDPAESQ"
FT   gap             20966441..20966508
FT                   /estimated_length=68
FT   gap             20999948..21000157
FT                   /estimated_length=210
FT   gene            21029433..21031987
FT                   /locus_tag="mCG_112980"
FT                   /note="gene_id=mCG112980.1"
FT   mRNA            join(21029433..21029494,21029843..21029971,
FT                   21030313..21030395,21031673..21031987)
FT                   /locus_tag="mCG_112980"
FT                   /product="mCG112980, transcript variant mCT114057"
FT                   /note="gene_id=mCG112980.1 transcript_id=mCT114057.1
FT                   created on 19-JUL-2002"
FT   mRNA            join(<21029481..21029971,21030313..21030395,
FT                   21031673..21031790)
FT                   /locus_tag="mCG_112980"
FT                   /product="mCG112980, transcript variant mCT170698"
FT                   /note="gene_id=mCG112980.1 transcript_id=mCT170698.0
FT                   created on 19-JUL-2002"
FT   CDS             join(21029492..21029494,21029843..21029971,
FT                   21030313..21030395,21031673..21031736)
FT                   /codon_start=1
FT                   /locus_tag="mCG_112980"
FT                   /product="mCG112980, isoform CRA_a"
FT                   /note="gene_id=mCG112980.1 transcript_id=mCT114057.1
FT                   protein_id=mCP74616.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q4VAF2"
FT                   /db_xref="InterPro:IPR002674"
FT                   /db_xref="InterPro:IPR011331"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="MGI:MGI:98068"
FT                   /db_xref="UniProtKB/TrEMBL:Q4VAF2"
FT                   /protein_id="EDL00289.1"
FT                   /translation="MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKT
FT                   KMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKDQ"
FT   CDS             join(<21029747..21029971,21030313..21030395,
FT                   21031673..21031736)
FT                   /codon_start=1
FT                   /locus_tag="mCG_112980"
FT                   /product="mCG112980, isoform CRA_b"
FT                   /note="gene_id=mCG112980.1 transcript_id=mCT170698.0
FT                   protein_id=mCP93616.0 isoform=CRA_b"
FT                   /protein_id="EDL00290.1"
FT                   /translation="GKTGFSRVCAQRRVGVHRLAQCLCSVPFLCQQAKRTKKVGIVGKY
FT                   GTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNT
FT                   TSAVTVKSAIRRLKELKDQ"
FT   gap             21038113..21038132
FT                   /estimated_length=20
FT   gap             21039535..21039700
FT                   /estimated_length=166
FT   gap             21043011..21043039
FT                   /estimated_length=29
FT   gap             21072973..21072994
FT                   /estimated_length=22
FT   gene            21086045..21171036
FT                   /gene="Igfbp2"
FT                   /locus_tag="mCG_112979"
FT                   /note="gene_id=mCG112979.1"
FT   mRNA            join(21086045..21086065,21143057..21143514,
FT                   21167649..21167875,21168127..21168267,21170561..21171036)
FT                   /gene="Igfbp2"
FT                   /locus_tag="mCG_112979"
FT                   /product="insulin-like growth factor binding protein 2,
FT                   transcript variant mCT114056"
FT                   /note="gene_id=mCG112979.1 transcript_id=mCT114056.1
FT                   created on 19-JUL-2002"
FT   gap             21089277..21089549
FT                   /estimated_length=273
FT   gap             21093647..21093710
FT                   /estimated_length=64
FT   gap             21095425..21095444
FT                   /estimated_length=20
FT   gap             21100011..21106969
FT                   /estimated_length=6959
FT   gap             21119281..21119557
FT                   /estimated_length=277
FT   gap             21120781..21121797
FT                   /estimated_length=1017
FT   gap             21133714..21133764
FT                   /estimated_length=51
FT   gap             21142845..21143055
FT                   /estimated_length=211
FT   mRNA            join(<21143056..21143104,21143257..21143514,
FT                   21167649..21167875,21168127..21168267,21170561..21171036)
FT                   /gene="Igfbp2"
FT                   /locus_tag="mCG_112979"
FT                   /product="insulin-like growth factor binding protein 2,
FT                   transcript variant mCT170696"
FT                   /note="gene_id=mCG112979.1 transcript_id=mCT170696.0
FT                   created on 19-JUL-2002"
FT   mRNA            join(<21143056..21143268,21167731..21167875,
FT                   21168127..21168267,21170561..21170826)
FT                   /gene="Igfbp2"
FT                   /locus_tag="mCG_112979"
FT                   /product="insulin-like growth factor binding protein 2,
FT                   transcript variant mCT170697"
FT                   /note="gene_id=mCG112979.1 transcript_id=mCT170697.0
FT                   created on 19-JUL-2002"
FT   CDS             join(<21143056..21143104,21143257..21143514,
FT                   21167649..21167875,21168127..21168267,21170561..21170725)
FT                   /codon_start=1
FT                   /gene="Igfbp2"
FT                   /locus_tag="mCG_112979"
FT                   /product="insulin-like growth factor binding protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG112979.1 transcript_id=mCT170696.0
FT                   protein_id=mCP93615.0 isoform=CRA_a"
FT                   /protein_id="EDL00291.1"
FT                   /translation="ASPRIRLGRATCPLARCTPERLAACGPPPDAPCAELVREPGCGCC
FT                   SVCARQEGEACGVYIPRCAQTLRCYPNPGSELPLKALVTGAGTCEKRRVGTTPQQVADS
FT                   DDDHSEGGLVENHVDGTMNMLGGGSSAGRKPLKSGMKELAVFREKVNEQHRQMGKGAKH
FT                   LSLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDDRGPLEHLYSLHIPNCDKHGRYN
FT                   LKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIRGDPECHLFYNEQQETGGAHAQSVQ"
FT   CDS             join(<21143099..21143268,21167731..21167875,
FT                   21168127..21168267,21170561..21170725)
FT                   /codon_start=1
FT                   /gene="Igfbp2"
FT                   /locus_tag="mCG_112979"
FT                   /product="insulin-like growth factor binding protein 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG112979.1 transcript_id=mCT170697.0
FT                   protein_id=mCP93614.0 isoform=CRA_b"
FT                   /protein_id="EDL00292.1"
FT                   /translation="LAALPLPTSQHAAEIGRPRAAAAPAVVALAAALGRGRLRPRGARR
FT                   GAVPLPTLHARAAGRKPLKSGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPA
FT                   RTPCQQELDQVLERISTMRLPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGE
FT                   CWCVNPNTGKPIQGAPTIRGDPECHLFYNEQQETGGAHAQSVQ"
FT   CDS             join(21143130..21143514,21167649..21167875,
FT                   21168127..21168267,21170561..21170725)
FT                   /codon_start=1
FT                   /gene="Igfbp2"
FT                   /locus_tag="mCG_112979"
FT                   /product="insulin-like growth factor binding protein 2,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG112979.1 transcript_id=mCT114056.1
FT                   protein_id=mCP74613.0 isoform=CRA_c"
FT                   /db_xref="GOA:P47877"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR009168"
FT                   /db_xref="InterPro:IPR012210"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="InterPro:IPR022321"
FT                   /db_xref="MGI:MGI:96437"
FT                   /db_xref="UniProtKB/Swiss-Prot:P47877"
FT                   /protein_id="EDL00293.1"
FT                   /translation="MLPRLGGPALPLLLPSLLLLLLLGAGGCGPGVRAEVLFRCPPCTP
FT                   ERLAACGPPPDAPCAELVREPGCGCCSVCARQEGEACGVYIPRCAQTLRCYPNPGSELP
FT                   LKALVTGAGTCEKRRVGTTPQQVADSDDDHSEGGLVENHVDGTMNMLGGGSSAGRKPLK
FT                   SGMKELAVFREKVNEQHRQMGKGAKHLSLEEPKKLRPPPARTPCQQELDQVLERISTMR
FT                   LPDDRGPLEHLYSLHIPNCDKHGRYNLKQCKMSLNGQRGECWCVNPNTGKPIQGAPTIR
FT                   GDPECHLFYNEQQETGGAHAQSVQ"
FT   gap             21153024..21153247
FT                   /estimated_length=224
FT   gene            complement(21176599..21193615)
FT                   /gene="Igfbp5"
FT                   /locus_tag="mCG_112978"
FT                   /note="gene_id=mCG112978.2"
FT   mRNA            complement(join(21176599..21181076,21181711..21181830,
FT                   21182419..21182648,21192522..>21193234))
FT                   /gene="Igfbp5"
FT                   /locus_tag="mCG_112978"
FT                   /product="insulin-like growth factor binding protein 5,
FT                   transcript variant mCT189280"
FT                   /note="gene_id=mCG112978.2 transcript_id=mCT189280.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(21176600..21176792,21179278..21181076,
FT                   21181711..21181830,21182419..21182648,21192522..21193615))
FT                   /gene="Igfbp5"
FT                   /locus_tag="mCG_112978"
FT                   /product="insulin-like growth factor binding protein 5,
FT                   transcript variant mCT114055"
FT                   /note="gene_id=mCG112978.2 transcript_id=mCT114055.1
FT                   created on 19-JUL-2002"
FT   CDS             complement(join(21180945..21181076,21181711..21181830,
FT                   21182419..21182648,21192522..>21193041))
FT                   /codon_start=1
FT                   /gene="Igfbp5"
FT                   /locus_tag="mCG_112978"
FT                   /product="insulin-like growth factor binding protein 5,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG112978.2 transcript_id=mCT189280.0
FT                   protein_id=mCP110235.0 isoform=CRA_b"
FT                   /protein_id="EDL00295.1"
FT                   /translation="SSQLGLACRHLNPPCLIFCKCLGESTCSTCKRFKRKKISRLPLSP
FT                   HTLALLPRPEVKPDSEKMVISVVLLLLAAYAVPAQGLGSFVHCEPCDEKALSMCPPSPL
FT                   GCELVKEPGCGCCMTCALAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLN
FT                   EKSYGEQTKIERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLT
FT                   QSKFVGGAENTAHPRVIPAPEMRQESEQGPCRRHMEASLQEFKASPRMVPRAVYLPNCD
FT                   RKGFYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHAFDSSNVE"
FT   CDS             complement(join(21180945..21181076,21181711..21181830,
FT                   21182419..21182648,21192522..21192855))
FT                   /codon_start=1
FT                   /gene="Igfbp5"
FT                   /locus_tag="mCG_112978"
FT                   /product="insulin-like growth factor binding protein 5,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG112978.2 transcript_id=mCT114055.1
FT                   protein_id=mCP74611.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UQV0"
FT                   /db_xref="InterPro:IPR000716"
FT                   /db_xref="InterPro:IPR000867"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR009168"
FT                   /db_xref="InterPro:IPR012213"
FT                   /db_xref="InterPro:IPR017891"
FT                   /db_xref="InterPro:IPR022321"
FT                   /db_xref="MGI:MGI:96440"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UQV0"
FT                   /protein_id="EDL00294.1"
FT                   /translation="MVISVVLLLLAAYAVPAQGLGSFVHCEPCDEKALSMCPPSPLGCE
FT                   LVKEPGCGCCMTCALAEGQSCGVYTERCAQGLRCLPRQDEEKPLHALLHGRGVCLNEKS
FT                   YGEQTKIERDSREHEEPTTSEMAEETYSPKVFRPKHTRISELKAEAVKKDRRKKLTQSK
FT                   FVGGAENTAHPRVIPAPEMRQESEQGPCRRHMEASLQEFKASPRMVPRAVYLPNCDRKG
FT                   FYKRKQCKPSRGRKRGICWCVDKYGMKLPGMEYVDGDFQCHAFDSSNVE"
FT   gap             21184126..21184293
FT                   /estimated_length=168
FT   gap             21194337..21194474
FT                   /estimated_length=138
FT   gap             21212498..21212697
FT                   /estimated_length=200
FT   gap             21215063..21215857
FT                   /estimated_length=795
FT   gap             21216907..21216926
FT                   /estimated_length=20
FT   gap             21218250..21218269
FT                   /estimated_length=20
FT   gap             21219401..21219420
FT                   /estimated_length=20
FT   gap             21220764..21220970
FT                   /estimated_length=207
FT   gap             21229637..21229656
FT                   /estimated_length=20
FT   gap             21235857..21236068
FT                   /estimated_length=212
FT   gap             21238737..21238828
FT                   /estimated_length=92
FT   gap             21242507..21242764
FT                   /estimated_length=258
FT   gap             21244517..21244536
FT                   /estimated_length=20
FT   gap             21256778..21256797
FT                   /estimated_length=20
FT   gap             21260398..21260417
FT                   /estimated_length=20
FT   gene            <21260833..21265676
FT                   /locus_tag="mCG_1035714"
FT                   /note="gene_id=mCG1035714.1"
FT   mRNA            join(<21260833..21260926,21261019..21261119,
FT                   21261298..21261435,21264436..21264480,21265624..21265676)
FT                   /locus_tag="mCG_1035714"
FT                   /product="mCG1035714"
FT                   /note="gene_id=mCG1035714.1 transcript_id=mCT153418.1
FT                   created on 21-APR-2003"
FT   CDS             join(<21260835..21260926,21261019..21261067)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035714"
FT                   /product="mCG1035714"
FT                   /note="gene_id=mCG1035714.1 transcript_id=mCT153418.1
FT                   protein_id=mCP74627.1"
FT                   /protein_id="EDL00296.1"
FT                   /translation="TGAKEGLDSLFLWGWWLQLQIRGAVNVFPRSTQQAGQAGELWELK
FT                   R"
FT   gene            21266422..21285029
FT                   /locus_tag="mCG_1035565"
FT                   /note="gene_id=mCG1035565.1"
FT   mRNA            join(21266422..21266549,21266694..21266831,
FT                   21281653..21281998,21284605..21285029)
FT                   /locus_tag="mCG_1035565"
FT                   /product="mCG1035565"
FT                   /note="gene_id=mCG1035565.1 transcript_id=mCT153269.0
FT                   created on 18-MAR-2003"
FT   CDS             join(21266493..21266549,21266694..21266831,
FT                   21281653..21281730)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035565"
FT                   /product="mCG1035565"
FT                   /note="gene_id=mCG1035565.1 transcript_id=mCT153269.0
FT                   protein_id=mCP74808.1"
FT                   /protein_id="EDL00297.1"
FT                   /translation="MCSPVGPASAKHGVSRPHHKQGSYTAGGLLQGQLGLHSLNLSQHL
FT                   LEASPPPVPPYSLVFLSCFKCSMTLGFRGDFHQNLAICSNIQRAK"
FT   gap             21273026..21273761
FT                   /estimated_length=736
FT   gap             21279092..21279198
FT                   /estimated_length=107
FT   gap             21280352..21280501
FT                   /estimated_length=150
FT   gene            21287916..21297483
FT                   /locus_tag="mCG_146951"
FT                   /note="gene_id=mCG146951.0"
FT   mRNA            join(21287916..21287956,21295031..21297483)
FT                   /locus_tag="mCG_146951"
FT                   /product="mCG146951"
FT                   /note="gene_id=mCG146951.0 transcript_id=mCT187214.0
FT                   created on 13-JAN-2004"
FT   gap             21288611..21288770
FT                   /estimated_length=160
FT   CDS             21295548..21295787
FT                   /codon_start=1
FT                   /locus_tag="mCG_146951"
FT                   /product="mCG146951"
FT                   /note="gene_id=mCG146951.0 transcript_id=mCT187214.0
FT                   protein_id=mCP109550.0"
FT                   /protein_id="EDL00298.1"
FT                   /translation="MAHCLVDDSWWLLAKRGKEKGKRSRLPLLQVLKMELNETEGLWSL
FT                   GSGSTSAYPFCWFPDDEDSLSFSPLGQSLRERLF"
FT   gap             21301091..21301137
FT                   /estimated_length=47
FT   gene            complement(21339418..21340234)
FT                   /gene="Tnp1"
FT                   /locus_tag="mCG_112976"
FT                   /note="gene_id=mCG112976.1"
FT   mRNA            complement(join(21339418..21339666,21340066..21340234))
FT                   /gene="Tnp1"
FT                   /locus_tag="mCG_112976"
FT                   /product="transition protein 1"
FT                   /note="gene_id=mCG112976.1 transcript_id=mCT114053.1
FT                   created on 19-JUL-2002"
FT   CDS             complement(join(21339638..21339666,21340066..21340204))
FT                   /codon_start=1
FT                   /gene="Tnp1"
FT                   /locus_tag="mCG_112976"
FT                   /product="transition protein 1"
FT                   /note="gene_id=mCG112976.1 transcript_id=mCT114053.1
FT                   protein_id=mCP74873.1"
FT                   /db_xref="GOA:Q545L6"
FT                   /db_xref="InterPro:IPR001319"
FT                   /db_xref="InterPro:IPR020062"
FT                   /db_xref="MGI:MGI:98784"
FT                   /db_xref="UniProtKB/TrEMBL:Q545L6"
FT                   /protein_id="EDL00299.1"
FT                   /translation="MSTSRKLKTHGMRRGKNRAPHKGVKRGGSKRKYRKSVLKSRKRGD
FT                   DASRNYRSHL"
FT   gene            21340376..21351634
FT                   /locus_tag="mCG_112981"
FT                   /note="gene_id=mCG112981.1"
FT   mRNA            join(21340376..21340435,21341847..21341942,
FT                   21351458..21351634)
FT                   /locus_tag="mCG_112981"
FT                   /product="mCG112981"
FT                   /note="gene_id=mCG112981.1 transcript_id=mCT114058.1
FT                   created on 10-SEP-2002"
FT   gap             21345676..21345695
FT                   /estimated_length=20
FT   gap             21346998..21347017
FT                   /estimated_length=20
FT   gap             21348034..21348561
FT                   /estimated_length=528
FT   CDS             21351468..21351614
FT                   /codon_start=1
FT                   /locus_tag="mCG_112981"
FT                   /product="mCG112981"
FT                   /note="gene_id=mCG112981.1 transcript_id=mCT114058.1
FT                   protein_id=mCP74633.1"
FT                   /protein_id="EDL00300.1"
FT                   /translation="MLWLKKLLDTMKYQVTFVPIVDSKNDGSRCKPKATVIIVELASPP
FT                   QGL"
FT   gap             21356396..21356443
FT                   /estimated_length=48
FT   gap             21427967..21427986
FT                   /estimated_length=20
FT   gap             21431426..21431962
FT                   /estimated_length=537
FT   gap             21436590..21437010
FT                   /estimated_length=421
FT   gap             21448171..21448269
FT                   /estimated_length=99
FT   gap             21461932..21462112
FT                   /estimated_length=181
FT   gap             21467104..21467129
FT                   /estimated_length=26
FT   gap             21479785..21479920
FT                   /estimated_length=136
FT   gap             21497590..21497609
FT                   /estimated_length=20
FT   gap             21528163..21528278
FT                   /estimated_length=116
FT   gap             21531233..21531692
FT                   /estimated_length=460
FT   gap             21544018..21544263
FT                   /estimated_length=246
FT   gap             21605485..21605632
FT                   /estimated_length=148
FT   gap             21621054..21621073
FT                   /estimated_length=20
FT   gap             21625398..21625417
FT                   /estimated_length=20
FT   gap             21638290..21638466
FT                   /estimated_length=177
FT   gap             21643118..21643481
FT                   /estimated_length=364
FT   gap             21647590..21650282
FT                   /estimated_length=2693
FT   gap             21656240..21656449
FT                   /estimated_length=210
FT   gene            21690546..21704657
FT                   /locus_tag="mCG_1035715"
FT                   /note="gene_id=mCG1035715.1"
FT   mRNA            join(21690546..21690638,21691254..21691449,
FT                   21693013..21693102,21696551..21696673,21696801..21696889,
FT                   21704601..21704657)
FT                   /locus_tag="mCG_1035715"
FT                   /product="mCG1035715"
FT                   /note="gene_id=mCG1035715.1 transcript_id=mCT153419.1
FT                   created on 19-MAR-2003"
FT   CDS             join(21691369..21691449,21693013..21693102,
FT                   21696551..21696673,21696801..21696857)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035715"
FT                   /product="mCG1035715"
FT                   /note="gene_id=mCG1035715.1 transcript_id=mCT153419.1
FT                   protein_id=mCP74636.1"
FT                   /protein_id="EDL00301.1"
FT                   /translation="MRPRCVCFLAELIGPGHHGCKDAICVKLAWLPSPWDLPASSPPAL
FT                   MLHVWMPGVKVNTSPTSLLTSQKRAATYLTLTTTDVVNTLSETHFWTCADSFLGGQSLK
FT                   EKKDSLINEYFQ"
FT   gap             21719017..21719036
FT                   /estimated_length=20
FT   gene            <21725067..21756416
FT                   /locus_tag="mCG_144891"
FT                   /note="gene_id=mCG144891.0"
FT   mRNA            join(<21725067..21725202,21728688..21728816,
FT                   21756129..21756416)
FT                   /locus_tag="mCG_144891"
FT                   /product="mCG144891"
FT                   /note="gene_id=mCG144891.0 transcript_id=mCT184315.0
FT                   created on 05-JUN-2003"
FT   CDS             <21756129..21756401
FT                   /codon_start=1
FT                   /locus_tag="mCG_144891"
FT                   /product="mCG144891"
FT                   /note="gene_id=mCG144891.0 transcript_id=mCT184315.0
FT                   protein_id=mCP106120.0"
FT                   /protein_id="EDL00302.1"
FT                   /translation="IYTHTHSACMYPCAPHACLLSEEIRRSIWSSRTGIMDASELATEP
FT                   RSSSKATSGLNHQAISPALLQLLDKLFSFVLYWVSLSFLTNFFLK"
FT   gap             21791554..21795625
FT                   /estimated_length=4072
FT   gap             21798160..21798542
FT                   /estimated_length=383
FT   gap             21800527..21800546
FT                   /estimated_length=20
FT   gap             21804739..21804782
FT                   /estimated_length=44
FT   gap             21808586..21808781
FT                   /estimated_length=196
FT   gap             21810691..21810738
FT                   /estimated_length=48
FT   gap             21812657..21812676
FT                   /estimated_length=20
FT   gap             21853632..21853660
FT                   /estimated_length=29
FT   gap             21859804..21859891
FT                   /estimated_length=88
FT   gap             21884099..21884192
FT                   /estimated_length=94
FT   gap             21889155..21889174
FT                   /estimated_length=20
FT   gap             21895403..21895526
FT                   /estimated_length=124
FT   gap             21898724..21898743
FT                   /estimated_length=20
FT   gene            complement(21941323..22182220)
FT                   /locus_tag="mCG_1035719"
FT                   /note="gene_id=mCG1035719.2"
FT   mRNA            complement(join(21941323..21941901,21943431..21943659,
FT                   21989782..21989852,22175820..22175852,22176318..22176614,
FT                   22177371..22177621,22178723..22178806,22180413..22180870,
FT                   22182128..22182220))
FT                   /locus_tag="mCG_1035719"
FT                   /product="mCG1035719, transcript variant mCT153424"
FT                   /note="gene_id=mCG1035719.2 transcript_id=mCT153424.2
FT                   created on 13-JUN-2003"
FT   mRNA            complement(join(21941323..21941901,21943431..21943659,
FT                   21989782..21989852,22060923..22061274))
FT                   /locus_tag="mCG_1035719"
FT                   /product="mCG1035719, transcript variant mCT153423"
FT                   /note="gene_id=mCG1035719.2 transcript_id=mCT153423.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(21943482..21943655)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035719"
FT                   /product="mCG1035719, isoform CRA_a"
FT                   /note="gene_id=mCG1035719.2 transcript_id=mCT153423.0
FT                   protein_id=mCP74659.1 isoform=CRA_a"
FT                   /protein_id="EDL00303.1"
FT                   /translation="MLTWHCFTQHSRCKCGEWRACKQLDGCSLEINSPGAGMLLKEACM
FT                   RSTWWMLKCWES"
FT   gap             21963625..21963644
FT                   /estimated_length=20
FT   gap             21989429..21989667
FT                   /estimated_length=239
FT   gap             22004499..22004764
FT                   /estimated_length=266
FT   gap             22017830..22018625
FT                   /estimated_length=796
FT   gap             22027033..22030017
FT                   /estimated_length=2985
FT   gap             22057185..22057338
FT                   /estimated_length=154
FT   gap             22065382..22065458
FT                   /estimated_length=77
FT   gap             22113781..22114576
FT                   /estimated_length=796
FT   gap             22117960..22118924
FT                   /estimated_length=965
FT   gap             22143530..22143633
FT                   /estimated_length=104
FT   gap             22144835..22144978
FT                   /estimated_length=144
FT   gap             22150586..22151012
FT                   /estimated_length=427
FT   CDS             complement(22180587..22180814)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1035719"
FT                   /product="mCG1035719, isoform CRA_b"
FT                   /note="gene_id=mCG1035719.2 transcript_id=mCT153424.2
FT                   protein_id=mCP74662.1 isoform=CRA_b"
FT                   /protein_id="EDL00304.1"
FT                   /translation="MGLLLGKPNSSGGQDLKACTGRPSPPGGSVYPCGEALRGPSRGRQ
FT                   RPDLVRQCRRAQENVLASDQAWSVQYPAYA"
FT   gap             22187535..22187628
FT                   /estimated_length=94
FT   gap             22188637..22189306
FT                   /estimated_length=670
FT   gap             22192757..22192776
FT                   /estimated_length=20
FT   gap             22198713..22203832
FT                   /estimated_length=5120
FT   gap             22217447..22217661
FT                   /estimated_length=215
FT   gene            complement(22222364..22254498)
FT                   /locus_tag="mCG_114802"
FT                   /note="gene_id=mCG114802.2"
FT   mRNA            complement(join(22222364..22226799,22228633..22228665,
FT                   22229056..22229124,22229823..22229991,22230188..22230259,
FT                   22231844..22231921,22232697..22232789,22233148..22233279,
FT                   22233957..22234043,22236898..22237961,22240380..22240578,
FT                   22249692..22249784,22253445..22253520,22254377..22254498))
FT                   /locus_tag="mCG_114802"
FT                   /product="mCG114802"
FT                   /note="gene_id=mCG114802.2 transcript_id=mCT115899.1
FT                   created on 31-MAR-2004"
FT   CDS             complement(join(22226655..22226799,22228633..22228665,
FT                   22229056..22229124,22229823..22229991,22230188..22230259,
FT                   22231844..22231921,22232697..22232789,22233148..22233279,
FT                   22233957..22234043,22236898..22237961,22240380..22240578,
FT                   22249692..22249784,22253445..22253484))
FT                   /codon_start=1
FT                   /locus_tag="mCG_114802"
FT                   /product="mCG114802"
FT                   /note="gene_id=mCG114802.2 transcript_id=mCT115899.1
FT                   protein_id=mCP74483.2"
FT                   /protein_id="EDL00305.1"
FT                   /translation="MEGTSPSSPPHSVARSPPGLAKTPLSALGLKPHNPADILLHPTGE
FT                   PRSYVESVARTAVAGPRAQDVEPKSFSAPAAHAYGHETPLRNGTPGGSFVSPSPLSTSS
FT                   PILSADSTSVGSFPSVVSSDQGPRTPFQPMLDSSIRSGSLGQPSPAALSYQSSSPVPVG
FT                   GSSYNSPDYSLQPFSSSPESQGQPQYSAASVHMVPGSPQARHRTVGTNTPPSPGFGRRA
FT                   VNPTMAAPGSPSLSHRQVMGPSGPGFHGNVVSGHPASAATTPGSPSLGRHPVGSHQVPG
FT                   LHSSVVTTPGSPSLGRHPGAHQGNLASSLHSNAVISPGSPSLGRHLGGSGSVVPGSPSL
FT                   DRHAAYGGYSTPEDRRPTLSRQSSASGYQAPSTPSFPVSPAYYPGLSSPATSPSPDSAA
FT                   FRQGSPTPALPEKRRMSVGDRAGSLPNYATINGKVSSSPVANGMASGSSTVSFSHTLPD
FT                   FSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRG
FT                   AYGLAMKVSSPPPTITQQGKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALV
FT                   YQHSVIPLALPCKLVIPSRDPTDESKDSSGPANSTTDLLKQGAACNVLFVNSVDMESLT
FT                   GPQAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKLFFRRHYPLNTVTFCDLD
FT                   PQERKWMKTEGGAPAKLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLSA
FT                   GQKR"
FT   gap             22227085..22227298
FT                   /estimated_length=214
FT   gap             22238141..22238529
FT                   /estimated_length=389
FT   gap             22265084..22265103
FT                   /estimated_length=20
FT   gap             22275395..22275477
FT                   /estimated_length=83
FT   gap             22300187..22300269
FT                   /estimated_length=83
FT   gene            complement(22302075..>22310799)
FT                   /locus_tag="mCG_144501"
FT                   /note="gene_id=mCG144501.0"
FT   mRNA            complement(join(22302075..22302747,22304028..22304092,
FT                   22304453..22304575,22305516..22305566,22307520..22307700,
FT                   22309368..22309423,22310576..>22310799))
FT                   /locus_tag="mCG_144501"
FT                   /product="mCG144501"
FT                   /note="gene_id=mCG144501.0 transcript_id=mCT183925.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(22302549..22302747,22304028..22304092,
FT                   22304453..22304575,22305516..22305566,22307520..22307700,
FT                   22309368..22309423,22310576..>22310602))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144501"
FT                   /product="mCG144501"
FT                   /note="gene_id=mCG144501.0 transcript_id=mCT183925.0
FT                   protein_id=mCP106109.0"
FT                   /protein_id="EDL00306.1"
FT                   /translation="VLLHHQTPRGSMRVSPSIQPQPQSQPTSLSRNTSVSRAMEDSCEL
FT                   DLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNLSEQRPDITKLHA
FT                   KVLEFGWPDLHTPALEKICSVCKAMDTWLNADPHNVVVLHNKGNRGRIGVVIAAYLHYS
FT                   NISASADQALDRFAMKRFYEDKIVPIGQPSQRRWVPGTSPTCAFLWWILCLVHSQGVDS
FT                   YLIEGVSSMGI"
FT   gap             22312895..22313480
FT                   /estimated_length=586
FT   gap             22315160..22315230
FT                   /estimated_length=71
FT   gap             22322526..22323018
FT                   /estimated_length=493
FT   gap             22327723..22327742
FT                   /estimated_length=20
FT   gap             22332333..22332384
FT                   /estimated_length=52
FT   gap             22334341..22334681
FT                   /estimated_length=341
FT   gap             22380820..22382047
FT                   /estimated_length=1228
FT   gap             22383151..22383424
FT                   /estimated_length=274
FT   gap             22387464..22387597
FT                   /estimated_length=134
FT   gap             22398821..22398840
FT                   /estimated_length=20
FT   gap             22405788..22405836
FT                   /estimated_length=49
FT   gap             22422948..22422977
FT                   /estimated_length=30
FT   gap             22430260..22430498
FT                   /estimated_length=239
FT   gap             22435789..22435995
FT                   /estimated_length=207
FT   gap             22438747..22439063
FT                   /estimated_length=317
FT   gap             22440116..22440261
FT                   /estimated_length=146
FT   gap             22453440..22453459
FT                   /estimated_length=20
FT   gene            22465739..22498060
FT                   /gene="Il8rb"
FT                   /locus_tag="mCG_114805"
FT                   /note="gene_id=mCG114805.1"
FT   mRNA            join(22465739..22465856,22470077..22471629,
FT                   22497883..22498060)
FT                   /gene="Il8rb"
FT                   /locus_tag="mCG_114805"
FT                   /product="interleukin 8 receptor, beta"
FT                   /note="gene_id=mCG114805.1 transcript_id=mCT115902.0
FT                   created on 22-JUL-2002"
FT   CDS             22470096..22471175
FT                   /codon_start=1
FT                   /gene="Il8rb"
FT                   /locus_tag="mCG_114805"
FT                   /product="interleukin 8 receptor, beta"
FT                   /note="gene_id=mCG114805.1 transcript_id=mCT115902.0
FT                   protein_id=mCP74689.1"
FT                   /db_xref="GOA:P35343"
FT                   /db_xref="InterPro:IPR000057"
FT                   /db_xref="InterPro:IPR000174"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000355"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:105303"
FT                   /db_xref="UniProtKB/Swiss-Prot:P35343"
FT                   /protein_id="EDL00307.1"
FT                   /translation="MGEFKVDKFNIEDFFSGDLDIFNYSSGMPSILPDAVPCHSENLEI
FT                   NSYAVVVIYVLVTLLSLVGNSLVMLVILYNRSTCSVTDVYLLNLAIADLFFALTLPVWA
FT                   ASKVNGWTFGSTLCKIFSYVKEVTFYSSVLLLACISMDRYLAIVHATSTLIQKRHLVKF
FT                   VCIAMWLLSVILALPILILRNPVKVNLSTLVCYEDVGNNTSRLRVVLRILPQTFGFLVP
FT                   LLIMLFCYGFTLRTLFKAHMGQKHRAMRVIFAVVLVFLLCWLPYNLVLFTDTLMRTKLI
FT                   KETCERRDDIDKALNATEILGFLHSCLNPIIYAFIGQKFRHGLLKIMATYGLVSKEFLA
FT                   KEGRPSFVSSSSANTSTTL"
FT   gap             22503191..22503210
FT                   /estimated_length=20
FT   gene            complement(22503534..>22504607)
FT                   /gene="Il8ra"
FT                   /locus_tag="mCG_1035566"
FT                   /note="gene_id=mCG1035566.1"
FT   mRNA            complement(22503534..>22504607)
FT                   /gene="Il8ra"
FT                   /locus_tag="mCG_1035566"
FT                   /product="interleukin 8 receptor, alpha"
FT                   /note="gene_id=mCG1035566.1 transcript_id=mCT153270.1
FT                   created on 19-SEP-2002"
FT   CDS             complement(22503552..22504607)
FT                   /codon_start=1
FT                   /gene="Il8ra"
FT                   /locus_tag="mCG_1035566"
FT                   /product="interleukin 8 receptor, alpha"
FT                   /note="gene_id=mCG1035566.1 transcript_id=mCT153270.1
FT                   protein_id=mCP74524.0"
FT                   /protein_id="EDL00308.1"
FT                   /translation="MAEAEYFIWTNPEGDFEKEFGNITGMLPTGDYFIPCKRVPITNRQ
FT                   ALVVFYALVSLLSLLGNSLVMLVILYRRRTRSVMDVYVLNLAIADLLFSLTLPFLAVSK
FT                   LKGWIFGTPLCKMVSLLKEFNFFSGILLLACISVDRYLAIVHATRTLARKRYLVKFVCV
FT                   GIWGLSLILSLPFAIFRQAYKPFRSGTVCYEVLGEATTDFRMTLRGLSHIFGFLLPLLT
FT                   MLVCYGLTLRMLFKTHMRQKHRAMGVIFAVVLVFLLCCLPYNLVLLSDTLLGAHLIEDT
FT                   CERRNDIDQALYITEILGFSHSCLNPIIYAFVGQNFRHEFLKILANHGLVRKEVLTHRR
FT                   VAFHTSLTAIY"
FT   gene            22548246..22579942
FT                   /locus_tag="mCG_114810"
FT                   /note="gene_id=mCG114810.2"
FT   mRNA            join(22548246..22548355,22548563..22548792,
FT                   22557823..22557857,22559875..22559987,22562997..22563042,
FT                   22566571..22566757,22567701..22567794,22574202..22574328,
FT                   22575476..22575576,22576086..22576186,22579504..22579942)
FT                   /locus_tag="mCG_114810"
FT                   /product="mCG114810, transcript variant mCT189310"
FT                   /note="gene_id=mCG114810.2 transcript_id=mCT189310.1
FT                   created on 22-APR-2004"
FT   mRNA            join(22548246..22548355,22548563..22548644,
FT                   22557823..22557857,22559875..22559987,22562997..22563042,
FT                   22566571..22566757,22567701..22567794,22574202..22574328,
FT                   22575476..22575576,22576086..22576186,22579504..22579942)
FT                   /locus_tag="mCG_114810"
FT                   /product="mCG114810, transcript variant mCT115907"
FT                   /note="gene_id=mCG114810.2 transcript_id=mCT115907.1
FT                   created on 22-APR-2004"
FT   CDS             join(22548571..22548644,22557823..22557857,
FT                   22559875..22559987,22562997..22563042,22566571..22566757,
FT                   22567701..22567794,22574202..22574328,22575476..22575576,
FT                   22576086..22576186,22579504..22579528)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114810"
FT                   /product="mCG114810, isoform CRA_a"
FT                   /note="gene_id=mCG114810.2 transcript_id=mCT115907.1
FT                   protein_id=mCP74498.2 isoform=CRA_a"
FT                   /protein_id="EDL00309.1"
FT                   /translation="MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHI
FT                   SNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPEPGYNVSLLYDLENLPA
FT                   SKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTV
FT                   VFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGY
FT                   ITFVLFPRHTNATARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRAR
FT                   PDAEKKEMKTITGKTFSSR"
FT   CDS             join(22548767..22548792,22557823..22557857,
FT                   22559875..22559987,22562997..22563042,22566571..22566757,
FT                   22567701..22567794,22574202..22574328,22575476..22575576,
FT                   22576086..22576186,22579504..22579528)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114810"
FT                   /product="mCG114810, isoform CRA_b"
FT                   /note="gene_id=mCG114810.2 transcript_id=mCT189310.1
FT                   protein_id=mCP110296.1 isoform=CRA_b"
FT                   /db_xref="GOA:D3YXG6"
FT                   /db_xref="InterPro:IPR007188"
FT                   /db_xref="MGI:MGI:1923959"
FT                   /db_xref="UniProtKB/TrEMBL:D3YXG6"
FT                   /protein_id="EDL00310.1"
FT                   /translation="MDVGSHGARNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISL
FT                   KFYKELQAHGADELLKRVYGSFLVNPEPGYNVSLLYDLENLPASKDSIVHQAGMLKRNC
FT                   FASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGK
FT                   VFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNATARD
FT                   NTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTF
FT                   SSR"
FT   gene            <22590330..>22591319
FT                   /gene="Gpbar1"
FT                   /locus_tag="mCG_1050345"
FT                   /note="gene_id=mCG1050345.0"
FT   mRNA            <22590330..>22591319
FT                   /gene="Gpbar1"
FT                   /locus_tag="mCG_1050345"
FT                   /product="G protein-coupled bile acid receptor 1"
FT                   /note="gene_id=mCG1050345.0 transcript_id=mCT194351.0
FT                   created on 22-APR-2004"
FT   CDS             22590330..22591319
FT                   /codon_start=1
FT                   /gene="Gpbar1"
FT                   /locus_tag="mCG_1050345"
FT                   /product="G protein-coupled bile acid receptor 1"
FT                   /note="gene_id=mCG1050345.0 transcript_id=mCT194351.0
FT                   protein_id=mCP115380.0"
FT                   /db_xref="GOA:Q14AA9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2653863"
FT                   /db_xref="UniProtKB/TrEMBL:Q14AA9"
FT                   /protein_id="EDL00311.1"
FT                   /translation="MMTPNSTELSAIPMGVLGLSLALASLIVIANLLLALGIALDRHLR
FT                   SPPAGCFFLSLLLAGLLTGLALPMLPGLWSRNHQGYWSCLLLHLTPNFCFLSLLANLLL
FT                   VHGERYMAVLQPLRPHGSVRLALFLTWVSSLFFASLPALGWNHWSPDANCSSQAVFPAP
FT                   YLYLEVYGLLLPAVGATALLSVRVLATAHRQLCEIRRLERAVCRDVPSTLARALTWRQA
FT                   RAQAGATLLFLLCWGPYVATLLLSVLAYERRPPLGPGTLLSLISLGSTSAAAVPVAMGL
FT                   GDQRYTAPWRTAAQRCLRVLRGRAKRDNPGPSTAYHTSSQCSIDLDLN"
FT   gene            complement(22591569..22597359)
FT                   /gene="Aamp"
FT                   /locus_tag="mCG_114812"
FT                   /note="gene_id=mCG114812.1"
FT   mRNA            complement(join(22591569..22592039,22592513..22592667,
FT                   22592819..22592909,22593059..22593162,22593257..22593372,
FT                   22593466..22593549,22593757..22593901,22594141..22594280,
FT                   22594824..22594943,22595616..22595771,22596233..22597359))
FT                   /gene="Aamp"
FT                   /locus_tag="mCG_114812"
FT                   /product="angio-associated migratory protein"
FT                   /note="gene_id=mCG114812.1 transcript_id=mCT115909.1
FT                   created on 21-NOV-2002"
FT   CDS             complement(join(22591964..22592039,22592513..22592667,
FT                   22592819..22592909,22593059..22593162,22593257..22593372,
FT                   22593466..22593549,22593757..22593901,22594141..22594280,
FT                   22594824..22594943,22595616..22595771,22596233..22596353))
FT                   /codon_start=1
FT                   /gene="Aamp"
FT                   /locus_tag="mCG_114812"
FT                   /product="angio-associated migratory protein"
FT                   /note="gene_id=mCG114812.1 transcript_id=mCT115909.1
FT                   protein_id=mCP74510.1"
FT                   /db_xref="GOA:Q3TJ22"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="MGI:MGI:107809"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TJ22"
FT                   /protein_id="EDL00312.1"
FT                   /translation="MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQ
FT                   EMEDVDFEEEEEEEEGNDEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKT
FT                   NTLAVTGGEDDKAFVWRLGDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQ
FT                   VDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCG
FT                   RVLPDGKRAVVGYEDGTIRIWDLKQGNPIHVLKGTEGHQGPLTCVATNQDGSLILTGSV
FT                   DCQAKLVSATTGKVVGVFRPETVASQPSLGEGEESESNSVESLGFCSVMPLAAVGYLDG
FT                   TLAIYDLSTQTLRHQCQHQSGIVQLLWEAGTAVVYTCSLDGVVRLWDARTGRLLTDYRG
FT                   HTAEILDFALSKDASLVVTTSGDHKAKVFCVQRPDR"
FT   gene            22596660..22665045
FT                   /locus_tag="mCG_114807"
FT                   /note="gene_id=mCG114807.3"
FT   mRNA            join(22596660..22596867,22597572..22597740,
FT                   22598822..22598938,22658725..22658840,22658992..22659104,
FT                   22660103..22660161,22660647..22660739,22661053..22661216,
FT                   22661956..22662042,22662876..22662991,22663321..22665045)
FT                   /locus_tag="mCG_114807"
FT                   /product="mCG114807, transcript variant mCT189266"
FT                   /note="gene_id=mCG114807.3 transcript_id=mCT189266.1
FT                   created on 22-APR-2004"
FT   mRNA            join(22596660..22596867,22597572..22597740,
FT                   22658725..22658840,22658992..22659104,22660103..22660161,
FT                   22660647..22660739,22661053..22661216,22661956..22662042,
FT                   22662876..22662991,22663321..22665045)
FT                   /locus_tag="mCG_114807"
FT                   /product="mCG114807, transcript variant mCT171047"
FT                   /note="gene_id=mCG114807.3 transcript_id=mCT171047.1
FT                   created on 22-APR-2004"
FT   mRNA            join(22596660..22596867,22597572..22597740,
FT                   22598822..22599188)
FT                   /locus_tag="mCG_114807"
FT                   /product="mCG114807, transcript variant mCT171048"
FT                   /note="gene_id=mCG114807.3 transcript_id=mCT171048.1
FT                   created on 22-APR-2004"
FT   CDS             join(22596801..22596867,22597572..22597740,
FT                   22598822..22598938,22658725..22658840,22658992..22659104,
FT                   22660103..22660161,22660647..22660739,22661053..22661216,
FT                   22661956..22662042,22662876..22662991,22663321..22663380)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114807"
FT                   /product="mCG114807, isoform CRA_d"
FT                   /note="gene_id=mCG114807.3 transcript_id=mCT189266.1
FT                   protein_id=mCP110241.1 isoform=CRA_d"
FT                   /protein_id="EDL00316.1"
FT                   /translation="MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHS
FT                   SPECKEEPEPLSPELEYIPRKRGKNPMKAVGLAWAIGFPCGILFFVLTKQEVDKDRLKQ
FT                   MKARQNMRVSNTGEYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPI
FT                   PVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGNRD
FT                   LSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEP
FT                   YKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGFA
FT                   GVVEPENLARERKMQWVQRQRMERKSTVSQQRGGHPPPTLHHPLHH"
FT   CDS             join(22596801..22596867,22597572..22597740,
FT                   22658725..22658840,22658992..22659104,22660103..22660161,
FT                   22660647..22660739,22661053..22661216,22661956..22662042,
FT                   22662876..22662991,22663321..22663380)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114807"
FT                   /product="mCG114807, isoform CRA_b"
FT                   /note="gene_id=mCG114807.3 transcript_id=mCT171047.1
FT                   protein_id=mCP93966.1 isoform=CRA_b"
FT                   /protein_id="EDL00314.1"
FT                   /translation="MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHS
FT                   SPECKEEPEPLSPELEYIPRKRGKNPMKAVGLAWYSLYTRTWLGYLFYRQQLRRARNRY
FT                   PKGHSKTQPRLFNGVKVLPIPVLSDNYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERV
FT                   NLVAILCTHKHWDHSGGNRDLSRRHRDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIR
FT                   ALATPGHTQGHLVYLLDGEPYKGPSCLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDL
FT                   GDDTLLWPGHEYAEENLGFAGVVEPENLARERKMQWVQRQRMERKSTVSQQRGGHPPPT
FT                   LHHPLHH"
FT   CDS             join(22596801..22596867,22597572..22597740,
FT                   22598822..22599014)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114807"
FT                   /product="mCG114807, isoform CRA_c"
FT                   /note="gene_id=mCG114807.3 transcript_id=mCT171048.1
FT                   protein_id=mCP93965.1 isoform=CRA_c"
FT                   /protein_id="EDL00315.1"
FT                   /translation="MAAVVAATALKGRGARNARVLRGILSGATANKASQNRTRALQSHS
FT                   SPECKEEPEPLSPELEYIPRKRGKNPMKAVGLAWAIGFPCGILFFVLTKQEVDKDRLKQ
FT                   MKARQNMRVSNTGEYESQRFRASPQQAQFPEVGSGAQT"
FT   gene            complement(22599975..22617340)
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /note="gene_id=mCG114808.1"
FT   mRNA            complement(join(22599975..22601248,22601601..22601654,
FT                   22602482..22602577,22602926..22603013,22603157..22603194,
FT                   22603421..22603460,22604183..22604233,22604562..22604615,
FT                   22604732..22604796,22605635..22605729,22606925..22607166,
FT                   22617231..22617340))
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /product="transmembrane BAX inhibitor motif containing 1,
FT                   transcript variant mCT171050"
FT                   /note="gene_id=mCG114808.1 transcript_id=mCT171050.0
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(22599975..22601248,22601601..22601654,
FT                   22602482..22602577,22602926..22603013,22603157..22603194,
FT                   22603421..22603460,22604183..22604233,22604562..22604615,
FT                   22604732..22604796,22605635..22605729,22606925..22607166,
FT                   22615841..22616043,22617036..22617169))
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /product="transmembrane BAX inhibitor motif containing 1,
FT                   transcript variant mCT115905"
FT                   /note="gene_id=mCG114808.1 transcript_id=mCT115905.1
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(22599975..22601248,22601601..22601654,
FT                   22602482..22602577,22602926..22603013,22603157..22603194,
FT                   22603421..22603460,22604183..22604233,22604562..22604615,
FT                   22604732..22604796,22605635..22605729,22606925..22607166,
FT                   22615493..22615660))
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /product="transmembrane BAX inhibitor motif containing 1,
FT                   transcript variant mCT171051"
FT                   /note="gene_id=mCG114808.1 transcript_id=mCT171051.0
FT                   created on 23-JUL-2002"
FT   mRNA            complement(join(22599981..22601248,22601601..22601639,
FT                   22604738..22604796,22605635..22605729,22606925..22607170))
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /product="transmembrane BAX inhibitor motif containing 1,
FT                   transcript variant mCT171049"
FT                   /note="gene_id=mCG114808.1 transcript_id=mCT171049.0
FT                   created on 23-JUL-2002"
FT   CDS             complement(join(22601102..22601248,22601601..22601654,
FT                   22602482..22602577,22602926..22603013,22603157..22603194,
FT                   22603421..22603460,22604183..22604233,22604562..22604615,
FT                   22604732..22604796,22605635..22605729,22606925..22607126))
FT                   /codon_start=1
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /product="transmembrane BAX inhibitor motif containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114808.1 transcript_id=mCT171051.0
FT                   protein_id=mCP93968.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U717"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1916910"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U717"
FT                   /protein_id="EDL00318.1"
FT                   /translation="MSNPSAPPPYEDHNPLYPGSPPPGGYGQPSVLPGGYPAYPAYPQP
FT                   GYGHPAGYPQPVPPVHPMPMNYGHDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCII
FT                   SVQLLITVAIIAIFTFVEPVGKYVRNNVAVYYVSYAVFLVTYLTLACCQGPRRRFPWNI
FT                   ILLTIFTLALGFVTGTISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFC
FT                   VLGIVLMVTGIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLVLGNRKHTISPE
FT                   DYITGALQIYTDIVYIFTFVLQLVGSRD"
FT   CDS             complement(join(22601102..22601248,22601601..22601654,
FT                   22602482..22602577,22602926..22603013,22603157..22603194,
FT                   22603421..22603460,22604183..22604233,22604562..22604615,
FT                   22604732..22604796,22605635..22605729,22606925..22607126))
FT                   /codon_start=1
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /product="transmembrane BAX inhibitor motif containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114808.1 transcript_id=mCT115905.1
FT                   protein_id=mCP74712.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U717"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1916910"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U717"
FT                   /protein_id="EDL00319.1"
FT                   /translation="MSNPSAPPPYEDHNPLYPGSPPPGGYGQPSVLPGGYPAYPAYPQP
FT                   GYGHPAGYPQPVPPVHPMPMNYGHDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCII
FT                   SVQLLITVAIIAIFTFVEPVGKYVRNNVAVYYVSYAVFLVTYLTLACCQGPRRRFPWNI
FT                   ILLTIFTLALGFVTGTISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFC
FT                   VLGIVLMVTGIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLVLGNRKHTISPE
FT                   DYITGALQIYTDIVYIFTFVLQLVGSRD"
FT   CDS             complement(join(22601102..22601248,22601601..22601654,
FT                   22602482..22602577,22602926..22603013,22603157..22603194,
FT                   22603421..22603460,22604183..22604233,22604562..22604615,
FT                   22604732..22604796,22605635..22605729,22606925..22607126))
FT                   /codon_start=1
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /product="transmembrane BAX inhibitor motif containing 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG114808.1 transcript_id=mCT171050.0
FT                   protein_id=mCP93967.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q3U717"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="MGI:MGI:1916910"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U717"
FT                   /protein_id="EDL00320.1"
FT                   /translation="MSNPSAPPPYEDHNPLYPGSPPPGGYGQPSVLPGGYPAYPAYPQP
FT                   GYGHPAGYPQPVPPVHPMPMNYGHDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCII
FT                   SVQLLITVAIIAIFTFVEPVGKYVRNNVAVYYVSYAVFLVTYLTLACCQGPRRRFPWNI
FT                   ILLTIFTLALGFVTGTISSMYETKAVIIAMIITAVVSISVTIFCFQTKVDFTSCTGLFC
FT                   VLGIVLMVTGIVTSIVLIFKYIYWLHMVYAALGAICFTLFLAYDTQLVLGNRKHTISPE
FT                   DYITGALQIYTDIVYIFTFVLQLVGSRD"
FT   CDS             complement(join(22601149..22601248,22601601..22601639,
FT                   22604738..22604796,22605635..22605729,22606925..22607126))
FT                   /codon_start=1
FT                   /gene="Tmbim1"
FT                   /locus_tag="mCG_114808"
FT                   /product="transmembrane BAX inhibitor motif containing 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG114808.1 transcript_id=mCT171049.0
FT                   protein_id=mCP93969.0 isoform=CRA_a"
FT                   /protein_id="EDL00317.1"
FT                   /translation="MSNPSAPPPYEDHNPLYPGSPPPGGYGQPSVLPGGYPAYPAYPQP
FT                   GYGHPAGYPQPVPPVHPMPMNYGHDYNEEERAGSDSFRPGEWDDRKVRHSFIQKVYCII
FT                   SVQLLITVAIIAIFTWSMQLWGPSVSPCSWLMTHSWSWGTGSTPSARRTTSQAPYRSTQ
FT                   I"
FT   gene            22607319..22609632
FT                   /locus_tag="mCG_146962"
FT                   /note="gene_id=mCG146962.0"
FT   mRNA            join(22607319..22607513,22608083..22609632)
FT                   /locus_tag="mCG_146962"
FT                   /product="mCG146962"
FT                   /note="gene_id=mCG146962.0 transcript_id=mCT187225.0
FT                   created on 13-JAN-2004"
FT   CDS             join(22607492..22607513,22608083..22608429)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146962"
FT                   /product="mCG146962"
FT                   /note="gene_id=mCG146962.0 transcript_id=mCT187225.0
FT                   protein_id=mCP109561.0"
FT                   /protein_id="EDL00321.1"
FT                   /translation="MALEALPGLLCQAHHSLWTHNEMAGTSRYGRDEDRDKPRKWCLYF
FT                   FHRTTPSHAHPVTELPPALQERLADPGQPHLQGRCWKQESPSFSFRAPVQLRDQIEDMH
FT                   GSSQDNGSDSQGKPVRIE"
FT   gap             22631731..22632542
FT                   /estimated_length=812
FT   gap             22636778..22636797
FT                   /estimated_length=20
FT   gap             22642015..22642034
FT                   /estimated_length=20
FT   mRNA            join(22643923..22644106,22658725..22658840,
FT                   22658992..22659104,22660103..22660161,22660647..22660739,
FT                   22661053..22661216,22661956..22662042,22662876..22662991,
FT                   22663321..22665045)
FT                   /locus_tag="mCG_114807"
FT                   /product="mCG114807, transcript variant mCT115904"
FT                   /note="gene_id=mCG114807.3 transcript_id=mCT115904.0
FT                   created on 22-APR-2004"
FT   CDS             join(22643946..22644106,22658725..22658840,
FT                   22658992..22659104,22660103..22660161,22660647..22660739,
FT                   22661053..22661216,22661956..22662042,22662876..22662991,
FT                   22663321..22663380)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114807"
FT                   /product="mCG114807, isoform CRA_a"
FT                   /note="gene_id=mCG114807.3 transcript_id=mCT115904.0
FT                   protein_id=mCP74693.1 isoform=CRA_a"
FT                   /protein_id="EDL00313.1"
FT                   /translation="MAWQGWLAPWLWVSGCWLLFFAFVLLLSPRSCQEQRGFRGLLMTR
FT                   SQRLLFRIGYSLYTRTWLGYLFYRQQLRRARNRYPKGHSKTQPRLFNGVKVLPIPVLSD
FT                   NYSYLIIDTQAGLAVAVDPSDPRAVQASIEKERVNLVAILCTHKHWDHSGGNRDLSRRH
FT                   RDCRVYGSPQDGIPYLTHPLCHQDVVSVGRLQIRALATPGHTQGHLVYLLDGEPYKGPS
FT                   CLFSGDLLFLSGCGRTFEGTAETMLSSLDTVLDLGDDTLLWPGHEYAEENLGFAGVVEP
FT                   ENLARERKMQWVQRQRMERKSTVSQQRGGHPPPTLHHPLHH"
FT   gap             22649417..22649436
FT                   /estimated_length=20
FT   gap             22663018..22663320
FT                   /estimated_length=303
FT   gap             22675402..22679609
FT                   /estimated_length=4208
FT   gene            <22682881..22693929
FT                   /gene="Slc11a1"
FT                   /locus_tag="mCG_114804"
FT                   /note="gene_id=mCG114804.2"
FT   mRNA            join(<22682881..22683001,22683398..22683531,
FT                   22684473..22684595,22684837..22684956,22687508..22687614,
FT                   22687922..22687992,22688334..22688401,22688567..22688722,
FT                   22689598..22689756,22691314..22691403,22691501..22692049,
FT                   22692574..22692647,22693018..22693171,22693270..22693929)
FT                   /gene="Slc11a1"
FT                   /locus_tag="mCG_114804"
FT                   /product="solute carrier family 11 (proton-coupled divalent
FT                   metal ion transporters), member 1, transcript variant
FT                   mCT189264"
FT                   /note="gene_id=mCG114804.2 transcript_id=mCT189264.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(22682909..22683001,22683398..22683531,
FT                   22684473..22684595,22684837..22684956,22687508..22687614,
FT                   22687922..22687992,22688334..22688401,22688567..22688722,
FT                   22689598..22689756,22691314..22691403,22691501..22691620,
FT                   22691900..22692049,22692574..22692647,22693018..22693171,
FT                   22693270..22693929)
FT                   /gene="Slc11a1"
FT                   /locus_tag="mCG_114804"
FT                   /product="solute carrier family 11 (proton-coupled divalent
FT                   metal ion transporters), member 1, transcript variant
FT                   mCT115901"
FT                   /note="gene_id=mCG114804.2 transcript_id=mCT115901.0
FT                   created on 11-JUN-2002"
FT   CDS             join(<22682962..22683001,22683398..22683531,
FT                   22684473..22684595,22684837..22684956,22687508..22687614,
FT                   22687922..22687992,22688334..22688401,22688567..22688722,
FT                   22689598..22689756,22691314..22691403,22691501..22691806)
FT                   /codon_start=1
FT                   /gene="Slc11a1"
FT                   /locus_tag="mCG_114804"
FT                   /product="solute carrier family 11 (proton-coupled divalent
FT                   metal ion transporters), member 1, isoform CRA_c"
FT                   /note="gene_id=mCG114804.2 transcript_id=mCT189264.0
FT                   protein_id=mCP110239.0 isoform=CRA_c"
FT                   /protein_id="EDL00324.1"
FT                   /translation="PHTEYPAACVLMISDKSPPRLSRPSYGSISSLPGPAPQPAPCRET
FT                   YLSEKIPIPSADQGTFSLRKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVAGFKLLWVL
FT                   LWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRILLWLTIELAIVGSDMQEVIG
FT                   TAISFNLLSAGRIPLWGGVLITIVDTFFFLFLDNYGLRKLEAFFGLLITIMALTFGYEY
FT                   VVAHPSQGALLKGLVLPTCPGCGQPELLQAVGIVGAIIMPHNIYLHSALVKSREVDRTR
FT                   RVDVREANMYFLIEATIALSVSFIINLFVMAVFGQAFYQQTNEEAFNICANSSLQNYAK
FT                   IFPRDNNTVSVDIYQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEVGI
FT                   EGPKIADTLLEAWTLGLSELQKGKMTIRIPQRRSIFSKPVMGILPLPLVLSPTNRSQI"
FT   CDS             join(22682995..22683001,22683398..22683531,
FT                   22684473..22684595,22684837..22684956,22687508..22687614,
FT                   22687922..22687992,22688334..22688401,22688567..22688722,
FT                   22689598..22689756,22691314..22691403,22691501..22691620,
FT                   22691900..22692049,22692574..22692647,22693018..22693171,
FT                   22693270..22693383)
FT                   /codon_start=1
FT                   /gene="Slc11a1"
FT                   /locus_tag="mCG_114804"
FT                   /product="solute carrier family 11 (proton-coupled divalent
FT                   metal ion transporters), member 1, isoform CRA_a"
FT                   /note="gene_id=mCG114804.2 transcript_id=mCT115901.0
FT                   protein_id=mCP74504.1 isoform=CRA_a"
FT                   /protein_id="EDL00322.1"
FT                   /translation="MISDKSPPRLSRPSYGSISSLPGPAPQPAPCRETYLSEKIPIPSA
FT                   DQGTFSLRKLWAFTGPGFLMSIAFLDPGNIESDLQAGAVAGFKLLWVLLWATVLGLLCQ
FT                   RLAARLGVVTGKDLGEVCHLYYPKVPRILLWLTIELAIVGSDMQEVIGTAISFNLLSAG
FT                   RIPLWGGVLITIVDTFFFLFLDNYGLRKLEAFFGLLITIMALTFGYEYVVAHPSQGALL
FT                   KGLVLPTCPGCGQPELLQAVGIVGAIIMPHNIYLHSALVKSREVDRTRRVDVREANMYF
FT                   LIEATIALSVSFIINLFVMAVFGQAFYQQTNEEAFNICANSSLQNYAKIFPRDNNTVSV
FT                   DIYQGGVILGCLFGPAALYIWAVGLLAAGQSSTMTGTYAGQFVMEGFLKLRWSRFARVL
FT                   LTRSCAILPTVLVAVFRDLKDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPAVMQEFAN
FT                   GRMSKAITSCIMALVCAINLYFVISYLPSLPHPAYFGLVALFAIGYLGLTAYLAWTCCI
FT                   AHGATFLTHSSHKHFLYGLPNEEQGGVQGSG"
FT   gap             22685281..22685413
FT                   /estimated_length=133
FT   gap             22688759..22688979
FT                   /estimated_length=221
FT   mRNA            join(22691217..22691403,22691501..22691620,
FT                   22691900..22692049,22692574..22692647,22693018..22693171,
FT                   22693270..22693929)
FT                   /gene="Slc11a1"
FT                   /locus_tag="mCG_114804"
FT                   /product="solute carrier family 11 (proton-coupled divalent
FT                   metal ion transporters), member 1, transcript variant
FT                   mCT167957"
FT                   /note="gene_id=mCG114804.2 transcript_id=mCT167957.0
FT                   created on 11-JUN-2002"
FT   CDS             join(22691585..22691620,22691900..22692049,
FT                   22692574..22692647,22693018..22693171,22693270..22693383)
FT                   /codon_start=1
FT                   /gene="Slc11a1"
FT                   /locus_tag="mCG_114804"
FT                   /product="solute carrier family 11 (proton-coupled divalent
FT                   metal ion transporters), member 1, isoform CRA_b"
FT                   /note="gene_id=mCG114804.2 transcript_id=mCT167957.0
FT                   protein_id=mCP90832.0 isoform=CRA_b"
FT                   /protein_id="EDL00323.1"
FT                   /translation="MTGTYAGQFVMEGFLKLRWSRFARVLLTRSCAILPTVLVAVFRDL
FT                   KDLSGLNDLLNVLQSLLLPFAVLPILTFTSMPAVMQEFANGRMSKAITSCIMALVCAIN
FT                   LYFVISYLPSLPHPAYFGLVALFAIGYLGLTAYLAWTCCIAHGATFLTHSSHKHFLYGL
FT                   PNEEQGGVQGSG"
FT   gene            22699473..22705108
FT                   /gene="Ctdsp1"
FT                   /locus_tag="mCG_114811"
FT                   /note="gene_id=mCG114811.1"
FT   mRNA            join(22699473..22699606,22699645..22699809,
FT                   22701121..22701269,22701640..22701744,22701862..22701918,
FT                   22702483..22702575,22702680..22702865,22703299..22705108)
FT                   /gene="Ctdsp1"
FT                   /locus_tag="mCG_114811"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase 1, transcript variant
FT                   mCT115908"
FT                   /note="gene_id=mCG114811.1 transcript_id=mCT115908.1
FT                   created on 21-NOV-2002"
FT   gap             22699607..22699644
FT                   /estimated_length=38
FT   mRNA            join(<22699645..22699809,22701121..22701744,
FT                   22701862..22701918,22702483..22702575,22702680..22702865,
FT                   22703299..22705101)
FT                   /gene="Ctdsp1"
FT                   /locus_tag="mCG_114811"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase 1, transcript variant
FT                   mCT189311"
FT                   /note="gene_id=mCG114811.1 transcript_id=mCT189311.0
FT                   created on 08-MAR-2004"
FT   CDS             join(22699743..22699809,22701121..22701269,
FT                   22701640..22701744,22701862..22701918,22702483..22702575,
FT                   22702680..22702865,22703299..22703427)
FT                   /codon_start=1
FT                   /gene="Ctdsp1"
FT                   /locus_tag="mCG_114811"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase 1, isoform CRA_a"
FT                   /note="gene_id=mCG114811.1 transcript_id=mCT115908.1
FT                   protein_id=mCP74503.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q5I0X8"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011948"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="MGI:MGI:2654470"
FT                   /db_xref="UniProtKB/TrEMBL:Q5I0X8"
FT                   /protein_id="EDL00325.1"
FT                   /translation="MDSSAVITQISKEEARGPLRGKGDQKSAVSQKPRSRGILHSLFCC
FT                   VCRDDGEPLPAHSGAPLLVEENGAIPKHTPVQYLLPEAKAQDSDKICVVIDLDETLVHS
FT                   SFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAKYADPVA
FT                   DLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPV
FT                   ASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS"
FT   CDS             join(<22701580..22701744,22701862..22701918,
FT                   22702483..22702575,22702680..22702865,22703299..22703427)
FT                   /codon_start=1
FT                   /gene="Ctdsp1"
FT                   /locus_tag="mCG_114811"
FT                   /product="CTD (carboxy-terminal domain, RNA polymerase II,
FT                   polypeptide A) small phosphatase 1, isoform CRA_b"
FT                   /note="gene_id=mCG114811.1 transcript_id=mCT189311.0
FT                   protein_id=mCP110297.0 isoform=CRA_b"
FT                   /protein_id="EDL00326.1"
FT                   /translation="RNLGREAPVRGALPAQPSPQHTPVQYLLPEAKAQDSDKICVVIDL
FT                   DETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLA
FT                   KYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFH
FT                   PDNAVPVASWFDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS"
FT   gene            22717240..22744690
FT                   /gene="Vil1"
FT                   /locus_tag="mCG_114803"
FT                   /note="gene_id=mCG114803.1"
FT   mRNA            join(22717240..22717270,22722911..22722996,
FT                   22723808..22723882,22726151..22726347,22727360..22727468,
FT                   22727586..22727696,22729044..22729246,22729352..22729430,
FT                   22729570..22729668,22730718..22730871,22731466..22731566,
FT                   22731654..22731791,22733525..22733683,22734540..22734719,
FT                   22735228..22735373,22735496..22735640,22736083..22736271,
FT                   22738650..22738718,22740324..22740464,22742911..22744690)
FT                   /gene="Vil1"
FT                   /locus_tag="mCG_114803"
FT                   /product="villin 1"
FT                   /note="gene_id=mCG114803.1 transcript_id=mCT115900.1
FT                   created on 22-JUL-2002"
FT   CDS             join(22722922..22722996,22723808..22723882,
FT                   22726151..22726347,22727360..22727468,22727586..22727696,
FT                   22729044..22729246,22729352..22729430,22729570..22729668,
FT                   22730718..22730871,22731466..22731566,22731654..22731791,
FT                   22733525..22733683,22734540..22734719,22735228..22735373,
FT                   22735496..22735640,22736083..22736271,22738650..22738718,
FT                   22740324..22740464,22742911..22743024)
FT                   /codon_start=1
FT                   /gene="Vil1"
FT                   /locus_tag="mCG_114803"
FT                   /product="villin 1"
FT                   /note="gene_id=mCG114803.1 transcript_id=mCT115900.1
FT                   protein_id=mCP74490.1"
FT                   /protein_id="EDL00327.1"
FT                   /translation="MTKLNAQVKGSLNITTPGIQIWRIEAMQMVPVPSSTFGSFFDGDC
FT                   YVVLAIHKTSSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNES
FT                   ETFRSYFKQGLVIRKGGVASGMKHVETNSCDVQRLLHVKGKRNVLAGEVEMSWKSFNRG
FT                   DVFLLDLGKLIIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGVVDGEKEGDSPQL
FT                   MAIMNHVLGPRKELKAAISDSVVEPAAKAALKLYHVSDSEGKLVVREVATRPLTQDLLK
FT                   HEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYPPSTQVEVQNDGAESP
FT                   IFQQLFQKWTVPNRTSGLGKTHTVGSVAKVEQVKFDALTMHVQPQVAAQQKMVDDGSGE
FT                   VQVWRIEDLELVPVESKWLGHFYGGDCYLLLYTYLIGEKQHYLLYIWQGSQASQDEIAA
FT                   SAYQAVLLDQKYNDEPVQIRVTMGKEPPHLMSIFKGRMVVYQGGTSRKNNLEPVPSTRL
FT                   FQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSCCYLWCGKGCSGDEREMAKMVADT
FT                   ISRTEKQVVVEGQEPANFWMALGGKAPYANTKRLQEENQVITPRLFECSNQTGRFLATE
FT                   IFDFNQDDLEEEDVFLLDVWDQVFFWIGKHANEEEKKAAATTVQEYLKTHPGNRDLETP
FT                   IIVVKQGHEPPTFTGWFLAWDPFKWSNTKSYDDLKAELGNSGDWSQIADEVMSPKVDVF
FT                   TANTSLSSRPLPTFPLEQLVNKSVEDLPEGVDPSRKEEHLSTEDFTRALGMTPAAFSAL
FT                   PRWKQQNIKKEKGLF"
FT   gap             22724505..22724638
FT                   /estimated_length=134
FT   gene            complement(22747148..>22852192)
FT                   /gene="Usp37"
FT                   /locus_tag="mCG_144507"
FT                   /note="gene_id=mCG144507.0"
FT   mRNA            complement(join(22747148..22747514,22747996..22748134,
FT                   22749560..22749629,22752435..22752550,22758505..22758565,
FT                   22760697..22760863,22761838..22762093,22764089..22764230,
FT                   22767945..22768010,22769596..22769760,22774955..22775034,
FT                   22776307..22776424,22778625..22778815,22779425..22779548,
FT                   22779684..22779815,22782911..22783069,22785992..22786076,
FT                   22787597..22787694,22793929..22794003,22794573..22794751,
FT                   22798030..22798130,22800844..22801015,22803569..22803792,
FT                   22807894..22808038,22838933..22838982,22852080..>22852192))
FT                   /gene="Usp37"
FT                   /locus_tag="mCG_144507"
FT                   /product="ubiquitin specific peptidase 37"
FT                   /note="gene_id=mCG144507.0 transcript_id=mCT183931.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(22747427..22747514,22747996..22748134,
FT                   22749560..22749629,22752435..22752550,22758505..22758565,
FT                   22760697..22760863,22761838..22762093,22764089..22764230,
FT                   22767945..22768010,22769596..22769760,22774955..22775034,
FT                   22776307..22776424,22778625..22778815,22779425..22779548,
FT                   22779684..22779815,22782911..22783069,22785992..22786076,
FT                   22787597..22787694,22793929..22794003,22794573..22794751,
FT                   22798030..22798130,22800844..22801015,22803569..>22803748))
FT                   /codon_start=1
FT                   /gene="Usp37"
FT                   /locus_tag="mCG_144507"
FT                   /product="ubiquitin specific peptidase 37"
FT                   /note="gene_id=mCG144507.0 transcript_id=mCT183931.0
FT                   protein_id=mCP106114.0"
FT                   /protein_id="EDL00328.1"
FT                   /translation="KQFIFKETMSPLKIYGPIRIRSMQTGITKWKEGSFEIVEKDNRVS
FT                   LLVHYNTGGIPRVFQLSHNIKNVVLRPSGIKQSRLMLTLQDNSFLSIDKVPSKDAEEMR
FT                   LFLDAVHQNRLHAAMKASQGSGSFGTILGSRTSQKETNRQLSYSDNQASSKRGSLETKD
FT                   EIPFRKVLGSPGRGPIKTVTGGGMAVTRTIPSLTLTSTPLRSGLLENRTEKRKRMLSGS
FT                   ELTEDYPKENDSSSNNKAMTDPSRKYLTSCREKQLSLKQAEENRTSGLLPLQSSSFYGS
FT                   RAGSKDYSSGVTNLDRCNVSSQTPSAKRSLGFLPQPTPLSVKKLRCNQDYAGWNRPRVP
FT                   LSSHQQQLQGFSNLGNTCYMNAILQSLFSLQSFANDLLKQSIPWKKIPFNALIRRFANL
FT                   LIKKDICNSETKKELLKKVKNAISATAERFSGYVQNDAHEFLSQCLDQLKEDMEKLNKT
FT                   WKTEPVLGEENLPDTSATKVFTCPVITNLEFEVQHSIICKACGETIPKREQFNDLSIDL
FT                   PRRKKPLPPRSIQDSLDLFFRAEELEYSCEKCGGKCALVRHKFNRLPRVLILHLKRYSF
FT                   NVALSLNNKLGQQVIIPRFLTLASHCTESTKPPVTLGWSAPVAISRPLRACQMVNSCIT
FT                   SPSAPSKKFTFKSKSSVTSCLDSDSEDELKRSVVLSQRLCDLPGNEQYQEDVEKDLKLC
FT                   RLEPGKAELENSGFDRMSEEEVLAAVLEISRREASPVLSPEDDDKPTSSPDTGFAEDDI
FT                   PEMPENPDAMEIEKSKTITEPGPASFTEITKDCDENKENKTPEGSQGEVDWLQQYDVDR
FT                   EREEQELQQALAQSLQEQEAWEQKEDDDLKRATELSLQEFNNSFLDSLGSDEDSGNEDV
FT                   FDMEYTEAEAEELKRNAETGALPHSYRLISVVSHIGSTSSSGHYISDVYDIKKQAWFTY
FT                   NDLEVSKIQEAAVQSDRDRSGYIFFYMHKEIFDELLETEKTSQALSMEVGRAARQAS"
FT   gap             22765888..22765907
FT                   /estimated_length=20
FT   gap             22777750..22777769
FT                   /estimated_length=20
FT   gene            22814016..22838710
FT                   /gene="Rqcd1"
FT                   /locus_tag="mCG_114806"
FT                   /note="gene_id=mCG114806.1"
FT   mRNA            join(22814016..22814426,22824951..22825130,
FT                   22826812..22826927,22830189..22830298,22831371..22831480,
FT                   22834859..22834957,22835462..22835553,22836556..22838710)
FT                   /gene="Rqcd1"
FT                   /locus_tag="mCG_114806"
FT                   /product="rcd1 (required for cell differentiation) homolog
FT                   1 (S. pombe), transcript variant mCT115903"
FT                   /note="gene_id=mCG114806.1 transcript_id=mCT115903.1
FT                   created on 22-JUL-2002"
FT   mRNA            join(<22814071..22814179,22824951..22825130,
FT                   22826812..22826927,22830189..22830298,22831371..22831480,
FT                   22832897..22832960,22834859..22834954)
FT                   /gene="Rqcd1"
FT                   /locus_tag="mCG_114806"
FT                   /product="rcd1 (required for cell differentiation) homolog
FT                   1 (S. pombe), transcript variant mCT189265"
FT                   /note="gene_id=mCG114806.1 transcript_id=mCT189265.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<22814147..22814179,22824951..22825130,
FT                   22826812..22826927,22830189..22830298,22831371..22831480,
FT                   22832897..22832917)
FT                   /codon_start=1
FT                   /gene="Rqcd1"
FT                   /locus_tag="mCG_114806"
FT                   /product="rcd1 (required for cell differentiation) homolog
FT                   1 (S. pombe), isoform CRA_b"
FT                   /note="gene_id=mCG114806.1 transcript_id=mCT189265.0
FT                   protein_id=mCP110240.0 isoform=CRA_b"
FT                   /protein_id="EDL00330.1"
FT                   /translation="FADVILIPNLKPVPTALAQVDREKIYQWINELSSPETRENALLEL
FT                   SKKRESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVA
FT                   SHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLT
FT                   TEIIPLCLRIMESGSELSKTEPEIIH"
FT   CDS             join(22814403..22814426,22824951..22825130,
FT                   22826812..22826927,22830189..22830298,22831371..22831480,
FT                   22834859..22834957,22835462..22835553,22836556..22836724)
FT                   /codon_start=1
FT                   /gene="Rqcd1"
FT                   /locus_tag="mCG_114806"
FT                   /product="rcd1 (required for cell differentiation) homolog
FT                   1 (S. pombe), isoform CRA_a"
FT                   /note="gene_id=mCG114806.1 transcript_id=mCT115903.1
FT                   protein_id=mCP74690.1 isoform=CRA_a"
FT                   /protein_id="EDL00329.1"
FT                   /translation="MHSLATAAPVPTALAQVDREKIYQWINELSSPETRENALLELSKK
FT                   RESVPDLAPMLWHSFGTIAALLQEIVNIYPSINPPTLTAHQSNRVCNALALLQCVASHP
FT                   ETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSLGVIGALVKTDEQEVINFLLTTEI
FT                   IPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVAMILGKMVLQLSK
FT                   EPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLVK
FT                   NLQEGQVTDPRGIPLPPQ"
FT   gap             22819256..22819352
FT                   /estimated_length=97
FT   gap             22825410..22825536
FT                   /estimated_length=127
FT   gap             22827315..22827424
FT                   /estimated_length=110
FT   gap             22842695..22842714
FT                   /estimated_length=20
FT   gene            22852268..22874049
FT                   /gene="Plcd4"
FT                   /locus_tag="mCG_133882"
FT                   /note="gene_id=mCG133882.1"
FT   mRNA            join(22852268..22852555,22855815..22855870,
FT                   22856007..22856165,22857077..22857305,22858916..22859051,
FT                   22859890..22860121,22862545..22862746,22863998..22864142,
FT                   22865769..22865921,22868359..22868562,22869911..22870006,
FT                   22870124..22870292,22870783..22870899,22871520..22871692,
FT                   22872446..22872581,22873101..22873250,22873329..22873436,
FT                   22873816..22874049)
FT                   /gene="Plcd4"
FT                   /locus_tag="mCG_133882"
FT                   /product="phospholipase C, delta 4, transcript variant
FT                   mCT135254"
FT                   /note="gene_id=mCG133882.1 transcript_id=mCT135254.1
FT                   created on 17-SEP-2002"
FT   mRNA            join(<22852270..22852555,22855815..22855870,
FT                   22856007..22856165,22857077..22857305,22858918..22859051,
FT                   22859890..22860121,22862545..22862746,22863998..22864142,
FT                   22865769..22865921,22868359..22868562,22869911..22870006,
FT                   22870090..22870292,22870783..22870883,22871520..22871692,
FT                   22872446..22872581,22873101..22873250,22873329..22873436,
FT                   22873816..22874045)
FT                   /gene="Plcd4"
FT                   /locus_tag="mCG_133882"
FT                   /product="phospholipase C, delta 4, transcript variant
FT                   mCT189295"
FT                   /note="gene_id=mCG133882.1 transcript_id=mCT189295.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<22852435..22852555,22855815..22855870,
FT                   22856007..22856165,22857077..22857305,22858918..22859051,
FT                   22859890..22860121,22862545..22862746,22863998..22864142,
FT                   22865769..22865921,22868359..22868562,22869911..22870006,
FT                   22870124..22870292,22870783..22870899,22871520..22871692,
FT                   22872446..22872581,22873101..22873250,22873329..22873436,
FT                   22873816..22874045)
FT                   /gene="Plcd4"
FT                   /locus_tag="mCG_133882"
FT                   /product="phospholipase C, delta 4, transcript variant
FT                   mCT189294"
FT                   /note="gene_id=mCG133882.1 transcript_id=mCT189294.0
FT                   created on 08-MAR-2004"
FT   gap             22853633..22853652
FT                   /estimated_length=20
FT   CDS             join(22855849..22855870,22856007..22856165,
FT                   22857077..22857305,22858916..22859051,22859890..22860121,
FT                   22862545..22862746,22863998..22864142,22865769..22865921,
FT                   22868359..22868562,22869911..22870006,22870124..22870292,
FT                   22870783..22870899,22871520..22871692,22872446..22872581,
FT                   22873101..22873250,22873329..22873435)
FT                   /codon_start=1
FT                   /gene="Plcd4"
FT                   /locus_tag="mCG_133882"
FT                   /product="phospholipase C, delta 4, isoform CRA_a"
FT                   /note="gene_id=mCG133882.1 transcript_id=mCT135254.1
FT                   protein_id=mCP74603.1 isoform=CRA_a"
FT                   /protein_id="EDL00331.1"
FT                   /translation="MTSQIQDLLATDQDLLLMQEGTMMRKVRTKSWKKLRYFRLQNDGM
FT                   TVWHGSQPESMPKPTFSISDVERIRKGQDSELLRYLVEEFPLEQGFTVVFHGRRPNLDL
FT                   VANSVEEAQIWMRGLQLLVDLVASMDHQEQMDQAGMLNEWFQQADRNQDGRMSFREAQR
FT                   LLLLMNVEMDEEYAFSLFQEADVTQSDDLGSEEFVQFYKALTKRTEIEEIFEDFSSDKQ
FT                   KLTLLEFVDFLRKEQKEKDHAPDLALELIDRYEPSENGRLLHVLSKDGFLKYLCSKDGN
FT                   IFNSDCLPIYQDMTQPLSHYYINSSHNTYLVGDQLCGQSSVEGYIRALKRGCRCVEVDT
FT                   WDGPDGEPVVYHGHTLTSRILFKDVLATLAQYAFQSSDYPLILSLENHCTWEQQRTMAH
FT                   HLTEILGEQLLRNTLEGLLVDSMPSPEQLRGKILVKGKKLRTIEVDKEEEEEEEEEELE
FT                   KDEGPDLDPASPELDTQPQPETQGQAAGNKKERKKKVMKCPMSCLLICGHVMAQAPSSI
FT                   PESILLSKQFLLLSSTTIMCPDLSALVVYLRTVPFCSFTHSKENYHIYDISSFSESKAK
FT                   NLIKEAGNEFVQHNARQLCRVYPSGLRTDSSNFNPQEHWNVGCQMVAMNMQTAGSAMDI
FT                   CDGLFRQNGGSGYVLKPEFLRDTQSSFNPERPISLYKAQILVVQVISGQQLPKVDKTKE
FT                   TTVVDPLVKVELYGVPEDTKEQETSHVENNGINPYWGETFYFRLQVPELAMLRFVVKDY
FT                   SRKSRNNFIGQYTLPWTCMKQGYRHVSLLSRDGTSLNPASIFVYTCMQEDLDMDEP"
FT   CDS             join(<22857209..22857305,22858918..22859051,
FT                   22859890..22860121,22862545..22862746,22863998..22864142,
FT                   22865769..22865921,22868359..22868562,22869911..22870006,
FT                   22870124..22870292,22870783..22870899,22871520..22871692,
FT                   22872446..22872581,22873101..22873250,22873329..22873435)
FT                   /codon_start=1
FT                   /gene="Plcd4"
FT                   /locus_tag="mCG_133882"
FT                   /product="phospholipase C, delta 4, isoform CRA_b"
FT                   /note="gene_id=mCG133882.1 transcript_id=mCT189294.0
FT                   protein_id=mCP110283.0 isoform=CRA_b"
FT                   /protein_id="EDL00332.1"
FT                   /translation="WPTVLKRPRFGCEDSSCWWILLPAWTTRSKWITGMLNEWFQQADR
FT                   NQDGRMSFREAQRLLLLMNVEMDEEYAFSLFQEADVTQSDDLGSEEFVQFYKALTKRTE
FT                   IEEIFEDFSSDKQKLTLLEFVDFLRKEQKEKDHAPDLALELIDRYEPSENGRLLHVLSK
FT                   DGFLKYLCSKDGNIFNSDCLPIYQDMTQPLSHYYINSSHNTYLVGDQLCGQSSVEGYIR
FT                   ALKRGCRCVEVDTWDGPDGEPVVYHGHTLTSRILFKDVLATLAQYAFQSSDYPLILSLE
FT                   NHCTWEQQRTMAHHLTEILGEQLLRNTLEGLLVDSMPSPEQLRGKILVKGKKLRTIEVD
FT                   KEEEEEEEEEELEKDEGPDLDPASPELDTQPQPETQGQAAGNKKERKKKVMKCPMSCLL
FT                   ICGHVMAQAPSSIPESILLSKQFLLLSSTTIMCPDLSALVVYLRTVPFCSFTHSKENYH
FT                   IYDISSFSESKAKNLIKEAGNEFVQHNARQLCRVYPSGLRTDSSNFNPQEHWNVGCQMV
FT                   AMNMQTAGSAMDICDGLFRQNGGSGYVLKPEFLRDTQSSFNPERPISLYKAQILVVQVI
FT                   SGQQLPKVDKTKETTVVDPLVKVELYGVPEDTKEQETSHVENNGINPYWGETFYFRLQV
FT                   PELAMLRFVVKDYSRKSRNNFIGQYTLPWTCMKQGYRHVSLLSRDGTSLNPASIFVYTC
FT                   MQEDLDMDEP"
FT   CDS             join(<22857209..22857305,22858918..22859051,
FT                   22859890..22860121,22862545..22862746,22863998..22864142,
FT                   22865769..22865921,22868359..22868562,22869911..22870006,
FT                   22870090..22870242)
FT                   /codon_start=1
FT                   /gene="Plcd4"
FT                   /locus_tag="mCG_133882"
FT                   /product="phospholipase C, delta 4, isoform CRA_c"
FT                   /note="gene_id=mCG133882.1 transcript_id=mCT189295.0
FT                   protein_id=mCP110284.0 isoform=CRA_c"
FT                   /protein_id="EDL00333.1"
FT                   /translation="WPTVLKRPRFGCEDSSCWWILLPAWTTRSKWITGMLNEWFQQADR
FT                   NQDGRMSFREAQRLLLLMNVEMDEEYAFSLFQEADVTQSDDLGSEEFVQFYKALTKRTE
FT                   IEEIFEDFSSDKQKLTLLEFVDFLRKEQKEKDHAPDLALELIDRYEPSENGRLLHVLSK
FT                   DGFLKYLCSKDGNIFNSDCLPIYQDMTQPLSHYYINSSHNTYLVGDQLCGQSSVEGYIR
FT                   ALKRGCRCVEVDTWDGPDGEPVVYHGHTLTSRILFKDVLATLAQYAFQSSDYPLILSLE
FT                   NHCTWEQQRTMAHHLTEILGEQLLRNTLEGLLVDSMPSPEQLRGKILVKGKKLRTIEVD
FT                   KEEEEEEEEEELEKDEGPDLDPASPELDTQPQPETQGQAAGNKKERKKKVMKCPMSCLL
FT                   ICGHVMAQAPSSIPESILLSKQTMLKSIPSSCPVSSPEFHNHHVPRPICPGCLLEDCPL
FT                   LQLHSFQRKLPHL"
FT   gap             22861400..22861583
FT                   /estimated_length=184
FT   gap             22864608..22864627
FT                   /estimated_length=20
FT   gene            complement(22873822..22896260)
FT                   /locus_tag="mCG_133876"
FT                   /note="gene_id=mCG133876.2"
FT   mRNA            complement(join(22873822..22875416,22876620..22876725,
FT                   22877748..22880652,22881608..22881785,22883849..22884673,
FT                   22886192..22886356,22887394..22887996,22893449..22893762,
FT                   22895628..22896142))
FT                   /locus_tag="mCG_133876"
FT                   /product="mCG133876, transcript variant mCT135248"
FT                   /note="gene_id=mCG133876.2 transcript_id=mCT135248.2
FT                   created on 17-JUN-2003"
FT   mRNA            complement(join(22873822..22875416,22876620..22876725,
FT                   22877748..22880652,22881608..22881785,22883849..22884673,
FT                   22886192..22886356,22887394..22887475,22893449..22893762))
FT                   /locus_tag="mCG_133876"
FT                   /product="mCG133876, transcript variant mCT185748"
FT                   /note="gene_id=mCG133876.2 transcript_id=mCT185748.0
FT                   created on 17-JUN-2003"
FT   mRNA            complement(join(22874516..22875416,22876620..22876725,
FT                   22877748..22880652,22881608..22881785,22883849..22884673,
FT                   22886192..22886356,22887394..22887687,22893449..22893762,
FT                   22895628..>22896028))
FT                   /locus_tag="mCG_133876"
FT                   /product="mCG133876, transcript variant mCT189257"
FT                   /note="gene_id=mCG133876.2 transcript_id=mCT189257.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(22874947..22875416,22876620..22876725,
FT                   22877748..22880652,22881608..22881785,22883849..22884673,
FT                   22886192..22886356,22887394..22887687,22893449..>22893755))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133876"
FT                   /product="mCG133876, isoform CRA_d"
FT                   /note="gene_id=mCG133876.2 transcript_id=mCT189257.0
FT                   protein_id=mCP110278.0 isoform=CRA_d"
FT                   /protein_id="EDL00337.1"
FT                   /translation="ETTAHKSVIMTDPVLASQLANGTGEMDGLCSELLLIPPPLSNHGI
FT                   LGPVQNTCASGELAPLPADPGCLLVEATATEEGPGNMEIIVEAVTGTLSPGAPEETSES
FT                   GCVFSAEDRKGLQNHLRQTHKAVPVPCSFRGCSLLFGSQQGMELHRQAHYPFHCSHCSF
FT                   MGSNVKLFRQHQRSHGASARGELSAAVQGLPSQELLPAAKLPPGHREPSEEASTPLPGQ
FT                   ESAEEEDAEEEESVTQKDSQKVMDKSQGAQQLEGHVGSGTESLFKTHMCPECKRCFKKR
FT                   THLVEHLHLHFPDPSLQCPNCQKFFTSKSKLKTHLLRELGEKAHRCPLCHYSAVERNAL
FT                   NRHMASMHEDISNFYSDTYACPVCREEFRLSQALKEHLKSHTAAAAAEPLPLHCFQEGC
FT                   TYVAPDRKAFLKHLKEIHGVRAVECRHHSCPMLFATAEAMEAHHKSHYAFHCPHCDFAC
FT                   SNKHLFRKHKKQGHPGSEELRCTFCPFATFNPVAYQDHVGKMHAYEKIHQCSECNFATA
FT                   HKRVLIRHMLLHTGEKPHKCELCDFTCRDVSYLSKHMLTHSNTKDYMCTECGYVTKWKH
FT                   YLSVHMRKHAGDLRYQCNQCSYRCHRADQLSSHKLRHQGKSLMCEVCAFACKRKYELQK
FT                   HMASQHHPGTPAPLYPCRYCSYQSRHKQALLSHENCKHTHLREFHCALCDYRTFSNTTL
FT                   FFHKRKVHGYMPGDQVWQFCNASQELEGARQCLAPPSDSGPSSQLSAQPEREDREHEIV
FT                   ANSNMDQALPETNEEASPKRQDGIEAPQEDDQVDSPSLGEVEEGGCTLHLEALRVELEP
FT                   ETEPLPLEELTETATVEFRPLDPSGPLGTERPGGLEEPALSSFDSIETPALVAEEEPVV
FT                   EKLASEPPRNPLISEEAPNTFKAALTAETVPLPPFPESESLLKAMRRQDKEQAEALVLE
FT                   GRVQMVVIQGEGRAFRCPHCPFITRREKALTLHSKSGCQGRREPLLCPECGASFKQQRG
FT                   LSTHMMKKCPVLLKKNKALPKPVSPTLHPQLPDNQASQDAESRKPPPLPSKVELLLPKD
FT                   APSDLPGGPGVEEPLPTPSDFPTSPPENSLPTGTSEKFHFEQGKFHCSSCTFLCSRLSS
FT                   ITSHVTEGCRGGRGQKRKRGRPQTHAVVLPLNNGDSTLLNTGSTESSPSDGDTAVVQKQ
FT                   KGALFSCPTCPFSCQQERTLRTHQTQGCPLKSGDLHCGLCPFTAPAAAALRLHQKRRHP
FT                   TASPASGPRPLLQCGDCGFTCKQSRCLQQHRRLKHEGVKPHQCPFCDFSTTRRYRLEAH
FT                   QSRHTGVGRIPCSSCPQTFGTNSKLRLHQLRVHDKTPTHFCPLCDYSGYLRHDITRHVN
FT                   SCHQGTPSFSCTQCEAQFSSETALKQHALRRHPEPTPPSSGCPVEVTEGPLHCSHCGLL
FT                   CPSPASLRGHTRKQHPRLECGACQESFPNRPALDEHRRQHHFSHRCQLCSFAARERVGL
FT                   VKHYLEQHEESSTAPSDGDAGQPSLCCPFCDFACRHQLVLDHHVKGHGGTRLYKCTDCA
FT                   YSTKNRQKITWHSRIHTGEKPYHCHLCAYACADPSRLKYHMRIHKEERKYLCPECGYKC
FT                   KWVNQLKYHMTKHTGLKPYQCPECEYCTNRADALRVHRETRHREARAFMCEQCGKAFKT
FT                   RFLLRTHLRKHSEAKPYVCNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQ
FT                   VVKHVRRHHPDQADPNQGVGKDPTTPTVHLHDVKLEDPSPPAPPAPSTGPEG"
FT   CDS             complement(join(22874947..22875416,22876620..22876725,
FT                   22877748..22880652,22881608..22881785,22883849..22884673,
FT                   22886192..22886356,22887394..22887996,22893449..22893728))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133876"
FT                   /product="mCG133876, isoform CRA_a"
FT                   /note="gene_id=mCG133876.2 transcript_id=mCT135248.2
FT                   protein_id=mCP74608.2 isoform=CRA_a"
FT                   /db_xref="GOA:G5E869"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR015880"
FT                   /db_xref="MGI:MGI:1924514"
FT                   /db_xref="UniProtKB/TrEMBL:G5E869"
FT                   /protein_id="EDL00334.1"
FT                   /translation="MTDPVLASQLANGTGEMDGLCSELLLIPPPLSNHGILGPVQNTCA
FT                   SGELAPLPADPGCLLVEATATEEGPGNMEIIVEAVTGTLSPGAPEETSGVLVKVVEVYF
FT                   CERCEQSFAEPTLLSVHQCTETHIQAVQDLSSPPCSVELPPSNLALRGPLQDPSLPDSP
FT                   LPCPVCRQEFVQPQALKSHFKIHRVTPNMFSCPESGCVFSAEDRKGLQNHLRQTHKAVP
FT                   VPCSFRGCSLLFGSQQGMELHRQAHYPFHCSHCSFMGSNVKLFRQHQRSHGASARGELS
FT                   AAVQGLPSQELLPAAKLPPGHREPSEEASTPLPGQESAEEEDAEEEESVTQKDSQKVMD
FT                   KSQGAQQLEGHVGSGTESLFKTHMCPECKRCFKKRTHLVEHLHLHFPDPSLQCPNCQKF
FT                   FTSKSKLKTHLLRELGEKAHRCPLCHYSAVERNALNRHMASMHEDISNFYSDTYACPVC
FT                   REEFRLSQALKEHLKSHTAAAAAEPLPLHCFQEGCTYVAPDRKAFLKHLKEIHGVRAVE
FT                   CRHHSCPMLFATAEAMEAHHKSHYAFHCPHCDFACSNKHLFRKHKKQGHPGSEELRCTF
FT                   CPFATFNPVAYQDHVGKMHAYEKIHQCSECNFATAHKRVLIRHMLLHTGEKPHKCELCD
FT                   FTCRDVSYLSKHMLTHSNTKDYMCTECGYVTKWKHYLSVHMRKHAGDLRYQCNQCSYRC
FT                   HRADQLSSHKLRHQGKSLMCEVCAFACKRKYELQKHMASQHHPGTPAPLYPCRYCSYQS
FT                   RHKQALLSHENCKHTHLREFHCALCDYRTFSNTTLFFHKRKVHGYMPGDQVWQFCNASQ
FT                   ELEGARQCLAPPSDSGPSSQLSAQPEREDREHEIVANSNMDQALPETNEEASPKRQDGI
FT                   EAPQEDDQVDSPSLGEVEEGGCTLHLEALRVELEPETEPLPLEELTETATVEFRPLDPS
FT                   GPLGTERPGGLEEPALSSFDSIETPALVAEEEPVVEKLASEPPRNPLISEEAPNTFKAA
FT                   LTAETVPLPPFPESESLLKAMRRQDKEQAEALVLEGRVQMVVIQGEGRAFRCPHCPFIT
FT                   RREKALTLHSKSGCQGRREPLLCPECGASFKQQRGLSTHMMKKCPVLLKKNKALPKPVS
FT                   PTLHPQLPDNQASQDAESRKPPPLPSKVELLLPKDAPSDLPGGPGVEEPLPTPSDFPTS
FT                   PPENSLPTGTSEKFHFEQGKFHCSSCTFLCSRLSSITSHVTEGCRGGRGQKRKRGRPQT
FT                   HAVVLPLNNGDSTLLNTGSTESSPSDGDTAVVQKQKGALFSCPTCPFSCQQERTLRTHQ
FT                   TQGCPLKSGDLHCGLCPFTAPAAAALRLHQKRRHPTASPASGPRPLLQCGDCGFTCKQS
FT                   RCLQQHRRLKHEGVKPHQCPFCDFSTTRRYRLEAHQSRHTGVGRIPCSSCPQTFGTNSK
FT                   LRLHQLRVHDKTPTHFCPLCDYSGYLRHDITRHVNSCHQGTPSFSCTQCEAQFSSETAL
FT                   KQHALRRHPEPTPPSSGCPVEVTEGPLHCSHCGLLCPSPASLRGHTRKQHPRLECGACQ
FT                   ESFPNRPALDEHRRQHHFSHRCQLCSFAARERVGLVKHYLEQHEESSTAPSDGDAGQPS
FT                   LCCPFCDFACRHQLVLDHHVKGHGGTRLYKCTDCAYSTKNRQKITWHSRIHTGEKPYHC
FT                   HLCAYACADPSRLKYHMRIHKEERKYLCPECGYKCKWVNQLKYHMTKHTGLKPYQCPEC
FT                   EYCTNRADALRVHRETRHREARAFMCEQCGKAFKTRFLLRTHLRKHSEAKPYVCNVCHR
FT                   AFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHVRRHHPDQADPNQGVGKDPT
FT                   TPTVHLHDVKLEDPSPPAPPAPSTGPEG"
FT   CDS             complement(join(22874947..22875416,22876620..22876725,
FT                   22877748..22880652,22881608..22881785,22883849..22884673,
FT                   22886192..22886225))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133876"
FT                   /product="mCG133876, isoform CRA_b"
FT                   /note="gene_id=mCG133876.2 transcript_id=mCT185748.0
FT                   protein_id=mCP107007.0 isoform=CRA_b"
FT                   /protein_id="EDL00335.1"
FT                   /translation="MDKSQGAQQLEGHVGSGTESLFKTHMCPECKRCFKKRTHLVEHLH
FT                   LHFPDPSLQCPNCQKFFTSKSKLKTHLLRELGEKAHRCPLCHYSAVERNALNRHMASMH
FT                   EDISNFYSDTYACPVCREEFRLSQALKEHLKSHTAAAAAEPLPLHCFQEGCTYVAPDRK
FT                   AFLKHLKEIHGVRAVECRHHSCPMLFATAEAMEAHHKSHYAFHCPHCDFACSNKHLFRK
FT                   HKKQGHPGSEELRCTFCPFATFNPVAYQDHVGKMHAYEKIHQCSECNFATAHKRVLIRH
FT                   MLLHTGEKPHKCELCDFTCRDVSYLSKHMLTHSNTKDYMCTECGYVTKWKHYLSVHMRK
FT                   HAGDLRYQCNQCSYRCHRADQLSSHKLRHQGKSLMCEVCAFACKRKYELQKHMASQHHP
FT                   GTPAPLYPCRYCSYQSRHKQALLSHENCKHTHLREFHCALCDYRTFSNTTLFFHKRKVH
FT                   GYMPGDQVWQFCNASQELEGARQCLAPPSDSGPSSQLSAQPEREDREHEIVANSNMDQA
FT                   LPETNEEASPKRQDGIEAPQEDDQVDSPSLGEVEEGGCTLHLEALRVELEPETEPLPLE
FT                   ELTETATVEFRPLDPSGPLGTERPGGLEEPALSSFDSIETPALVAEEEPVVEKLASEPP
FT                   RNPLISEEAPNTFKAALTAETVPLPPFPESESLLKAMRRQDKEQAEALVLEGRVQMVVI
FT                   QGEGRAFRCPHCPFITRREKALTLHSKSGCQGRREPLLCPECGASFKQQRGLSTHMMKK
FT                   CPVLLKKNKALPKPVSPTLHPQLPDNQASQDAESRKPPPLPSKVELLLPKDAPSDLPGG
FT                   PGVEEPLPTPSDFPTSPPENSLPTGTSEKFHFEQGKFHCSSCTFLCSRLSSITSHVTEG
FT                   CRGGRGQKRKRGRPQTHAVVLPLNNGDSTLLNTGSTESSPSDGDTAVVQKQKGALFSCP
FT                   TCPFSCQQERTLRTHQTQGCPLKSGDLHCGLCPFTAPAAAALRLHQKRRHPTASPASGP
FT                   RPLLQCGDCGFTCKQSRCLQQHRRLKHEGVKPHQCPFCDFSTTRRYRLEAHQSRHTGVG
FT                   RIPCSSCPQTFGTNSKLRLHQLRVHDKTPTHFCPLCDYSGYLRHDITRHVNSCHQGTPS
FT                   FSCTQCEAQFSSETALKQHALRRHPEPTPPSSGCPVEVTEGPLHCSHCGLLCPSPASLR
FT                   GHTRKQHPRLECGACQESFPNRPALDEHRRQHHFSHRCQLCSFAARERVGLVKHYLEQH
FT                   EESSTAPSDGDAGQPSLCCPFCDFACRHQLVLDHHVKGHGGTRLYKCTDCAYSTKNRQK
FT                   ITWHSRIHTGEKPYHCHLCAYACADPSRLKYHMRIHKEERKYLCPECGYKCKWVNQLKY
FT                   HMTKHTGLKPYQCPECEYCTNRADALRVHRETRHREARAFMCEQCGKAFKTRFLLRTHL
FT                   RKHSEAKPYVCNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHVRRH
FT                   HPDQADPNQGVGKDPTTPTVHLHDVKLEDPSPPAPPAPSTGPEG"
FT   mRNA            complement(join(22893172..22893762,22895628..22895815,
FT                   22896045..22896260))
FT                   /locus_tag="mCG_133876"
FT                   /product="mCG133876, transcript variant mCT185749"
FT                   /note="gene_id=mCG133876.2 transcript_id=mCT185749.0
FT                   created on 17-JUN-2003"
FT   CDS             complement(22893315..22893728)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133876"
FT                   /product="mCG133876, isoform CRA_c"
FT                   /note="gene_id=mCG133876.2 transcript_id=mCT185749.0
FT                   protein_id=mCP107006.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D251"
FT                   /db_xref="MGI:MGI:1924514"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D251"
FT                   /protein_id="EDL00336.1"
FT                   /translation="MTDPVLASQLANGTGEMDGLCSELLLIPPPLSNHGILGPVQNTCA
FT                   SGELAPLPADPGCLLVEATATEEGPGNMEIIVEAVTGTLSPGAPEETSGTNIVATRPVG
FT                   HRLEFFHLCYFWSLSLNVMRTQGSMLFLHPEML"
FT   gene            22896385..22900503
FT                   /gene="Bcs1l"
FT                   /locus_tag="mCG_133893"
FT                   /note="gene_id=mCG133893.1"
FT   mRNA            join(22896385..22896551,22897550..22897942,
FT                   22898024..22898163,22898329..22898523,22898735..22898798,
FT                   22899024..22899193,22899653..22899770,22899886..22900503)
FT                   /gene="Bcs1l"
FT                   /locus_tag="mCG_133893"
FT                   /product="BCS1-like (yeast), transcript variant mCT135265"
FT                   /note="gene_id=mCG133893.1 transcript_id=mCT135265.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(22896402..22896457,22897550..22897942,
FT                   22898024..22898163,22898329..22898523,22898735..22898798,
FT                   22899024..22899193,22899653..22899770,22899886..22900250)
FT                   /gene="Bcs1l"
FT                   /locus_tag="mCG_133893"
FT                   /product="BCS1-like (yeast), transcript variant mCT173377"
FT                   /note="gene_id=mCG133893.1 transcript_id=mCT173377.0
FT                   created on 17-SEP-2002"
FT   CDS             join(22897623..22897942,22898024..22898163,
FT                   22898329..22898523,22898735..22898798,22899024..22899193,
FT                   22899653..22899770,22899886..22900135)
FT                   /codon_start=1
FT                   /gene="Bcs1l"
FT                   /locus_tag="mCG_133893"
FT                   /product="BCS1-like (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG133893.1 transcript_id=mCT173377.0
FT                   protein_id=mCP96296.0 isoform=CRA_a"
FT                   /protein_id="EDL00338.1"
FT                   /translation="MPFSDFVLALKDNPYFGAGFGLVGVGTALAMARKGAQLGLVAFRR
FT                   HYMITLEVPARDRSYAWLLSWLTRHSTRTQHLSVETSYLQHESGRISTKFEFIPSPGNH
FT                   FIWYQGKWIRVERNRDMQMVDLQTGTPWESVTFTALGTDRKVFFNILEEARALALQQEE
FT                   GKTVMYTAVGSEWRTFGYPRRRRPLDSVVLQQGLADRIVKDIREFIDNPKWYIDRGIPY
FT                   RRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVLL
FT                   EDVDAAFLSRDLAVENPIKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNYIDRLDPA
FT                   LIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLKATSEISPAQVQGY
FT                   FMLYKNDPMGAVHNIESLR"
FT   CDS             join(22897623..22897942,22898024..22898163,
FT                   22898329..22898523,22898735..22898798,22899024..22899193,
FT                   22899653..22899770,22899886..22900135)
FT                   /codon_start=1
FT                   /gene="Bcs1l"
FT                   /locus_tag="mCG_133893"
FT                   /product="BCS1-like (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG133893.1 transcript_id=mCT135265.0
FT                   protein_id=mCP74685.1 isoform=CRA_a"
FT                   /protein_id="EDL00339.1"
FT                   /translation="MPFSDFVLALKDNPYFGAGFGLVGVGTALAMARKGAQLGLVAFRR
FT                   HYMITLEVPARDRSYAWLLSWLTRHSTRTQHLSVETSYLQHESGRISTKFEFIPSPGNH
FT                   FIWYQGKWIRVERNRDMQMVDLQTGTPWESVTFTALGTDRKVFFNILEEARALALQQEE
FT                   GKTVMYTAVGSEWRTFGYPRRRRPLDSVVLQQGLADRIVKDIREFIDNPKWYIDRGIPY
FT                   RRGYLLYGPPGCGKSSFITALAGELEHSICLLSLTDSSLSDDRLNHLLSVAPQQSLVLL
FT                   EDVDAAFLSRDLAVENPIKYQGLGRLTFSGLLNALDGVASTEARIVFMTTNYIDRLDPA
FT                   LIRPGRVDLKEYVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLKATSEISPAQVQGY
FT                   FMLYKNDPMGAVHNIESLR"
FT   gene            complement(22901878..22909523)
FT                   /gene="Rnf25"
FT                   /locus_tag="mCG_133873"
FT                   /note="gene_id=mCG133873.1"
FT   mRNA            complement(join(22901878..22902527,22902685..22902819,
FT                   22903334..22903426,22903756..22903893,22903991..22904062,
FT                   22906488..22906557,22906656..22906723,22906819..22906918,
FT                   22907193..22907267,22909452..22909523))
FT                   /gene="Rnf25"
FT                   /locus_tag="mCG_133873"
FT                   /product="ring finger protein 25, transcript variant
FT                   mCT135245"
FT                   /note="gene_id=mCG133873.1 transcript_id=mCT135245.1
FT                   created on 24-JUL-2002"
FT   mRNA            complement(join(22901878..22902527,22902685..22902819,
FT                   22903334..22903423,22903756..22903893,22903991..22904062,
FT                   22906488..22906557,22906656..22906723,22906819..22906918,
FT                   22907193..22907267,22909452..>22909513))
FT                   /gene="Rnf25"
FT                   /locus_tag="mCG_133873"
FT                   /product="ring finger protein 25, transcript variant
FT                   mCT189251"
FT                   /note="gene_id=mCG133873.1 transcript_id=mCT189251.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(22901949..22902527,22902685..22902819,
FT                   22903334..22903423,22903756..22903893,22903991..22904062,
FT                   22906488..22906557,22906656..22906723,22906819..22906918,
FT                   22907193..22907267,22909452..>22909513))
FT                   /codon_start=1
FT                   /gene="Rnf25"
FT                   /locus_tag="mCG_133873"
FT                   /product="ring finger protein 25, isoform CRA_b"
FT                   /note="gene_id=mCG133873.1 transcript_id=mCT189251.0
FT                   protein_id=mCP110277.0 isoform=CRA_b"
FT                   /protein_id="EDL00341.1"
FT                   /translation="RPRAGEDMAASASTAAGEEDWVLPSEVEVLESIYLDELQVMKGNG
FT                   RSPWEIFITLHPATAEVQDSQFVCFTLVLRIPVQYPHEVPQISIRNPRGLSDEQIHKIS
FT                   QALGHVAKEGLGTAMLYELIEKGKEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYF
FT                   HCHCLARYIQHMEQELTTQEQEQERQHVVTKQAVGVQCPVCREPLVYDLASLKAAPEPQ
FT                   QPMELYQPSAESLRQQEELKLLYQRQQEKGGIIDLEAERNRYFISLQQPPAALEPESAV
FT                   DVSREPQPPNALSAEQSTSLADQSTLPTSLPMTTQYTYEKTSGAGPNQQRPGETQKSVL
FT                   DPPRHGRGSWRQYDRRHPKGGECCTPKGTSEIHELPPPEKPLKETVDLKAEPRNKGLTG
FT                   HPQEKGPGSWQGPSARRTRDCARWERSKNRTPGSCYPHLPRGQGAYRSGTRREPLGLES
FT                   EEGS"
FT   CDS             complement(join(22901949..22902527,22902685..22902819,
FT                   22903334..22903426,22903756..22903893,22903991..22904062,
FT                   22906488..22906557,22906656..22906723,22906819..22906918,
FT                   22907193..22907267,22909452..22909492))
FT                   /codon_start=1
FT                   /gene="Rnf25"
FT                   /locus_tag="mCG_133873"
FT                   /product="ring finger protein 25, isoform CRA_a"
FT                   /note="gene_id=mCG133873.1 transcript_id=mCT135245.1
FT                   protein_id=mCP74542.1 isoform=CRA_a"
FT                   /protein_id="EDL00340.1"
FT                   /translation="MAASASTAAGEEDWVLPSEVEVLESIYLDELQVMKGNGRSPWEIF
FT                   ITLHPATAEVQDSQFVCFTLVLRIPVQYPHEVPQISIRNPRGLSDEQIHKISQALGHVA
FT                   KEGLGTAMLYELIEKGKEILTDNNIPHGQCVICLYGFQEKEAFTKTPCYHYFHCHCLAR
FT                   YIQHMEQELTTQEQEQERQHVVTKQKAVGVQCPVCREPLVYDLASLKAAPEPQQPMELY
FT                   QPSAESLRQQEELKLLYQRQQEKGGIIDLEAERNRYFISLQQPPAALEPESAVDVSREP
FT                   QPPNALSAEQSTSLADQSTLPTSLPMTTQYTYEKTSGAGPNQQRPGETQKSVLDPPRHG
FT                   RGSWRQYDRRHPKGGECCTPKGTSEIHELPPPEKPLKETVDLKAEPRNKGLTGHPQEKG
FT                   PGSWQGPSARRTRDCARWERSKNRTPGSCYPHLPRGQGAYRSGTRREPLGLESEEGS"
FT   gene            <22909606..22942147
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /note="gene_id=mCG133878.2"
FT   mRNA            join(<22909606..22909740,22910156..22910328,
FT                   22911265..22911405,22911524..22911601,22913516..22913646,
FT                   22914283..22914532,22916043..22916136,22916420..22916529,
FT                   22916672..22916859,22917939..22918038,22921829..22921972,
FT                   22927446..22927625,22928535..22928632,22929089..22929187,
FT                   22930745..22930895,22931265..22931392,22931795..22931899,
FT                   22932649..22932747,22932839..22932927,22933172..22933235,
FT                   22933396..22933506,22936844..22936918,22937985..22938156,
FT                   22938398..22938545,22938763..22940012,22940971..22942147)
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), transcript variant mCT189262"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT189262.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(22909608..22909740,22910156..22910328,
FT                   22911265..22911405,22911524..22911601,22913516..22913646,
FT                   22914283..22914532,22916043..22916136,22916360..22916529,
FT                   22916672..22916859,22917939..22918038,22921829..22921903,
FT                   22927479..22927625,22928535..22928632,22929082..22929187,
FT                   22930745..22930895,22931265..22931392,22931795..22931899,
FT                   22932649..22932747,22932839..22932927,22933172..22933235,
FT                   22933396..22933506,22936844..22936924,22937985..22938156,
FT                   22938398..22938545,22938763..22938910,22939266..22940012,
FT                   22940971..22942142)
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), transcript variant mCT135250"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT135250.1
FT                   created on 17-SEP-2002"
FT   mRNA            join(<22909630..22909740,22910156..22910328,
FT                   22911265..22911405,22911524..22911601,22913516..22913646,
FT                   22914283..22914532,22916043..22916136,22916360..22916529,
FT                   22916672..22916859,22917939..22918038,22921829..22921972,
FT                   22927446..22927625,22928535..22928632,22929082..22929187,
FT                   22930745..22930895,22931265..22931392,22931795..22931899,
FT                   22932649..22932747,22932839..22932927,22933172..22933235,
FT                   22933396..22933506,22936844..22936918,22937985..22938156,
FT                   22938398..22938545,22938763..22938910,22939266..>22939353)
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), transcript variant mCT189260"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT189260.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<22909719..22909740,22910156..22910328,
FT                   22911265..22911405,22911524..22911601,22913516..22913646,
FT                   22914283..22914532,22916043..22916136,22916360..22916529,
FT                   22916672..22916859,22917939..22918038,22921829..22921972,
FT                   22927446..22927625,22928535..22928632,22929082..22929187,
FT                   22930745..22930895,22931265..22931392,22931795..22931899,
FT                   22932649..22932747,22932839..22932927,22933172..22933235,
FT                   22933396..22933506,22936844..22936918,22937985..22938156,
FT                   22938398..22938545,22938763..22938910,22939266..>22939353)
FT                   /codon_start=1
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT189260.0
FT                   protein_id=mCP110280.0 isoform=CRA_b"
FT                   /protein_id="EDL00343.1"
FT                   /translation="SVPGSKTGLPDVWNYPWIYSSLSPSSFYLLRDPETLAMEKYHVLE
FT                   MIGEGSFGRVYKGRKKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLWHPNIVHML
FT                   DSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDM
FT                   KPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHTADLWS
FT                   VGCILYELAVGTPPFYTTSIFQLVSLILKDPVRWPSTISSCFKNFLQGLLTKDPRQRLS
FT                   WPDLLHHPFIAGRVTIITEPAGSDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSRILR
FT                   QACKLMAEEAKQKEDQNAGSALEQEDGLCKVTPSTAPVPGLKATPQESSLLAGILASEM
FT                   KNNWEDWGAGEAPRTSRENHINLECEQGFPEPRPEAMGRQSTDVVDPENEEPDSDDEWQ
FT                   RLLETSEPGPVQLKSPLTLLCNPDFCQRIQSQLRGTGEQILKGVLDGVSHLLPVLRILS
FT                   SLLSSCNDSVLLYSFCQEAGLPELPLSLLRYSQESSSIQQQPWYGALLRDLVAVVQAYF
FT                   SCTFNLERSQTGDSLQVFQEAASLFLDLLGKLLAQSDDSEQTFRRDSLMCFAVLCEAVD
FT                   GNSWAVSKAFYSSLLTTQRAVLDGLLHGLTVPQLPFHTPPGAPQVSQPLREQSEDVPGA
FT                   ISSALAAMCTAPVGLPSCWDAKEQVSWHLANQLTEDSSQLRPSLISGLRHHVLCLHLLK
FT                   VLYACCYISERLCHILGQEPLALESLLMLVQGKVKVADWEESTEVALYLLSLLVFRLQD
FT                   LPSGMEKLGSEVATLFTHSHVVSLVNAAACLLGQLGQQGVTFDLQPREWIAAAAHALSA
FT                   PAEVRLTPPCSCGFYDGLLILLLQLLMQGKPGLIRDVVGSEVWTILWHRFSMALRLPEE
FT                   VSAQEDDLLLSSPSSLEPDWTLISPQGMAALLSLAMAIFTQESQLCLSHLSQHGSVLML
FT                   TLKHLLSPSFLHHLSQAPQGPEFLPVVVLSVCKLLCFPFALDVDADLLVGVLADLRASE
FT                   VVVCLLQVCCHHLSLLQAELPIGLLTRLALTDSASL"
FT   CDS             join(<22909719..22909740,22910156..22910328,
FT                   22911265..22911405,22911524..22911601,22913516..22913646,
FT                   22914283..22914532,22916043..22916136,22916420..22916529,
FT                   22916672..22916859,22917939..22918038,22921829..22921972,
FT                   22927446..22927625,22928535..22928632,22929089..22929187,
FT                   22930745..22930820)
FT                   /codon_start=1
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), isoform CRA_d"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT189262.0
FT                   protein_id=mCP110282.0 isoform=CRA_d"
FT                   /protein_id="EDL00345.1"
FT                   /translation="SVPGSKTGLPDVWNYPWIYSSLSPSSFYLLRDPETLAMEKYHVLE
FT                   MIGEGSFGRVYKGRKKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLWHPNIVHML
FT                   DSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDM
FT                   KPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHTADLWS
FT                   VGCILYELAVGTPPFYTTSIFQLVSLILKDPVRWPSTISSCFKNFLQGLLTKDPRQRLS
FT                   WPDLLHHPFIAGRVTKLQVLKDEQAHRLAPKGNQSRILRQACKLMAEEAKQKEDQNAGS
FT                   ALEQEDGLCKVTPSTAPVPGLKATPQESSLLAGILASEMKNNWEDWGAGEAPRTSRENH
FT                   INLECEQGFPEPRPEAMGRQSTDVVDPENEEPDSDDEWQRLLETSEPGPVQLKSPLTLL
FT                   CNPDFCQRIQSQLRGTGEQILKGVLDGVSHLLPVLRILSSLLSSCNDSVLLYSFCQEAG
FT                   LPELPLSLLRYSQESSSIQQQPWYGALLRDLVAVVQAYFSCTFNLERSQTGDRCFRRPP
FT                   ASFWTCWGSCWPNQMIPSRHFEGIALCALLSCVKLWTETAGPSPKPSTPAC"
FT   mRNA            join(<22909766..22909989,22910156..22910328,
FT                   22911265..22911405,22911524..22911601,22913516..22913646,
FT                   22914283..22914532,22916043..22916136,22916360..22916529,
FT                   22916672..22916859,22917939..22918038,22921829..22921972,
FT                   22930745..22930895,22931265..22931392,22931795..22931899,
FT                   22932649..22932747,22932839..22932927,22933172..22933235,
FT                   22933396..22933506,22936844..22936924,22937985..22938156,
FT                   22938398..22938545,22938763..22938910,22939266..22940012,
FT                   22940971..22941298)
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), transcript variant mCT189259"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT189259.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<22909944..22909989,22910156..22910328,
FT                   22911265..22911405,22911524..22911601,22913516..22913646,
FT                   22914283..22914532,22916043..22916136,22916360..22916529,
FT                   22916672..22916859,22917939..22918038,22921829..22921972,
FT                   22930745..22930895,22931265..22931392,22931795..22931899,
FT                   22932649..22932747,22932839..22932927,22933172..22933235,
FT                   22933396..22933506,22936844..22936924,22937985..22938156,
FT                   22938398..22938545,22938763..22938910,22939266..22940012,
FT                   22940971..22941114)
FT                   /codon_start=1
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT189259.0
FT                   protein_id=mCP110279.0 isoform=CRA_a"
FT                   /protein_id="EDL00342.1"
FT                   /translation="KERVSIAGGEGKGNTGLPDVWNYPWIYSSLSPSSFYLLRDPETLA
FT                   MEKYHVLEMIGEGSFGRVYKGRKKYSAQVVALKFIPKLGRSEKELRNLQREIEIMRGLW
FT                   HPNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQAIAAQLVSALYYLHS
FT                   HRILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGTPLYMSPELVEERPY
FT                   DHTADLWSVGCILYELAVGTPPFYTTSIFQLVSLILKDPVRWPSTISSCFKNFLQGLLT
FT                   KDPRQRLSWPDLLHHPFIAGRVTIITEPAGSDLGTPFTSRLPPELQVLKDEQAHRLAPK
FT                   GNQSRILRQACKLMAEEAKQKEDQNAGSALEQEDGLCKVTPSTAPVPGLKATPQESSLL
FT                   AGILASEMKNNWEDWGAGEAPRTSRENHINLECEQGFPEPRPEAMGRQSTDVVDPENEE
FT                   PDSDDEWQRLLETSEPGPVQLKSPLTLLCNPDFCQRIQSQLRGTGEQCFAVLCEAVDGN
FT                   SWAVSKAFYSSLLTTQRAVLDGLLHGLTVPQLPFHTPPGAPQVSQPLREQSEDVPGAIS
FT                   SALAAMCTAPVGLPSCWDAKEQVSWHLANQLTEDSSQLRPSLISGLRHHVLCLHLLKVL
FT                   YACCYISERLCHILGQEPLALESLLMLVQGKVKVADWEESTEVALYLLSLLVFRLQDLP
FT                   SGMEKLGSEVATLFTHSHVVSLVNAAACLLGQLGQQGVTFDLQPREWIAAAAHALSAPA
FT                   EVRLTPPCSCGFYDGLLILLLQLLMQVQGKPGLIRDVVGSEVWTILWHRFSMALRLPEE
FT                   VSAQEDDLLLSSPSSLEPDWTLISPQGMAALLSLAMAIFTQESQLCLSHLSQHGSVLML
FT                   TLKHLLSPSFLHHLSQAPQGPEFLPVVVLSVCKLLCFPFALDVDADLLVGVLADLRASE
FT                   VVVCLLQVCCHHLSLLQAELPIGLLTRLALTDSASLKQFVNTVATSSRAIISFLSVVLL
FT                   SDQPLMISDLLSLLTHTARILSPSHLSFIQELLSGSDESYRPLRSLLGHSENTVRVRAY
FT                   GLLGHLLQHSMALRGALQSQSGLLNLLLLGLGDKDPAVRRSASFAVGNAAYQAGPLGPA
FT                   LAAAVPSMTQLLGDAQDGIRRNAASALGNLGPEGLGKELLKCQVPQRLLEMACGDPQPT
FT                   VKEAALIALRSLQQESCIHQVLVSLGASEKLALLSLGNQLLPNSSNRPASVRHCRKLIQ
FT                   LLRPTHST"
FT   mRNA            join(<22910187..22910328,22911265..22911405,
FT                   22911524..22911601,22913516..22913646,22914283..22914532,
FT                   22916043..22916136,22916360..22916529,22916672..22916859,
FT                   22917939..22918038,22921829..22921972,22927446..22927625,
FT                   22928535..22928632,22929082..22929187,22930745..22930895,
FT                   22931265..22931392,22931795..22931899,22932649..22932747,
FT                   22932839..22932927,22933172..22933235,22933396..22933506,
FT                   22936844..22936924,22937985..22938156,22938398..22938545,
FT                   22938763..22938910,22939266..22940012,22940971..22942147)
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), transcript variant mCT189261"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT189261.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<22910188..22910328,22911265..22911405,
FT                   22911524..22911601,22913516..22913646,22914283..22914532,
FT                   22916043..22916136,22916360..22916529,22916672..22916859,
FT                   22917939..22918038,22921829..22921972,22927446..22927625,
FT                   22928535..22928632,22929082..22929187,22930745..22930895,
FT                   22931265..22931392,22931795..22931899,22932649..22932747,
FT                   22932839..22932927,22933172..22933235,22933396..22933506,
FT                   22936844..22936924,22937985..22938156,22938398..22938545,
FT                   22938763..22938910,22939266..22940012,22940971..22941114)
FT                   /codon_start=1
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), isoform CRA_c"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT189261.0
FT                   protein_id=mCP110281.0 isoform=CRA_c"
FT                   /protein_id="EDL00344.1"
FT                   /translation="YSSLSPSSFYLLRDPETLAMEKYHVLEMIGEGSFGRVYKGRKKYS
FT                   AQVVALKFIPKLGRSEKELRNLQREIEIMRGLWHPNIVHMLDSFETDKEVVVVTDYAEG
FT                   ELFQILEDDGKLPEDQVQAIAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIKLCDF
FT                   GFARAMSTNTMVLTSIKGTPLYMSPELVEERPYDHTADLWSVGCILYELAVGTPPFYTT
FT                   SIFQLVSLILKDPVRWPSTISSCFKNFLQGLLTKDPRQRLSWPDLLHHPFIAGRVTIIT
FT                   EPAGSDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSRILRQACKLMAEEAKQKEDQNA
FT                   GSALEQEDGLCKVTPSTAPVPGLKATPQESSLLAGILASEMKNNWEDWGAGEAPRTSRE
FT                   NHINLECEQGFPEPRPEAMGRQSTDVVDPENEEPDSDDEWQRLLETSEPGPVQLKSPLT
FT                   LLCNPDFCQRIQSQLRGTGEQILKGVLDGVSHLLPVLRILSSLLSSCNDSVLLYSFCQE
FT                   AGLPELPLSLLRYSQESSSIQQQPWYGALLRDLVAVVQAYFSCTFNLERSQTGDSLQVF
FT                   QEAASLFLDLLGKLLAQSDDSEQTFRRDSLMCFAVLCEAVDGNSWAVSKAFYSSLLTTQ
FT                   RAVLDGLLHGLTVPQLPFHTPPGAPQVSQPLREQSEDVPGAISSALAAMCTAPVGLPSC
FT                   WDAKEQVSWHLANQLTEDSSQLRPSLISGLRHHVLCLHLLKVLYACCYISERLCHILGQ
FT                   EPLALESLLMLVQGKVKVADWEESTEVALYLLSLLVFRLQDLPSGMEKLGSEVATLFTH
FT                   SHVVSLVNAAACLLGQLGQQGVTFDLQPREWIAAAAHALSAPAEVRLTPPCSCGFYDGL
FT                   LILLLQLLMQVQGKPGLIRDVVGSEVWTILWHRFSMALRLPEEVSAQEDDLLLSSPSSL
FT                   EPDWTLISPQGMAALLSLAMAIFTQESQLCLSHLSQHGSVLMLTLKHLLSPSFLHHLSQ
FT                   APQGPEFLPVVVLSVCKLLCFPFALDVDADLLVGVLADLRASEVVVCLLQVCCHHLSLL
FT                   QAELPIGLLTRLALTDSASLKQFVNTVATSSRAIISFLSVVLLSDQPLMISDLLSLLTH
FT                   TARILSPSHLSFIQELLSGSDESYRPLRSLLGHSENTVRVRAYGLLGHLLQHSMALRGA
FT                   LQSQSGLLNLLLLGLGDKDPAVRRSASFAVGNAAYQAGPLGPALAAAVPSMTQLLGDAQ
FT                   DGIRRNAASALGNLGPEGLGKELLKCQVPQRLLEMACGDPQPTVKEAALIALRSLQQES
FT                   CIHQVLVSLGASEKLALLSLGNQLLPNSSNRPASVRHCRKLIQLLRPTHST"
FT   CDS             join(22910245..22910328,22911265..22911405,
FT                   22911524..22911601,22913516..22913646,22914283..22914532,
FT                   22916043..22916136,22916360..22916529,22916672..22916859,
FT                   22917939..22918038,22921829..22921903,22927479..22927625,
FT                   22928535..22928632,22929082..22929187,22930745..22930895,
FT                   22931265..22931392,22931795..22931899,22932649..22932747,
FT                   22932839..22932927,22933172..22933235,22933396..22933506,
FT                   22936844..22936924,22937985..22938156,22938398..22938545,
FT                   22938763..22938910,22939266..22940012,22940971..22941114)
FT                   /codon_start=1
FT                   /gene="Stk36"
FT                   /locus_tag="mCG_133878"
FT                   /product="serine/threonine kinase 36 (fused homolog,
FT                   Drosophila), isoform CRA_e"
FT                   /note="gene_id=mCG133878.2 transcript_id=mCT135250.1
FT                   protein_id=mCP74840.1 isoform=CRA_e"
FT                   /protein_id="EDL00346.1"
FT                   /translation="MEKYHVLEMIGEGSFGRVYKGRKKYSAQVVALKFIPKLGRSEKEL
FT                   RNLQREIEIMRGLWHPNIVHMLDSFETDKEVVVVTDYAEGELFQILEDDGKLPEDQVQA
FT                   IAAQLVSALYYLHSHRILHRDMKPQNILLAKGGGIKLCDFGFARAMSTNTMVLTSIKGT
FT                   PLYMSPELVEERPYDHTADLWSVGCILYELAVGTPPFYTTSIFQLVSLILKDPVRWPST
FT                   ISSCFKNFLQGLLTKDPRQRLSWPDLLHHPFIAGRVTIITEPAGSDLGTPFTSRLPPEL
FT                   QVLKDEQAHRLAPKGNQSRILRQACKLMAEEAKQKEDQNAGSALEQEDGLCKVTPSTAP
FT                   VPGLKATPQESSLLAGILASEMKNNWEDWGAGEAPRTSRENHINLECEQGFPEPRPEAM
FT                   GRQSTDVVDPENEEPDSDDEWQRLLETSEPGPVQLKSPLLPVLRILSSLLSSCNDSVLL
FT                   YSFCQEAGLPELPLSLLRYSQESSSIQQQPWYGALLRDLVAVVQAYFSCTFNLERSQTG
FT                   DSLQVFQEAASLFLDLLGKLLAQSDDSEQTFRRDSLMCFAVLCEAVDGNSWAVSKAFYS
FT                   SLLTTQRAVLDGLLHGLTVPQLPFHTPPGAPQVSQPLREQSEDVPGAISSALAAMCTAP
FT                   VGLPSCWDAKEQVSWHLANQLTEDSSQLRPSLISGLRHHVLCLHLLKVLYACCYISERL
FT                   CHILGQEPLALESLLMLVQGKVKVADWEESTEVALYLLSLLVFRLQDLPSGMEKLGSEV
FT                   ATLFTHSHVVSLVNAAACLLGQLGQQGVTFDLQPREWIAAAAHALSAPAEVRLTPPCSC
FT                   GFYDGLLILLLQLLMQVQGKPGLIRDVVGSEVWTILWHRFSMALRLPEEVSAQEDDLLL
FT                   SSPSSLEPDWTLISPQGMAALLSLAMAIFTQESQLCLSHLSQHGSVLMLTLKHLLSPSF
FT                   LHHLSQAPQGPEFLPVVVLSVCKLLCFPFALDVDADLLVGVLADLRASEVVVCLLQVCC
FT                   HHLSLLQAELPIGLLTRLALTDSASLKQFVNTVATSSRAIISFLSVVLLSDQPLMISDL
FT                   LSLLTHTARILSPSHLSFIQELLSGSDESYRPLRSLLGHSENTVRVRAYGLLGHLLQHS
FT                   MALRGALQSQSGLLNLLLLGLGDKDPAVRRSASFAVGNAAYQAGPLGPALAAAVPSMTQ
FT                   LLGDAQDGIRRNAASALGNLGPEGLGKELLKCQVPQRLLEMACGDPQPTVKEAALIALR
FT                   SLQQESCIHQVLVSLGASEKLALLSLGNQLLPNSSNRPASVRHCRKLIQLLRPTHST"
FT   gap             22933717..22933833
FT                   /estimated_length=117
FT   gap             22946514..22947144
FT                   /estimated_length=631
FT   gap             22956476..22956495
FT                   /estimated_length=20
FT   gap             22966476..22966686
FT                   /estimated_length=211
FT   gene            22967189..23003151
FT                   /gene="Ttll4"
FT                   /locus_tag="mCG_133891"
FT                   /note="gene_id=mCG133891.2"
FT   mRNA            join(22967189..22967301,22978254..22978420,
FT                   22984412..22985728,22986739..22986829,22987179..22987242,
FT                   22990499..22990623,22991040..22991150,22991497..22991573,
FT                   22992384..22992575,22992658..22992740,22992903..22993031,
FT                   22993344..22993466,22993747..22993845,22994503..22994637,
FT                   22995140..22995331,23000888..23000990,23001585..23001795,
FT                   23001922..23001992,23002359..23002429,23002621..23003151)
FT                   /gene="Ttll4"
FT                   /locus_tag="mCG_133891"
FT                   /product="tubulin tyrosine ligase-like family, member 4"
FT                   /note="gene_id=mCG133891.2 transcript_id=mCT135263.2
FT                   created on 20-MAR-2003"
FT   CDS             join(22978364..22978420,22984412..22985728,
FT                   22986739..22986829,22987179..22987242,22990499..22990623,
FT                   22991040..22991150,22991497..22991573,22992384..22992575,
FT                   22992658..22992740,22992903..22993031,22993344..22993466,
FT                   22993747..22993845,22994503..22994637,22995140..22995331,
FT                   23000888..23000990,23001585..23001795,23001922..23001992,
FT                   23002359..23002429,23002621..23002879)
FT                   /codon_start=1
FT                   /gene="Ttll4"
FT                   /locus_tag="mCG_133891"
FT                   /product="tubulin tyrosine ligase-like family, member 4"
FT                   /note="gene_id=mCG133891.2 transcript_id=mCT135263.2
FT                   protein_id=mCP74645.2"
FT                   /protein_id="EDL00347.1"
FT                   /translation="MQRGWEEEECPGNSGDFTQMASAGTEHYSIGLRRGNSFKQRHPSG
FT                   TVSASPSEKPSEVKVWSQAHQQVKPIWKLEKKHVGTLSAGLGTSFLGVPSQPAYFLCPS
FT                   TLCSSGTTAVIAGHSNPCYLQSLPNLFSNTLLYRRTNVRQKPYQQLESFCLRSSPSEKR
FT                   SFSLPQKGLPVSVTANKATSSTVFPMAQPMATSPTDPYLSLAAAGENPSRKSLASAISG
FT                   KIASPLSYKPMLNNNSFMRPNSTKVPLSQATDGLKPVSSPKIQPVSWHHSGGTGDCVPQ
FT                   PGDHKVPQNIATVLDDVTAPITPSIPSTLNISTASVTSSQCSQSNFRMEAHPCGLDENP
FT                   DSQSATKEVHFTEAVRKLAEKGLEKMPRQGYQFEQACFVNPSFQWGLLNRSRRWKPLMG
FT                   QRFPQEDIGLDSAILPGTSDTLGLDSTVFCTKRISIHLLASHVHGLNPSPACGSAVDPQ
FT                   PNQVEPEDTEDELGDGLEDSCSHDENEEEEGDSECSSLSVVSPSESVALISRNCVDLMS
FT                   KSLPNHEKVVRPALIYSLFPNVTPTIYFGTRDERVEKLPWEQRRLLRWKMSTVTPNIVK
FT                   QTIGRSHFKISKRNDDWLGCWGHHMKSPGFRSIREHQKLNHFPGSFQIGRKDRLWRNLS
FT                   RMQSRFGKKEFSFFPQSFILPQDSKLLRKAWESSSRQKWIVKPPASARGIGIQVIHKWS
FT                   QLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSDGLVRFASCKYSPS
FT                   MKSLSNKFMHLTNYSVNKKNTEYQANADETACQGHKWALKALWNYLSQKGINSDAIWEK
FT                   IKDVVVKTIISSEPYVTNLLKLYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLHS
FT                   NSPLDISIKGQMIRDLLNLAGFVLPNMEDIISSSSSPSSSSGSSTRSAAHPEVGKVARA
FT                   ARLPSSPRDKCQMTPEHFTAQKMKKAYYLTQKIPDQDFYASVLDVLTPDDVRVLVEMED
FT                   EFSRRGQFERIFPSRISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRNWCYKG
FT                   FHTGIVSDSAPLWSLPTSLMTTSKGDGTPNSASKSRKKSASEGTTLSSEDRSTPKSKKS
FT                   QAGLSPISRKTLSSRSNENTSKQSKRSTPGLPVLKYSGQSSRLSAASASQSVTDSRLTA
FT                   VSS"
FT   gap             23005049..23005178
FT                   /estimated_length=130
FT   gap             23009764..23010159
FT                   /estimated_length=396
FT   gap             23012832..23012851
FT                   /estimated_length=20
FT   gene            23018629..23043280
FT                   /gene="Cyp27a1"
FT                   /locus_tag="mCG_133861"
FT                   /note="gene_id=mCG133861.1"
FT   mRNA            join(23018629..23019332,23037309..23037499,
FT                   23040667..23040866,23040944..23041141,23041254..23041426,
FT                   23042071..23042237,23042407..23042488,23042569..23042781,
FT                   23042933..23043280)
FT                   /gene="Cyp27a1"
FT                   /locus_tag="mCG_133861"
FT                   /product="cytochrome P450, family 27, subfamily a,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG133861.1 transcript_id=mCT135233.1
FT                   created on 24-JUL-2002"
FT   CDS             join(23019072..23019332,23037309..23037499,
FT                   23040667..23040866,23040944..23041141,23041254..23041426,
FT                   23042071..23042237,23042407..23042488,23042569..23042781,
FT                   23042933..23043049)
FT                   /codon_start=1
FT                   /gene="Cyp27a1"
FT                   /locus_tag="mCG_133861"
FT                   /product="cytochrome P450, family 27, subfamily a,
FT                   polypeptide 1"
FT                   /note="gene_id=mCG133861.1 transcript_id=mCT135233.1
FT                   protein_id=mCP74720.1"
FT                   /protein_id="EDL00348.1"
FT                   /translation="MAAWSRTRLRWTLLDPRVVGRGLCPQGARAKATIPAALQAQESTE
FT                   GPGTGQDRPRLRSPAELPGTGTLQFLFQLFLQGYVLHLPDLQVLNKTKYGPMWTTSFGT
FT                   YTNVNLASAPLLEQVMRQEGKYPIRDHMDQWKDHRDHKGLTYGIFIAQGEQWYHLRQAL
FT                   KQRLLKPDEAALYTDALNEVISDFITRLDQVRAESESGDQVPDMAHLLYHLALEAITYI
FT                   LFEKRIGCLKPSIPEDTAAFIRSVAIMFQNSVYITFLPKWNRPLLPFWKRYLNGWDNIF
FT                   SFGKKLIDEKVQELKAQLQETGPDGVRVSGYLHFLLTNELLSTQETIGTFPELLLAGVD
FT                   TTSNTLTWALYHLSKSPEIQEALHKEVTGVVPFGKVPQHKDFAHMPLLKAVIKETLRLY
FT                   PVVPTNSRIITEKETEINGFLFPKNTQFVLCHYVVSRDPSVFPEPNSFQPHRWLRKKEA
FT                   DNPGILHPFGSVPFGYGVRSCLGRRIAELEMQLMLSRLVQKYEIALAPGMGEVKTVSRI
FT                   VLVPSKKVRLHFLQRQ"
FT   gap             23030699..23030718
FT                   /estimated_length=20
FT   gene            complement(23044315..>23054337)
FT                   /gene="Prkag3"
FT                   /locus_tag="mCG_133883"
FT                   /note="gene_id=mCG133883.1"
FT   mRNA            complement(join(23044315..23045455,23045982..23046216,
FT                   23046547..23046693,23046862..23046899,23049837..23050002,
FT                   23050102..23050228,23050698..23050764,23050932..23050977,
FT                   23051078..23051136,23051251..23051332,23052533..23052939,
FT                   23053253..23053405,23053853..23053892,23054199..23054337))
FT                   /gene="Prkag3"
FT                   /locus_tag="mCG_133883"
FT                   /product="protein kinase, AMP-activated, gamma 3
FT                   non-catatlytic subunit, transcript variant mCT135255"
FT                   /note="gene_id=mCG133883.1 transcript_id=mCT135255.1
FT                   created on 21-NOV-2002"
FT   mRNA            complement(join(23044894..23045455,23045982..23046216,
FT                   23046547..23046693,23046862..23046899,23049837..23050002,
FT                   23050102..23050228,23050698..23050752,23050932..23050977,
FT                   23051078..23051136,23051251..23051332,23052533..23052939,
FT                   23053253..23053405,23053853..23053892,23054199..>23054337))
FT                   /gene="Prkag3"
FT                   /locus_tag="mCG_133883"
FT                   /product="protein kinase, AMP-activated, gamma 3
FT                   non-catatlytic subunit, transcript variant mCT189297"
FT                   /note="gene_id=mCG133883.1 transcript_id=mCT189297.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23046100..23046216,23046547..23046693,
FT                   23046862..23046899,23049837..23050002,23050102..23050228,
FT                   23050698..23050752,23050932..23050977,23051078..23051136,
FT                   23051251..23051332,23052533..23052939,23053253..23053405,
FT                   23053853..23053892,23054199..>23054249))
FT                   /codon_start=1
FT                   /gene="Prkag3"
FT                   /locus_tag="mCG_133883"
FT                   /product="protein kinase, AMP-activated, gamma 3
FT                   non-catatlytic subunit, isoform CRA_a"
FT                   /note="gene_id=mCG133883.1 transcript_id=mCT189297.0
FT                   protein_id=mCP110285.0 isoform=CRA_a"
FT                   /protein_id="EDL00349.1"
FT                   /translation="RTRAGRMEPELEHTLPGTLTWSHSGGPESQEMDFLEQGENSWPSP
FT                   AVATSSERTCAIRGVKASRWTRQEAVEEAEPPGLGEGAQSRPAAESTRQEATFPKATPL
FT                   AQAVPLAEAETSPTGWDLLLPDCAASAGGSSTGDLELTIEFPAPEAWDCELEGLGKDRP
FT                   RPGPSPQAPLLGLSWDDELQKPGAQVYMHFMQEHTCYDAMATSSKLVIFDTTLEIKKAF
FT                   FAMVANGVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEIEEHKIETWREI
FT                   YLQGCFKPLVSISPNDSLFEAVYALIKNRIHRLPVLDPVSGTVLYILTHKRLLKFLHIF
FT                   GALLPRPSFLCRTIQDLGIGTFRDLAVVLETAPVLTALDIFVDRRVSALPVVNESGQVV
FT                   GLYSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGVLSCQPHESLGEVIDRIAREQV
FT                   HRLVLVDETQHLLGVVSLSDILQALVLSPAGIDALSA"
FT   CDS             complement(join(23046100..23046216,23046547..23046693,
FT                   23046862..23046899,23049837..23050002,23050102..23050228,
FT                   23050698..23050764,23050932..23050977,23051078..23051136,
FT                   23051251..23051332,23052533..23052939,23053253..23053405,
FT                   23053853..23053892,23054199..23054231))
FT                   /codon_start=1
FT                   /gene="Prkag3"
FT                   /locus_tag="mCG_133883"
FT                   /product="protein kinase, AMP-activated, gamma 3
FT                   non-catatlytic subunit, isoform CRA_b"
FT                   /note="gene_id=mCG133883.1 transcript_id=mCT135255.1
FT                   protein_id=mCP74612.1 isoform=CRA_b"
FT                   /protein_id="EDL00350.1"
FT                   /translation="MEPELEHTLPGTLTWSHSGGPESQEMDFLEQGENSWPSPAVATSS
FT                   ERTCAIRGVKASRWTRQEAVEEAEPPGLGEGAQSRPAAESTRQEATFPKATPLAQAVPL
FT                   AEAETSPTGWDLLLPDCAASAGGSSTGDLELTIEFPAPEAWDCELEGLGKDRPRPGPSP
FT                   QAPLLGLSWDDELQKPGAQVYMHFMQEHTCYDAMATSSKLVIFDTTLEIKKAFFAMVAN
FT                   GVRAAPLWDSKKQSFVGMLTITDFILVLHRYYRSPLVQIYEIEEHKIETWRGFSAEIYL
FT                   QGCFKPLVSISPNDSLFEAVYALIKNRIHRLPVLDPVSGTVLYILTHKRLLKFLHIFGA
FT                   LLPRPSFLCRTIQDLGIGTFRDLAVVLETAPVLTALDIFVDRRVSALPVVNESGQVVGL
FT                   YSRFDVIHLAAQQTYNHLDMSVGEALRQRTLCLEGVLSCQPHESLGEVIDRIAREQVHR
FT                   LVLVDETQHLLGVVSLSDILQALVLSPAGIDALSA"
FT   gap             23062298..23062524
FT                   /estimated_length=227
FT   gap             23077248..23077314
FT                   /estimated_length=67
FT   gene            23077355..23090761
FT                   /gene="Wnt6"
FT                   /locus_tag="mCG_133871"
FT                   /note="gene_id=mCG133871.1"
FT   mRNA            join(23077355..23077686,23087549..23087769,
FT                   23088007..23088341,23089586..23090761)
FT                   /gene="Wnt6"
FT                   /locus_tag="mCG_133871"
FT                   /product="wingless-related MMTV integration site 6"
FT                   /note="gene_id=mCG133871.1 transcript_id=mCT135243.1
FT                   created on 24-JUL-2002"
FT   CDS             join(23077610..23077686,23087549..23087769,
FT                   23088007..23088341,23089586..23090047)
FT                   /codon_start=1
FT                   /gene="Wnt6"
FT                   /locus_tag="mCG_133871"
FT                   /product="wingless-related MMTV integration site 6"
FT                   /note="gene_id=mCG133871.1 transcript_id=mCT135243.1
FT                   protein_id=mCP74534.0"
FT                   /db_xref="GOA:P22727"
FT                   /db_xref="InterPro:IPR005817"
FT                   /db_xref="InterPro:IPR009143"
FT                   /db_xref="InterPro:IPR018161"
FT                   /db_xref="MGI:MGI:98960"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22727"
FT                   /protein_id="EDL00351.1"
FT                   /translation="MLPPVPSRLGLLLLLLCPAHVDGLWWAVGSPLVMDPTSICRKARR
FT                   LAGRQAELCQAEPEVVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRVLQQDIRET
FT                   AFVFAITAAGASHAVTQACSMGELLQCGCQAPRGRAPPRPSGLLGTPGPPGPTGSPDAS
FT                   AAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECK
FT                   CHGLSGSCALRTCWQKLPPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRA
FT                   DLLYAADSPDFCAPNRRTGSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCL
FT                   CRFHWCCVVQCHRCRVRKELSLCL"
FT   gene            23096961..23109660
FT                   /gene="Wnt10a"
FT                   /locus_tag="mCG_133865"
FT                   /note="gene_id=mCG133865.1"
FT   mRNA            join(23096961..23097732,23098816..23099078,
FT                   23106020..23106399,23108610..23109660)
FT                   /gene="Wnt10a"
FT                   /locus_tag="mCG_133865"
FT                   /product="wingless related MMTV integration site 10a"
FT                   /note="gene_id=mCG133865.1 transcript_id=mCT135237.0
FT                   created on 24-JUL-2002"
FT   CDS             join(23097620..23097732,23098816..23099078,
FT                   23106020..23106399,23108610..23109107)
FT                   /codon_start=1
FT                   /gene="Wnt10a"
FT                   /locus_tag="mCG_133865"
FT                   /product="wingless related MMTV integration site 10a"
FT                   /note="gene_id=mCG133865.1 transcript_id=mCT135237.0
FT                   protein_id=mCP74755.1"
FT                   /protein_id="EDL00352.1"
FT                   /translation="MGSAHPRPWLRLPQGPQPRPEFWALLFFLLLLAAAVPRSAPNDIL
FT                   GLRLPPEPVLNANTVCLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQR
FT                   WNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASR
FT                   RGDEEAFRRKLHRLQLDALQRGKGLSHGVPEHPAILPASPGLQDSWEWGGCSPDVGFGE
FT                   RFSKDFLDSREPHRDIHARMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTP
FT                   EFRTVGALLRNRFHRATLIRPHNRNGGQLEPGPAGAPSPAPGTPGLRRRASHSDLVYFE
FT                   KSPDFCEREPRLDSAGTVGRLCNKSSTGPDGCGSMCCGRGHNILRQTRSERCHCRFHWC
FT                   CFVVCEECRITEWVSVCK"
FT   gap             23100961..23101370
FT                   /estimated_length=410
FT   gene            <23160559..23162030
FT                   /gene="Cdk5r2"
FT                   /locus_tag="mCG_133869"
FT                   /note="gene_id=mCG133869.1"
FT   mRNA            <23160559..23162030
FT                   /gene="Cdk5r2"
FT                   /locus_tag="mCG_133869"
FT                   /product="cyclin-dependent kinase 5, regulatory subunit 2
FT                   (p39)"
FT                   /note="gene_id=mCG133869.1 transcript_id=mCT135241.1
FT                   created on 24-JUL-2002"
FT   CDS             23160559..23161668
FT                   /codon_start=1
FT                   /gene="Cdk5r2"
FT                   /locus_tag="mCG_133869"
FT                   /product="cyclin-dependent kinase 5, regulatory subunit 2
FT                   (p39)"
FT                   /note="gene_id=mCG133869.1 transcript_id=mCT135241.1
FT                   protein_id=mCP74801.0"
FT                   /db_xref="GOA:O35926"
FT                   /db_xref="InterPro:IPR004944"
FT                   /db_xref="InterPro:IPR013763"
FT                   /db_xref="MGI:MGI:1330828"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35926"
FT                   /protein_id="EDL00353.1"
FT                   /translation="MGTVLSLSPASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPAG
FT                   KGGKGESRLKRPSVLISALTWKRLVAASAKKKKGSKKVTPKPASTGPDPLVQQRNRENL
FT                   LRKGRDGPDGGGTAKPLAVPVPTVPTTAATCEPPSGGSAAAPPPGSGGGKPPPPPPPAP
FT                   QAAPPAPGGSPRRVIVQASTGELLRCLGDFVCRRCYRLKELSPGELVGWFRGVDRSLLL
FT                   QGWQDQAFITPANLVFVYLLCRESLRGDELASAAELQAAFLTCLYLAYSYMGNEISYPL
FT                   KPFLVEPDKERFWQRCLRLIQRLSPQMLRLNADPHFFTQVFQDLKNEGEAAASTGGPPS
FT                   GSSASTTSSSSARDSCATGAKHWTMNLDR"
FT   gene            complement(23186959..23190858)
FT                   /gene="Fev"
FT                   /locus_tag="mCG_133881"
FT                   /note="gene_id=mCG133881.1"
FT   mRNA            complement(join(23186959..23188112,23189843..23189917,
FT                   23190596..23190858))
FT                   /gene="Fev"
FT                   /locus_tag="mCG_133881"
FT                   /product="FEV (ETS oncogene family)"
FT                   /note="gene_id=mCG133881.1 transcript_id=mCT135253.1
FT                   created on 21-NOV-2002"
FT   CDS             complement(join(23187526..23188112,23189843..23189917,
FT                   23190596..23190647))
FT                   /codon_start=1
FT                   /gene="Fev"
FT                   /locus_tag="mCG_133881"
FT                   /product="FEV (ETS oncogene family)"
FT                   /note="gene_id=mCG133881.1 transcript_id=mCT135253.1
FT                   protein_id=mCP74599.1"
FT                   /db_xref="GOA:Q8QZW2"
FT                   /db_xref="InterPro:IPR000418"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="MGI:MGI:2449712"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8QZW2"
FT                   /protein_id="EDL00354.1"
FT                   /translation="MRQSGTSQPLLINMYLPDPVGDGLFKEGKSPSWGPLSPAVQKGSG
FT                   QIQLWQFLLELLADRANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRA
FT                   LRYYYDKNIMSKVHGKRYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKL
FT                   PAGLAPLPFPGLSKLNLMAASAGVAPAGFSYWPGPNATAAAAATAALYPTPGLQPPPGP
FT                   FGAVAAASHLGGHYH"
FT   gene            complement(23195363..>23198648)
FT                   /gene="Cryba2"
FT                   /locus_tag="mCG_133863"
FT                   /note="gene_id=mCG133863.1"
FT   mRNA            complement(join(23195363..23195566,23195961..23196103,
FT                   23197373..23197514,23198154..23198318,23198504..>23198648))
FT                   /gene="Cryba2"
FT                   /locus_tag="mCG_133863"
FT                   /product="crystallin, beta A2"
FT                   /note="gene_id=mCG133863.1 transcript_id=mCT135235.1
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(23195419..23195566,23195961..23196103,
FT                   23197373..23197514,23198154..23198318,23198504..>23198562))
FT                   /codon_start=1
FT                   /gene="Cryba2"
FT                   /locus_tag="mCG_133863"
FT                   /product="crystallin, beta A2"
FT                   /note="gene_id=mCG133863.1 transcript_id=mCT135235.1
FT                   protein_id=mCP74734.0"
FT                   /protein_id="EDL00355.1"
FT                   /translation="EHQARAQPLHFPSVRCSLTRDMSSAPAPGSAPVCLTLWDEEDFQG
FT                   RRCRLLSDCANVCERGALRRVRSVKVENGAWVAFEYPDFQGQQFILEKGDYPCWSAWSG
FT                   SSGHHSNQLLSFRPVLCANHSDSRVTLFEGENFQGCKFELSDDYPSLPSMGWTSKDVGS
FT                   LKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFRTYSDFGTQAHTGQLQSIRRVQH"
FT   gene            complement(23207484..>23208858)
FT                   /locus_tag="mCG_133877"
FT                   /note="gene_id=mCG133877.1"
FT   mRNA            complement(join(23207484..23207655,23207751..23207888,
FT                   23208509..>23208858))
FT                   /locus_tag="mCG_133877"
FT                   /product="mCG133877"
FT                   /note="gene_id=mCG133877.1 transcript_id=mCT135249.0
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(23207547..23207655,23207751..23207888,
FT                   23208509..>23208858))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133877"
FT                   /product="mCG133877"
FT                   /note="gene_id=mCG133877.1 transcript_id=mCT135249.0
FT                   protein_id=mCP74832.0"
FT                   /protein_id="EDL00356.1"
FT                   /translation="LAQKSSLYLVPILSLPPSYEGRKSKEQEEDLFGKMPGGQEDDEEE
FT                   EEDEEEAEEEEEEIEEEMSKDEEDIDKDAKMTWSGIKVTETSQHSLQWQWQQDLKTIIK
FT                   EETESDEKEAIGRLPAFANLQEAILENMIQNILVEASRGEVVLTSRPRIIALPPVSMHR
FT                   TDNLLQMSQGDVLCSGMQHPDCLLVSASSPSNMTT"
FT   gene            complement(23227642..>23240933)
FT                   /locus_tag="mCG_144889"
FT                   /note="gene_id=mCG144889.0"
FT   mRNA            complement(join(23227642..23227799,23228267..23230516,
FT                   23230722..23230922,23231780..23232045,23232363..23232585,
FT                   23232946..23233091,23233354..23233553,23233683..23233849,
FT                   23234604..23234706,23238414..23238582,23240859..>23240933))
FT                   /locus_tag="mCG_144889"
FT                   /product="mCG144889, transcript variant mCT184313"
FT                   /note="gene_id=mCG144889.0 transcript_id=mCT184313.0
FT                   created on 05-JUN-2003"
FT   mRNA            complement(join(23228730..23230922,23231780..23232045,
FT                   23232363..23232585,23232946..23233091,23233354..23233553,
FT                   23233683..23233849,23238414..23238582,23240859..23240932))
FT                   /locus_tag="mCG_144889"
FT                   /product="mCG144889, transcript variant mCT189314"
FT                   /note="gene_id=mCG144889.0 transcript_id=mCT189314.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23230049..23230516,23230722..23230922,
FT                   23231780..23232045,23232363..23232585,23232946..23233091,
FT                   23233354..23233553,23233683..23233849,23234604..23234706,
FT                   23238414..>23238451))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144889"
FT                   /product="mCG144889, isoform CRA_a"
FT                   /note="gene_id=mCG144889.0 transcript_id=mCT184313.0
FT                   protein_id=mCP106118.0 isoform=CRA_a"
FT                   /protein_id="EDL00357.1"
FT                   /translation="VPAHWEVAVSPPRPPKTKFFFTIIPQPIFLSPGITLTLPIVFRPL
FT                   EAKEYTDQLWFEKEEGVFCVTLKATLPCYKLDCPSSLQLPMCALGDTVETWFCLNNVGD
FT                   LPTFFTWEVPAPFQILPTTGLLEPGLGCKIKVTFEPLIAVIHEVEALCWYGKGNKQKNS
FT                   INIQAAAKCAQLLVSIKHKGLEDQDQEGFQKVVHFGYVSVGSVAERQIRLYNPSAVNAP
FT                   FKIEMAEHVLTKDPSFSCSTSQGIVPPGEKKCLSLFFHPKTLDSRAIDYFSIIPSGCAT
FT                   KTLLQVVGFCRGPDAVLQHSCVNFHWVKLGERREQTLWIENQSDCQAHFQFDIDCQESV
FT                   FSIRPAFGTLAGKTRMTLHCAYQPTHPIISFRRVACLIHHQDPLFLDLIGTCHSDSIKP
FT                   AILTPQHLTWYRTHLARGLTLYPPDILAAMLKEKKLERDEDGALILPIESLPMQELEDL
FT                   PDQKYPNIPPMTEYFFDGTRDLAIFPPAVCLEPIDVDFGACPGPEAPNPVPLCLRNYTK
FT                   GKITVVWTGRSDCPFWVTPVTSDVPPLKSIALRLYFQPSSPNCLYAVELEAFAVYKVCA
FT                   YRLKQLWKLSLSLEPEGQSLATRMTRG"
FT   CDS             complement(join(23230635..23230922,23231780..23232045,
FT                   23232363..23232585,23232946..23233091,23233354..23233553,
FT                   23233683..23233849,23238414..23238542))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144889"
FT                   /product="mCG144889, isoform CRA_b"
FT                   /note="gene_id=mCG144889.0 transcript_id=mCT189314.0
FT                   protein_id=mCP110307.0 isoform=CRA_b"
FT                   /db_xref="GOA:Q8CAK2"
FT                   /db_xref="MGI:MGI:2444274"
FT                   /db_xref="UniProtKB/TrEMBL:Q8CAK2"
FT                   /protein_id="EDL00358.1"
FT                   /translation="MLIQKNQCHITRTRENCDCTMNTVNEDLCLSASTLGSSSVTTQKE
FT                   YTDQLWFEKEEGVFCVTLKATLPCYKLDCPSSLQLPMCALGDTVETWFCLNNVGDLPTF
FT                   FTWEVPAPFQILPTTGLLEPGLGCKIKVTFEPLIAVIHEVEALCWYGKGNKQKNSINIQ
FT                   AAAKCAQLLVSIKHKGLEDQDQEGFQKVVHFGYVSVGSVAERQIRLYNPSAVNAPFKIE
FT                   MAEHVLTKDPSFSCSTSQGIVPPGEKKCLSLFFHPKTLDSRAIDYFSIIPSGCATKTLL
FT                   QVVGFCRGPDAVLQHSCVNFHWVKLGERREQTLWIENQSDCQAHFQFDIDCQESVFSIR
FT                   PAFGTLAGKTRMTLHCAYQPTHPIISFRRVACLIHHQDPLFLDLIGTCHSDSIKPAILT
FT                   PQHLTWYRTHLARGLTLYPPDILAAMLKEKKLERDEDGALILPIEVCEMPDIPAPHRRA
FT                   DLSRIPDPPLQVTE"
FT   gene            complement(23250377..23256868)
FT                   /gene="Ihh"
FT                   /locus_tag="mCG_133872"
FT                   /note="gene_id=mCG133872.1"
FT   mRNA            complement(join(23250377..23252095,23253661..23253922,
FT                   23256257..23256868))
FT                   /gene="Ihh"
FT                   /locus_tag="mCG_133872"
FT                   /product="Indian hedgehog"
FT                   /note="gene_id=mCG133872.1 transcript_id=mCT135244.1
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(23251437..23252095,23253661..23253922,
FT                   23256257..23256685))
FT                   /codon_start=1
FT                   /gene="Ihh"
FT                   /locus_tag="mCG_133872"
FT                   /product="Indian hedgehog"
FT                   /note="gene_id=mCG133872.1 transcript_id=mCT135244.1
FT                   protein_id=mCP74538.1"
FT                   /db_xref="GOA:Q80XI9"
FT                   /db_xref="InterPro:IPR000320"
FT                   /db_xref="InterPro:IPR001657"
FT                   /db_xref="InterPro:IPR001767"
FT                   /db_xref="InterPro:IPR003586"
FT                   /db_xref="InterPro:IPR003587"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="MGI:MGI:96533"
FT                   /db_xref="UniProtKB/TrEMBL:Q80XI9"
FT                   /protein_id="EDL00359.1"
FT                   /translation="MESPRATQTPESPKLSQPRAHLSAHQAPSPAALPGYPAMSPAWLR
FT                   PRLRFCLFLLLLLLVPAARGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGR
FT                   YEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMNQWPGV
FT                   KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKA
FT                   HVHCSVKSEHSAAAKTGGCFPAGAQVRLENGERVALSAVKPGDRVLAMGEDGTPTFSDV
FT                   LIFLDREPNRLRAFQVIETQDPPRRLALTPAHLLFIADNHTEPAAHFRATFASHVQPGQ
FT                   YVLVSGVPGLQPARVAAVSTHVALGSYAPLTRHGTLVVEDVVASCFAAVADHHLAQLAF
FT                   WPLRLFPSLAWGSWTPSEGVHWYPQMLYRLGRLLLEESTFHPLGMSGAGS"
FT   gene            complement(23272515..23366196)
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /note="gene_id=mCG133884.1"
FT   mRNA            complement(join(23272515..23273142,23273543..23273649,
FT                   23274170..23274287,23350554..23350612,23351746..23351884,
FT                   23360788..23361000,23361550..23361804,23366110..23366196))
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /product="nonhomologous end-joining factor 1, transcript
FT                   variant mCT173372"
FT                   /note="gene_id=mCG133884.1 transcript_id=mCT173372.0
FT                   created on 17-SEP-2002"
FT   mRNA            complement(join(23272515..23273142,23273543..23273649,
FT                   23274170..23274287,23350554..23350612,23351746..23351884,
FT                   23360788..23361000,23361550..23361726,23362207..23362300,
FT                   23366110..23366196))
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /product="nonhomologous end-joining factor 1, transcript
FT                   variant mCT173373"
FT                   /note="gene_id=mCG133884.1 transcript_id=mCT173373.0
FT                   created on 17-SEP-2002"
FT   mRNA            complement(join(23272515..23273142,23273543..23273649,
FT                   23274170..23274287,23350554..23350612,23351746..23351884,
FT                   23360788..23361000,23361550..23361804,23362207..23362300,
FT                   23366110..23366196))
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /product="nonhomologous end-joining factor 1, transcript
FT                   variant mCT135256"
FT                   /note="gene_id=mCG133884.1 transcript_id=mCT135256.1
FT                   created on 17-SEP-2002"
FT   mRNA            complement(join(23272730..23273142,23273543..23273649,
FT                   23274170..23274287,23360788..23361000,23361550..23361726,
FT                   23362207..23362300,23366110..>23366178))
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /product="nonhomologous end-joining factor 1, transcript
FT                   variant mCT189298"
FT                   /note="gene_id=mCG133884.1 transcript_id=mCT189298.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23273068..23273142,23273543..23273649,
FT                   23274170..23274287,23360788..23361000,23361550..23361726,
FT                   23362207..>23362257))
FT                   /codon_start=1
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /product="nonhomologous end-joining factor 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG133884.1 transcript_id=mCT189298.0
FT                   protein_id=mCP110286.0 isoform=CRA_c"
FT                   /protein_id="EDL00362.1"
FT                   /translation="TFCLHQVLGLEACNTLMMEELEQDLLLQPWAWLQLAENSLLAKVS
FT                   ITKHGYALLISDLQQVWHEQVDTSVVSQRAKELNKRLTAPPAALLCHLDEALRPLFKDS
FT                   AHPSKATFSCDRGEEGLILRVQSELSGLPFSWHFHCIPASSSLKLPEVCAVGDGKPFAM
FT                   SLQSLYVAVTKQQIQARQAHKDSGETQASSSTSPRGTDNQPEEPVSLPSTLSEPEYEPV
FT                   AASGPMHRARLVKSKRKKPRGLFS"
FT   CDS             complement(join(23273068..23273142,23273543..23273649,
FT                   23274170..23274287,23350554..23350612,23351746..23351884,
FT                   23360788..23361000,23361550..23361726,23362207..23362209))
FT                   /codon_start=1
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /product="nonhomologous end-joining factor 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG133884.1 transcript_id=mCT173373.0
FT                   protein_id=mCP96291.0 isoform=CRA_b"
FT                   /protein_id="EDL00361.1"
FT                   /translation="MMEELEQDLLLQPWAWLQLAENSLLAKVSITKHGYALLISDLQQV
FT                   WHEQVDTSVVSQRAKELNKRLTAPPAALLCHLDEALRPLFKDSAHPSKATFSCDRGEEG
FT                   LILRVQSELSGLPFSWHFHCIPASSSLVSQHLIHPLMGVSLALQSHVRELAALLRMKDL
FT                   EIQAYQESGAVLSRSRLKTEPFEENSFLEQFMAEKLPEVCAVGDGKPFAMSLQSLYVAV
FT                   TKQQIQARQAHKDSGETQASSSTSPRGTDNQPEEPVSLPSTLSEPEYEPVAASGPMHRA
FT                   RLVKSKRKKPRGLFS"
FT   CDS             complement(join(23273068..23273142,23273543..23273649,
FT                   23274170..23274287,23350554..23350612,23351746..23351884,
FT                   23360788..23361000,23361550..23361726))
FT                   /codon_start=1
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /product="nonhomologous end-joining factor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG133884.1 transcript_id=mCT135256.1
FT                   protein_id=mCP74623.1 isoform=CRA_a"
FT                   /protein_id="EDL00360.1"
FT                   /translation="MEELEQDLLLQPWAWLQLAENSLLAKVSITKHGYALLISDLQQVW
FT                   HEQVDTSVVSQRAKELNKRLTAPPAALLCHLDEALRPLFKDSAHPSKATFSCDRGEEGL
FT                   ILRVQSELSGLPFSWHFHCIPASSSLVSQHLIHPLMGVSLALQSHVRELAALLRMKDLE
FT                   IQAYQESGAVLSRSRLKTEPFEENSFLEQFMAEKLPEVCAVGDGKPFAMSLQSLYVAVT
FT                   KQQIQARQAHKDSGETQASSSTSPRGTDNQPEEPVSLPSTLSEPEYEPVAASGPMHRAR
FT                   LVKSKRKKPRGLFS"
FT   CDS             complement(join(23273068..23273142,23273543..23273649,
FT                   23274170..23274287,23350554..23350612,23351746..23351884,
FT                   23360788..23361000,23361550..23361726))
FT                   /codon_start=1
FT                   /gene="Nhej1"
FT                   /locus_tag="mCG_133884"
FT                   /product="nonhomologous end-joining factor 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG133884.1 transcript_id=mCT173372.0
FT                   protein_id=mCP96292.0 isoform=CRA_a"
FT                   /protein_id="EDL00363.1"
FT                   /translation="MEELEQDLLLQPWAWLQLAENSLLAKVSITKHGYALLISDLQQVW
FT                   HEQVDTSVVSQRAKELNKRLTAPPAALLCHLDEALRPLFKDSAHPSKATFSCDRGEEGL
FT                   ILRVQSELSGLPFSWHFHCIPASSSLVSQHLIHPLMGVSLALQSHVRELAALLRMKDLE
FT                   IQAYQESGAVLSRSRLKTEPFEENSFLEQFMAEKLPEVCAVGDGKPFAMSLQSLYVAVT
FT                   KQQIQARQAHKDSGETQASSSTSPRGTDNQPEEPVSLPSTLSEPEYEPVAASGPMHRAR
FT                   LVKSKRKKPRGLFS"
FT   gap             23281596..23281615
FT                   /estimated_length=20
FT   gap             23322701..23323996
FT                   /estimated_length=1296
FT   gap             23341371..23341390
FT                   /estimated_length=20
FT   gap             23343672..23343742
FT                   /estimated_length=71
FT   gap             23361273..23361292
FT                   /estimated_length=20
FT   gene            complement(23366517..>23375236)
FT                   /gene="Slc23a3"
FT                   /locus_tag="mCG_133892"
FT                   /note="gene_id=mCG133892.1"
FT   mRNA            complement(join(23366517..23366992,23367316..23367411,
FT                   23369820..23369987,23370251..23370356,23370745..23370998,
FT                   23373007..23373121,23373498..23373618,23373945..23374126,
FT                   23374297..23374373,23374541..23374638,23374747..23374904,
FT                   23375031..>23375236))
FT                   /gene="Slc23a3"
FT                   /locus_tag="mCG_133892"
FT                   /product="solute carrier family 23 (nucleobase
FT                   transporters), member 3"
FT                   /note="gene_id=mCG133892.1 transcript_id=mCT135264.1
FT                   created on 19-MAR-2003"
FT   CDS             complement(join(23366703..23366992,23367316..23367411,
FT                   23369820..23369987,23370251..23370356,23370745..23370998,
FT                   23373007..23373121,23373498..23373618,23373945..23374126,
FT                   23374297..23374373,23374541..23374638,23374747..23374904,
FT                   23375031..>23375234))
FT                   /codon_start=1
FT                   /gene="Slc23a3"
FT                   /locus_tag="mCG_133892"
FT                   /product="solute carrier family 23 (nucleobase
FT                   transporters), member 3"
FT                   /note="gene_id=mCG133892.1 transcript_id=mCT135264.1
FT                   protein_id=mCP74661.1"
FT                   /protein_id="EDL00364.1"
FT                   /translation="GAAKTQSSQGSMSRSPLHPIPLLSEGYQDTPAPLPPLLPPLQNPS
FT                   SRSWASRVCGPSTWGLSCLLALQHFLVLASLLWASHLLLLHGLPPGGLSYPPAQLLASS
FT                   FFSCGLSTVLQTWMGSRLPLIQAPSLEFLIPALVLTNQKLPLTTKTPGNASLSLPLCSL
FT                   TRSCHGLELWNTSLREVSGAVVVSGLLQGTIGLLGVPGRVFPYCGPLVLAPSLVVAGLS
FT                   AHKEVAQFCSAHWGLALLLILLMVVCSQHLGSCQIPLCSWRPSSTSTHICIPVFRLLSV
FT                   LAPVACVWFISAFVGTSVIPLQLSEPSDAPWFWLPHPGEWEWPLLTPRALAAGISMALA
FT                   ASTSSLGCYALCGQLLRLSPPPPHACSRGLSLEGLGSVLAGLLGSPLGTASSFPNVGTV
FT                   SLFQTGSRRVAHLVGLFCMGLGLSPRLAQLFTSIPLPVLGGVLGVTQAVVLSAGFSSFH
FT                   LADIDSGRNVFIVGFSIFMALLLPRWLREAPVLLNTGWSPLDMFLRSLLAEPIFLAGLL
FT                   GFLLENTISGTRAERGLGQRLPTSFTAQEIQMLQQSRRKAAQEYGLPLPIRNLCSCIPQ
FT                   PLHCLCPMPEDSGDEGGSSKTGERADLLPNSGESYSTASREGVRSQ"
FT   gap             23368660..23369070
FT                   /estimated_length=411
FT   gene            complement(23376561..23384004)
FT                   /gene="1810031K17Rik"
FT                   /locus_tag="mCG_142643"
FT                   /note="gene_id=mCG142643.0"
FT   mRNA            complement(join(23376561..23378278,23378672..23378789,
FT                   23379101..23379162,23380694..23380822,23380906..23381026,
FT                   23381168..23381249,23382246..23382354,23382764..23382851,
FT                   23383408..23384004))
FT                   /gene="1810031K17Rik"
FT                   /locus_tag="mCG_142643"
FT                   /product="RIKEN cDNA 1810031K17"
FT                   /note="gene_id=mCG142643.0 transcript_id=mCT181340.0
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(23377745..23378278,23378672..23378789,
FT                   23379101..23379162,23380694..23380822,23380906..23381026,
FT                   23381168..23381249,23382246..23382354,23382764..23382832))
FT                   /codon_start=1
FT                   /gene="1810031K17Rik"
FT                   /locus_tag="mCG_142643"
FT                   /product="RIKEN cDNA 1810031K17"
FT                   /note="gene_id=mCG142643.0 transcript_id=mCT181340.0
FT                   protein_id=mCP104262.0"
FT                   /protein_id="EDL00365.1"
FT                   /translation="MDLTGLLLDEEGAFSLTGFQDFMVLPGHQKLSARIRRRLYYGWDL
FT                   ETDCSLEELSSPVADITVELLQKAAPSPIRRLQKKYVAHVSREACISPCAMMLALVYIE
FT                   RLRHRNPDYLQHVSSSDLFLISMMVASKYLYDEGEEEEVFNDEWGAAGGVAVATLNALE
FT                   RSFLSAMDWRLYTDPREIFEVLSWLESCVAEQQGRRRGWYTYTDLCVLLEQPTWQLALG
FT                   SLCQRLVKLSCLLAVAYVSSVALAVASVAVIHQSLGLSSSPSPGPPELTLVSKSLVQPC
FT                   VPAPVSQCLTNVSSCLEGSVDLPSLWGSLLAPLTPPLRPPPDPPAPPTPLHKCPLCQKF
FT                   QRLPPNCRACHTNQTVSIGPSRPLYHARGLAPPWLWSPVAPPFLQPQQCSLFSVMELAH
FT                   LKSVISPG"
FT   gene            23383400..23389255
FT                   /gene="BC038286"
FT                   /locus_tag="mCG_133889"
FT                   /note="gene_id=mCG133889.1"
FT   mRNA            join(23383400..23384478,23384719..23384825,
FT                   23385273..23385303,23385654..23385789,23385972..23386056,
FT                   23386310..23386453,23386609..23386703,23387030..23387165,
FT                   23387780..23389255)
FT                   /gene="BC038286"
FT                   /locus_tag="mCG_133889"
FT                   /product="cDNA sequence BC038286, transcript variant
FT                   mCT135261"
FT                   /note="gene_id=mCG133889.1 transcript_id=mCT135261.1
FT                   created on 18-MAR-2003"
FT   mRNA            join(23384135..23384478,23384719..23384825,
FT                   23385273..23385303,23385742..23385789,23385972..23386056,
FT                   23386310..23386453,23386609..23386703,23387030..23387170)
FT                   /gene="BC038286"
FT                   /locus_tag="mCG_133889"
FT                   /product="cDNA sequence BC038286, transcript variant
FT                   mCT181344"
FT                   /note="gene_id=mCG133889.1 transcript_id=mCT181344.0
FT                   created on 18-MAR-2003"
FT   mRNA            join(23384185..23384478,23384719..23384825,
FT                   23385273..23385303,23385654..23385789,23385972..23386056,
FT                   23386310..23386453,23386609..23386703,23387030..23387165,
FT                   23387780..23388069,23388181..23388944)
FT                   /gene="BC038286"
FT                   /locus_tag="mCG_133889"
FT                   /product="cDNA sequence BC038286, transcript variant
FT                   mCT181343"
FT                   /note="gene_id=mCG133889.1 transcript_id=mCT181343.0
FT                   created on 18-MAR-2003"
FT   CDS             join(23384213..23384478,23384719..23384825,
FT                   23385273..23385303,23385654..23385789,23385972..23386056,
FT                   23386310..23386453,23386609..23386703,23387030..23387165,
FT                   23387780..23388405)
FT                   /codon_start=1
FT                   /gene="BC038286"
FT                   /locus_tag="mCG_133889"
FT                   /product="cDNA sequence BC038286, isoform CRA_c"
FT                   /note="gene_id=mCG133889.1 transcript_id=mCT135261.1
FT                   protein_id=mCP74628.1 isoform=CRA_c"
FT                   /protein_id="EDL00368.1"
FT                   /translation="MASSGGGNTGAGGTSGLGLGLGLSLGMGEATGDAEEEAAAAEAVG
FT                   RLATSLWLRLRGWEAVLAAAQRLLVWEKPLHSLVTAATLNGLFWLLSSSSLRPFFLLSI
FT                   SLLTYFLLDLWHPRFLPDVSAPPPEEPHSDSEGAGSGAQPHLLSVPELCRYLAESWLTF
FT                   QIHLQELLQYKRQNPAQFCARGCAACAVLAVLGHYVPGVMISYIVLLSILLWPLVVYHE
FT                   LIQRMYTRLEPLLMQLDYSMKAEADALHHKHDKRKRQGKSAPPAGDEPLAETESESEAE
FT                   LAGFSPVVDVKKTALALAITDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSL
FT                   PSEPEEALNRELGEGEETELASPEDLLSAPPALSKQALDTEEEGAADKEALLQLSSPLH
FT                   FVNTHFNGAGSPQDGVKCPPGAPVKTLSPEAVSGDLMAPSSTLSPQLCLAESGPVTPLS
FT                   PSVLPSLPQDSPQPLAAPEEEEALTTEDFELLDQGELEQLNAELGLGPEMPPKPPDVLP
FT                   PPPLGADSHSLVQSDQEAHAEVEP"
FT   CDS             join(23384213..23384478,23384719..23384825,
FT                   23385273..23385303,23385654..23385789,23385972..23386056,
FT                   23386310..23386453,23386609..23386703,23387030..23387165,
FT                   23387780..23388069,23388181..23388405)
FT                   /codon_start=1
FT                   /gene="BC038286"
FT                   /locus_tag="mCG_133889"
FT                   /product="cDNA sequence BC038286, isoform CRA_a"
FT                   /note="gene_id=mCG133889.1 transcript_id=mCT181343.0
FT                   protein_id=mCP104265.0 isoform=CRA_a"
FT                   /protein_id="EDL00366.1"
FT                   /translation="MASSGGGNTGAGGTSGLGLGLGLSLGMGEATGDAEEEAAAAEAVG
FT                   RLATSLWLRLRGWEAVLAAAQRLLVWEKPLHSLVTAATLNGLFWLLSSSSLRPFFLLSI
FT                   SLLTYFLLDLWHPRFLPDVSAPPPEEPHSDSEGAGSGAQPHLLSVPELCRYLAESWLTF
FT                   QIHLQELLQYKRQNPAQFCARGCAACAVLAVLGHYVPGVMISYIVLLSILLWPLVVYHE
FT                   LIQRMYTRLEPLLMQLDYSMKAEADALHHKHDKRKRQGKSAPPAGDEPLAETESESEAE
FT                   LAGFSPVVDVKKTALALAITDSELSDEEASILESGGFSVSRATTPQLTDVSEDLDQQSL
FT                   PSEPEEALNRELGEGEETELASPEDLLSAPPALSKQALDTEEEGAADKEALLQLSSPLH
FT                   FVNTHFNGAGSPQDGVKCPPGAPVKTLSPEADSPQPLAAPEEEEALTTEDFELLDQGEL
FT                   EQLNAELGLGPEMPPKPPDVLPPPPLGADSHSLVQSDQEAHAEVEP"
FT   CDS             join(23384213..23384478,23384719..23384825,
FT                   23385273..23385303,23385742..23385789,23385972..23386041)
FT                   /codon_start=1
FT                   /gene="BC038286"
FT                   /locus_tag="mCG_133889"
FT                   /product="cDNA sequence BC038286, isoform CRA_b"
FT                   /note="gene_id=mCG133889.1 transcript_id=mCT181344.0
FT                   protein_id=mCP104266.0 isoform=CRA_b"
FT                   /protein_id="EDL00367.1"
FT                   /translation="MASSGGGNTGAGGTSGLGLGLGLSLGMGEATGDAEEEAAAAEAVG
FT                   RLATSLWLRLRGWEAVLAAAQRLLVWEKPLHSLVTAATLNGLFWLLSSSSLRPFFLLSI
FT                   SLLTYFLLDLWHPRFLPDVSAPPPEEPHSDRFTCKSCCSTRGRIQLSSALGAALPVLCW
FT                   LCWDTMFREL"
FT   gap             23399356..23399375
FT                   /estimated_length=20
FT   gene            23409889..23412867
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /note="gene_id=mCG133885.1"
FT   mRNA            join(23409889..23409951,23410075..23410150,
FT                   23410427..23410521,23410742..23410873,23411007..23411158,
FT                   23411609..23411701,23411781..23411841,23411928..23411995,
FT                   23412218..23412290,23412478..23412867)
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /product="zinc finger, AN1 type domain 2B, transcript
FT                   variant mCT173375"
FT                   /note="gene_id=mCG133885.1 transcript_id=mCT173375.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(23409889..23409951,23410075..23410150,
FT                   23410427..23410521,23410742..23410873,23411007..23411158,
FT                   23411609..23411701,23411781..23411799,23411940..23411995,
FT                   23412218..23412290,23412478..23412867)
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /product="zinc finger, AN1 type domain 2B, transcript
FT                   variant mCT173376"
FT                   /note="gene_id=mCG133885.1 transcript_id=mCT173376.0
FT                   created on 17-SEP-2002"
FT   mRNA            join(23409901..23410150,23410427..23410521,
FT                   23410742..23410873,23411007..23411158,23411609..23411701,
FT                   23411781..23411841,23411928..23411995,23412218..23412290,
FT                   23412478..23412867)
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /product="zinc finger, AN1 type domain 2B, transcript
FT                   variant mCT135257"
FT                   /note="gene_id=mCG133885.1 transcript_id=mCT135257.1
FT                   created on 17-SEP-2002"
FT   mRNA            join(23409901..23410150,23410427..23410521,
FT                   23410742..23410873,23411007..23411158,23411609..23411701,
FT                   23411781..23411799,23411940..23411995,23412218..23412290,
FT                   23412478..23412867)
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /product="zinc finger, AN1 type domain 2B, transcript
FT                   variant mCT173374"
FT                   /note="gene_id=mCG133885.1 transcript_id=mCT173374.0
FT                   created on 17-SEP-2002"
FT   CDS             join(23410096..23410150,23410427..23410521,
FT                   23410742..23410873,23411007..23411158,23411609..23411701,
FT                   23411781..23411841,23411928..23411995,23412218..23412290,
FT                   23412478..23412522)
FT                   /codon_start=1
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /product="zinc finger, AN1 type domain 2B, isoform CRA_a"
FT                   /note="gene_id=mCG133885.1 transcript_id=mCT173375.0
FT                   protein_id=mCP96295.0 isoform=CRA_a"
FT                   /protein_id="EDL00369.1"
FT                   /translation="MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCG
FT                   SAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSG
FT                   CRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQTSRAGLAAISRAQGLASTSTAPS
FT                   PSRTLPSSSSPSRATPQLPTRTASPVIALQNGLSEDEALQRALELSLAEAKPQVLSSQE
FT                   EDDLALAQALSASEAEYQQQQAQSRSLKPSNCSLC"
FT   CDS             join(23410096..23410150,23410427..23410521,
FT                   23410742..23410873,23411007..23411158,23411609..23411701,
FT                   23411781..23411841,23411928..23411995,23412218..23412290,
FT                   23412478..23412522)
FT                   /codon_start=1
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /product="zinc finger, AN1 type domain 2B, isoform CRA_a"
FT                   /note="gene_id=mCG133885.1 transcript_id=mCT135257.1
FT                   protein_id=mCP74858.1 isoform=CRA_a"
FT                   /protein_id="EDL00370.1"
FT                   /translation="MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCG
FT                   SAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSG
FT                   CRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQTSRAGLAAISRAQGLASTSTAPS
FT                   PSRTLPSSSSPSRATPQLPTRTASPVIALQNGLSEDEALQRALELSLAEAKPQVLSSQE
FT                   EDDLALAQALSASEAEYQQQQAQSRSLKPSNCSLC"
FT   CDS             join(23410096..23410150,23410427..23410521,
FT                   23410742..23410873,23411007..23411158,23411609..23411701,
FT                   23411781..23411799,23411940..23411995,23412218..23412290,
FT                   23412478..23412522)
FT                   /codon_start=1
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /product="zinc finger, AN1 type domain 2B, isoform CRA_b"
FT                   /note="gene_id=mCG133885.1 transcript_id=mCT173374.0
FT                   protein_id=mCP96293.0 isoform=CRA_b"
FT                   /protein_id="EDL00371.1"
FT                   /translation="MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCG
FT                   SAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSG
FT                   CRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQTSRAGLAAISRAQGLASTSTAPS
FT                   PSRTLPSSSSPSRATPQLPALQRALELSLAEAKPQVLSSQEEDDLALAQALSASEAEYQ
FT                   QQQAQSRSLKPSNCSLC"
FT   CDS             join(23410096..23410150,23410427..23410521,
FT                   23410742..23410873,23411007..23411158,23411609..23411701,
FT                   23411781..23411799,23411940..23411995,23412218..23412290,
FT                   23412478..23412522)
FT                   /codon_start=1
FT                   /gene="Zfand2b"
FT                   /locus_tag="mCG_133885"
FT                   /product="zinc finger, AN1 type domain 2B, isoform CRA_b"
FT                   /note="gene_id=mCG133885.1 transcript_id=mCT173376.0
FT                   protein_id=mCP96294.0 isoform=CRA_b"
FT                   /protein_id="EDL00372.1"
FT                   /translation="MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAQHHCG
FT                   SAYQKDIQVPVCPLCNVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSG
FT                   CRQREMMKLTCDRCGRNFCIKHRHPLDHECSGEGHQTSRAGLAAISRAQGLASTSTAPS
FT                   PSRTLPSSSSPSRATPQLPALQRALELSLAEAKPQVLSSQEEDDLALAQALSASEAEYQ
FT                   QQQAQSRSLKPSNCSLC"
FT   gene            complement(23412896..23421603)
FT                   /gene="Abcb6"
FT                   /locus_tag="mCG_133887"
FT                   /note="gene_id=mCG133887.1"
FT   mRNA            complement(join(23412896..23413230,23413356..23413424,
FT                   23413508..23413602,23413797..23413909,23414033..23414207,
FT                   23414787..23414891,23415104..23415161,23415381..23415466,
FT                   23415568..23415631,23415720..23415796,23415944..23416069,
FT                   23416215..23416280,23416749..23416858,23417331..23417452,
FT                   23418544..23418727,23418905..23419006,23419162..23419342,
FT                   23420171..23420308,23420810..23421603))
FT                   /gene="Abcb6"
FT                   /locus_tag="mCG_133887"
FT                   /product="ATP-binding cassette, sub-family B (MDR/TAP),
FT                   member 6"
FT                   /note="gene_id=mCG133887.1 transcript_id=mCT135259.1
FT                   created on 24-JUL-2002"
FT   CDS             complement(join(23413122..23413230,23413356..23413424,
FT                   23413508..23413602,23413797..23413909,23414033..23414207,
FT                   23414787..23414891,23415104..23415161,23415381..23415466,
FT                   23415568..23415631,23415720..23415796,23415944..23416069,
FT                   23416215..23416280,23416749..23416858,23417331..23417452,
FT                   23418544..23418727,23418905..23419006,23419162..23419342,
FT                   23420171..23420308,23420810..23421358))
FT                   /codon_start=1
FT                   /gene="Abcb6"
FT                   /locus_tag="mCG_133887"
FT                   /product="ATP-binding cassette, sub-family B (MDR/TAP),
FT                   member 6"
FT                   /note="gene_id=mCG133887.1 transcript_id=mCT135259.1
FT                   protein_id=mCP74429.1"
FT                   /protein_id="EDL00373.1"
FT                   /translation="MVTVGNYCETEGPAGPAWTQNGLSPCFFFTLVPSTLLTLGVLALV
FT                   LVLPRRRREVPAGPEELSWAAGPRVAPYVLQLFLATLQMALPLAGLAGRVGTARGVRLP
FT                   GYLLLASVLESLASVCGLWLLVVERSQARQSLAMGVWMKFRHSLGLLLLWTVTFAAENL
FT                   ALVSWNSPQWWWARADLGQQVQFGLWVLRYVTSGGLFILGLWAPGLRPQSYTLHVHEED
FT                   QDVGGNQGRSTDRRSTWRDLGRKLRLLSSYLWPRGSPSLQLIVLICLGLMGLERALNVL
FT                   VPIFYRDIVNLLTAKAPWSSLAWTVTTYVFLKFLQGGGTGSTGFVSNLRTFLWIRVQQF
FT                   TSRGVELRLFSHLHELSLRWHLGRRTGEVLRIVDRGTSSVTGLLSYLVFSIIPTLADII
FT                   IGIIYFSMFFNAWFGLIVFLCMSLYLILTIVVTEWRAKFRRDMNTQENATRARAVDSLL
FT                   NFETVKYYGAEGYEVDRYREAILKFQGLEWKSTASLVVLNQTQNLVIGLGLLAGSLLCA
FT                   YFVSEQKLQVGDFVLFGTYITQLYMPLNWFGTYYRMIQTNFIDMENMFDLLKEETEVKD
FT                   VPGAGPLRFHKGRIEFENVHFSYADGQETLQDVSFTVMPGQTVALVGPSGAGKSTILRL
FT                   LFRFYDISSGCIRIDGQDISQVTQISLRSHIGVVPQDTVLFNDTIANNIRYGRVTAGDS
FT                   EVEAAAQAAGIHDAILSFPEGYETQVGERGLKLSGGEKQRVAIARTILKAPDIILLDEA
FT                   TSALDTSNERAIQASLAKVCTNRTTIVIAHRLSTVVNADQILVIKDGCIIERGRHEALL
FT                   SRGGVYAEMWQLQQQGQETVPEESKPQDTA"
FT   gene            complement(23422100..23433460)
FT                   /gene="Atg9a"
FT                   /locus_tag="mCG_142642"
FT                   /note="gene_id=mCG142642.1"
FT   mRNA            complement(join(23422100..23423192,23423855..23424000,
FT                   23424157..23424379,23425719..23425836,23425952..23426130,
FT                   23426316..23426564,23426929..23427108,23427214..23427367,
FT                   23427453..23428449,23428948..23429089,23429208..23429369,
FT                   23430826..23430890,23431375..23431418,23431567..23431698,
FT                   23432087..23432141,23433088..>23433187))
FT                   /gene="Atg9a"
FT                   /locus_tag="mCG_142642"
FT                   /product="autophagy-related 9A (yeast), transcript variant
FT                   mCT189271"
FT                   /note="gene_id=mCG142642.1 transcript_id=mCT189271.0
FT                   created on 08-MAR-2004"
FT   gap             23422742..23422798
FT                   /estimated_length=57
FT   mRNA            complement(join(23422799..23423257,23423855..23424000,
FT                   23424157..23424379,23425719..23425836,23425952..23426130,
FT                   23426316..23426564,23426929..23427108,23427214..23427367,
FT                   23427453..23428201,23428948..23429089,23429208..23429369,
FT                   23430826..23430890,23431375..23431418,23431567..23431698,
FT                   23432087..23432144,23433088..23433460))
FT                   /gene="Atg9a"
FT                   /locus_tag="mCG_142642"
FT                   /product="autophagy-related 9A (yeast), transcript variant
FT                   mCT181341"
FT                   /note="gene_id=mCG142642.1 transcript_id=mCT181341.0
FT                   created on 18-MAR-2003"
FT   CDS             complement(join(23423187..23423192,23423855..23424000,
FT                   23424157..23424379,23425719..23425836,23425952..23426130,
FT                   23426316..23426564,23426929..23427108,23427214..23427367,
FT                   23427453..>23428312))
FT                   /codon_start=1
FT                   /gene="Atg9a"
FT                   /locus_tag="mCG_142642"
FT                   /product="autophagy-related 9A (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG142642.1 transcript_id=mCT189271.0
FT                   protein_id=mCP110291.0 isoform=CRA_b partial"
FT                   /protein_id="EDL00375.1"
FT                   /translation="AYDLYLCRQSPTSVLNKGFSYTLYISYTCLLSTLSWQSALPYCTW
FT                   QEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVALVNKSLLPLRFRLPGLGE
FT                   VVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLELAQRLSNRILWIGIANF
FT                   LLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYLRHFNELEHELQSRLNRG
FT                   YKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDEDVLAVEHVLTTVTLLGV
FT                   TVTVCRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHRSQTRDEFAQLFQYKAVF
FT                   ILEELLSPIVTPLILIFCLRPRALEIIDFFRNFTVEVVGVGDTCSFAQMDVRQHGHPQW
FT                   LSGGQTEASVYQQAEDGKTELSLMHFAITNPGWQPPRESTAFLGFLKEQVQRDGAAAGL
FT                   AQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSCRGPSLSRDLQGSRHRADVASAL
FT                   RSFSPLQPGAAPQGRVPSTMTGSGVDARTASSGSSVWEGQLQSLVLSEYASTEMSLHAL
FT                   YMHQLHKQQTQAEPERHVWHRRESDESGESAPEEGGEGARAPQPIPRSASYPCATPRPG
FT                   APETTALHGGFQRRYGGITDPGTVPRGPSHFSRLPLGGWAEDGQPASRHPEPVPEEGSE
FT                   DELPPQVHKV"
FT   CDS             complement(join(23423231..23423257,23423855..23424000,
FT                   23424157..23424379,23425719..23425836,23425952..23426130,
FT                   23426316..23426564,23426929..23427108,23427214..23427367,
FT                   23427453..23428201,23428948..23429089,23429208..23429369,
FT                   23430826..23430890,23431375..23431418,23431567..23431669))
FT                   /codon_start=1
FT                   /gene="Atg9a"
FT                   /locus_tag="mCG_142642"
FT                   /product="autophagy-related 9A (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG142642.1 transcript_id=mCT181341.0
FT                   protein_id=mCP104263.0 isoform=CRA_a"
FT                   /protein_id="EDL00374.1"
FT                   /translation="MAQFDTEYQRLEASYSDSPPGEEDLLVHVAEGSKSPWHHIENLDL
FT                   FFSRVYNLHQKNGFTCMLIGEMFELMQFLFVVAFTTFLVSCVDYDILFANKMVNHSLHP
FT                   TEPVKVTLPDAFLPAQVCSARIQENGSLITILVIAGVFWIHRLIKFIYNICCYWEIHSF
FT                   YLHALRIPMSALPYCTWQEVQARIVQTQKEHQICIHKRELTELDIYHRILRFQNYMVAL
FT                   VNKSLLPLRFRLPGLGEVVFFTRGLKYNFELILFWGPGSLFLNEWSLKAEYKRGGQRLE
FT                   LAQRLSNRILWIGIANFLLCPLILIWQILYAFFSYAEVLKREPGALGARCWSLYGRCYL
FT                   RHFNELEHELQSRLNRGYKPASKYMNCFLSPLLTLLAKNGAFFAGSILAVLIALTIYDE
FT                   DVLAVEHVLTTVTLLGVTVTVCRSFIPDQHMVFCPEQLLRVILAHIHYMPDHWQGNAHR
FT                   SQTRDEFAQLFQYKAVFILEELLSPIVTPLILIFCLRPRALEIIDFFRNFTVEVVGVGD
FT                   TCSFAQMDVRQHGHPQWLSGGQTEASVYQQAEDGKTELSLMHFAITNPGWQPPRESTAF
FT                   LGFLKEQVQRDGAAAGLAQGGLLPENALFTSIQSLQSESEPLSLIANVVAGSSCRGPSL
FT                   SRDLQGSRHRADVASALRSFSPLQPGAAPQGRVPSTMTGSGVDARTASSGSSVWEGQLQ
FT                   SLVLSEYASTEMSLHALYMHQLHKQQTQAEPERHVWHRRESDESGESAPEEGGEGARAP
FT                   QPIPRSASYPCATPRPGAPETTALHGGFQRRYGGITDPGTVPRGPSHFSRLPLGGWAED
FT                   GQPASRHPEPVPEEGSEDELPPQVHKIPLGQDDS"
FT   gene            23433450..23440809
FT                   /locus_tag="mCG_133867"
FT                   /note="gene_id=mCG133867.2"
FT   mRNA            join(23433450..23433941,23435442..23435548,
FT                   23436105..23436976,23437065..23437212,23437417..23437645,
FT                   23437778..23437933,23438908..23439388,23439529..23439640,
FT                   23439741..23439908,23440044..23440129,23440328..23440809)
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, transcript variant mCT135239"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT135239.1
FT                   created on 17-JUN-2003"
FT   mRNA            join(23433450..23433941,23435442..23435548,
FT                   23436105..23436207,23436327..23436976,23437065..23437645,
FT                   23437778..23437933,23438908..23439388,23439529..23439640,
FT                   23439741..23439908,23440044..23440129,23440328..23440809)
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, transcript variant mCT171065"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT171065.1
FT                   created on 17-JUN-2003"
FT   mRNA            join(23433450..23433941,23435442..23435548,
FT                   23436105..23436207,23436327..23436520,23436864..23436976,
FT                   23437065..23437212,23437417..23437645,23437778..23437933,
FT                   23438908..23439388,23439529..23439640,23439741..23439908,
FT                   23440044..23440129,23440328..23440809)
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, transcript variant mCT185747"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT185747.0
FT                   created on 17-JUN-2003"
FT   mRNA            join(23433450..23433941,23436105..23436207,
FT                   23436327..23436976,23437065..23437212,23437417..23437645,
FT                   23437778..23437933,23438908..23439388,23439529..23439640,
FT                   23439741..23439908,23440044..23440129,23440328..23440809)
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, transcript variant mCT171066"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT171066.1
FT                   created on 17-JUN-2003"
FT   mRNA            join(<23433477..23433941,23435442..23435548,
FT                   23436105..23436207,23436327..23436976,23437065..23437645,
FT                   23437778..23437933,23438908..23439640,23439741..23439908,
FT                   23440044..23440129,23440328..23440647)
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, transcript variant mCT189296"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT189296.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(<23433587..23433662,23437468..23437645,
FT                   23437778..23437933,23438908..23439388,23439529..23439640,
FT                   23439741..23439908,23440044..23440129,23440328..23440809)
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, transcript variant mCT185746"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT185746.0
FT                   created on 17-JUN-2003"
FT   CDS             join(<23433591..23433662,23437468..23437645,
FT                   23437778..23437933,23438908..23439388,23439529..23439640,
FT                   23439741..23439908,23440044..23440129,23440328..23440451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, isoform CRA_b"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT185746.0
FT                   protein_id=mCP107005.0 isoform=CRA_b"
FT                   /protein_id="EDL00378.1"
FT                   /translation="LVTPGLELGLGALHFTPEDPHVFTAETVLFRAPRSGRSLFFGGQG
FT                   APLQRDDPRLWDIPLTTRRPTFGELQRVLHKLTTLQVYDEDPREMVRFHSPETHWKPVR
FT                   EERKKDTEKEKTKVPSDANKPLGQDEEPLKQGSESQEEDGSEVELELVELTLGTLDLRE
FT                   FEVLPKRRRRRKKKERSQEQQCGAHGPLPQQPQDEPFSQPTQEVETPLDTLVYEAKAPG
FT                   QPELWDTLLAACRAGEVEVLKLQLATGLVDPGVKSLLNAPLGSGGFTLLHAAAAAGRGL
FT                   VVRLLLEAGADPTVQDSRARPPYTVAADKSTRNEFRRFMEKNLDAYDYNKARVPGPLTQ
FT                   EMEARQATRKKEQKAARRQREQQQRKQREQEEQEQEEQRRFAALSDREKRALAAERRLA
FT                   AQLGAPSPPVPDSAVASAGRCWSCGVSLQGLIPFHYLDFSFCSTRCLRDHRSQAGRPSS
FT                   "
FT   CDS             join(23433716..23433941,23435442..23435548,
FT                   23436105..23436207,23436327..23436520,23436864..23436976,
FT                   23437065..23437212,23437417..23437645,23437778..23437933,
FT                   23438908..23439388,23439529..23439640,23439741..23439908,
FT                   23440044..23440129,23440328..23440451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, isoform CRA_c"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT185747.0
FT                   protein_id=mCP107004.0 isoform=CRA_c"
FT                   /db_xref="GOA:J3QM81"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="MGI:MGI:1098746"
FT                   /db_xref="UniProtKB/TrEMBL:J3QM81"
FT                   /protein_id="EDL00379.1"
FT                   /translation="MAKPAGDAAVGSRSGELFLPSVSSSATSPAPSAASAPASVSLLSL
FT                   NGEAPLIRGLSLVSQAPGEALAWAPRTSCPGENTSSGGKVSPYSLEISEKLFCSACDQI
FT                   FQNHQEQREHYKLDWHRFNLKQRLKNKPLLSASDFEQQSSTGDLSSISGSDDTDSSSEE
FT                   DLLPLDEGRAESEKPNRPPGFYPHRVLFKNAQGQFLYAYRCVLGPHQIPPEKAELLLQN
FT                   LQNGGPRYYVVLMAAAGHFAGAIFQGREVVAHKTFHRYTVRAKRGTAQGLQDAHGRASR
FT                   SAGANLRRYNEAMLYKDVRNLLAGPIWSKALGEAETVLFRAPRSGRSLFFGGQGAPLQR
FT                   DDPRLWDIPLTTRRPTFGELQRVLHKLTTLQVYDEDPREMVRFHSPETHWKPVREERKK
FT                   DTEKEKTKVPSDANKPLGQDEEPLKQGSESQEEDGSEVELELVELTLGTLDLREFEVLP
FT                   KRRRRRKKKERSQEQQCGAHGPLPQQPQDEPFSQPTQEVETPLDTLVYEAKAPGQPELW
FT                   DTLLAACRAGEVEVLKLQLATGLVDPGVKSLLNAPLGSGGFTLLHAAAAAGRGLVVRLL
FT                   LEAGADPTVQDSRARPPYTVAADKSTRNEFRRFMEKNLDAYDYNKARVPGPLTQEMEAR
FT                   QATRKKEQKAARRQREQQQRKQREQEEQEQEEQRRFAALSDREKRALAAERRLAAQLGA
FT                   PSPPVPDSAVASAGRCWSCGVSLQGLIPFHYLDFSFCSTRCLRDHRSQAGRPSS"
FT   CDS             join(23436936..23436976,23437065..23437212,
FT                   23437417..23437645,23437778..23437933,23438908..23439388,
FT                   23439529..23439640,23439741..23439908,23440044..23440129,
FT                   23440328..23440451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, isoform CRA_a"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT135239.1
FT                   protein_id=mCP74765.1 isoform=CRA_a"
FT                   /protein_id="EDL00376.1"
FT                   /translation="MAAAGHFAGAIFQGREVVAHKTFHRYTVRAKRGTAQGLQDAHGRA
FT                   SRSAGANLRRYNEAMLYKDVRNLLAGPIWSKALGEAETVLFRAPRSGRSLFFGGQGAPL
FT                   QRDDPRLWDIPLTTRRPTFGELQRVLHKLTTLQVYDEDPREMVRFHSPETHWKPVREER
FT                   KKDTEKEKTKVPSDANKPLGQDEEPLKQGSESQEEDGSEVELELVELTLGTLDLREFEV
FT                   LPKRRRRRKKKERSQEQQCGAHGPLPQQPQDEPFSQPTQEVETPLDTLVYEAKAPGQPE
FT                   LWDTLLAACRAGEVEVLKLQLATGLVDPGVKSLLNAPLGSGGFTLLHAAAAAGRGLVVR
FT                   LLLEAGADPTVQDSRARPPYTVAADKSTRNEFRRFMEKNLDAYDYNKARVPGPLTQEME
FT                   ARQATRKKEQKAARRQREQQQRKQREQEEQEQEEQRRFAALSDREKRALAAERRLAAQL
FT                   GAPSPPVPDSAVASAGRCWSCGVSLQGLIPFHYLDFSFCSTRCLRDHRSQAGRPSS"
FT   CDS             join(23436936..23436976,23437065..23437212,
FT                   23437417..23437645,23437778..23437933,23438908..23439388,
FT                   23439529..23439640,23439741..23439908,23440044..23440129,
FT                   23440328..23440451)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, isoform CRA_a"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT171066.1
FT                   protein_id=mCP93983.1 isoform=CRA_a"
FT                   /protein_id="EDL00377.1"
FT                   /translation="MAAAGHFAGAIFQGREVVAHKTFHRYTVRAKRGTAQGLQDAHGRA
FT                   SRSAGANLRRYNEAMLYKDVRNLLAGPIWSKALGEAETVLFRAPRSGRSLFFGGQGAPL
FT                   QRDDPRLWDIPLTTRRPTFGELQRVLHKLTTLQVYDEDPREMVRFHSPETHWKPVREER
FT                   KKDTEKEKTKVPSDANKPLGQDEEPLKQGSESQEEDGSEVELELVELTLGTLDLREFEV
FT                   LPKRRRRRKKKERSQEQQCGAHGPLPQQPQDEPFSQPTQEVETPLDTLVYEAKAPGQPE
FT                   LWDTLLAACRAGEVEVLKLQLATGLVDPGVKSLLNAPLGSGGFTLLHAAAAAGRGLVVR
FT                   LLLEAGADPTVQDSRARPPYTVAADKSTRNEFRRFMEKNLDAYDYNKARVPGPLTQEME
FT                   ARQATRKKEQKAARRQREQQQRKQREQEEQEQEEQRRFAALSDREKRALAAERRLAAQL
FT                   GAPSPPVPDSAVASAGRCWSCGVSLQGLIPFHYLDFSFCSTRCLRDHRSQAGRPSS"
FT   CDS             join(23436936..23436976,23437065..23437239)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, isoform CRA_e"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT171065.1
FT                   protein_id=mCP93984.1 isoform=CRA_e"
FT                   /protein_id="EDL00381.1"
FT                   /translation="MAAAGHFAGAIFQGREVVAHKTFHRYTVRAKRGTAQGLQDAHGRA
FT                   SRSAGANLRRYNEAMLYKVSWASQIW"
FT   CDS             join(<23437417..23437645,23437778..23437933,
FT                   23438908..23439392)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133867"
FT                   /product="mCG133867, isoform CRA_d"
FT                   /note="gene_id=mCG133867.2 transcript_id=mCT189296.0
FT                   protein_id=mCP110276.0 isoform=CRA_d"
FT                   /protein_id="EDL00380.1"
FT                   /translation="DVRNLLAGPIWSKALGEAETVLFRAPRSGRSLFFGGQGAPLQRDD
FT                   PRLWDIPLTTRRPTFGELQRVLHKLTTLQVYDEDPREMVRFHSPETHWKPVREERKKDT
FT                   EKEKTKVPSDANKPLGQDEEPLKQGSESQEEDGSEVELELVELTLGTLDLREFEVLPKR
FT                   RRRRKKKERSQEQQCGAHGPLPQQPQDEPFSQPTQEVETPLDTLVYEAKAPGQPELWDT
FT                   LLAACRAGEVEVLKLQLATGLVDPGVKSLLNAPLGSGGFTLLHAAAAAGRGLVVRLLLE
FT                   AGADPTVQ"
FT   gene            complement(23439507..23452067)
FT                   /locus_tag="mCG_133890"
FT                   /note="gene_id=mCG133890.2"
FT   mRNA            complement(join(23439507..23439780,23440297..23441021,
FT                   23441175..23441390,23441594..23441725,23442208..23442321,
FT                   23442462..23442551,23442663..23442737,23443007..23443125,
FT                   23443314..23443354,23443451..23443572,23443672..23443730,
FT                   23443839..23444013,23444111..23444205,23449607..23449667,
FT                   23449975..23450125,23450344..23450510,23450669..23450791,
FT                   23451879..23452067))
FT                   /locus_tag="mCG_133890"
FT                   /product="mCG133890"
FT                   /note="gene_id=mCG133890.2 transcript_id=mCT135262.2
FT                   created on 12-JUN-2003"
FT   CDS             complement(join(23440758..23441021,23441175..23441390,
FT                   23441594..23441725,23442208..23442321,23442462..23442551,
FT                   23442663..23442737,23443007..23443125,23443314..23443354,
FT                   23443451..23443572,23443672..23443730,23443839..23444013,
FT                   23444111..23444205,23449607..23449667,23449975..23450125,
FT                   23450344..23450510,23450669..23450728))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133890"
FT                   /product="mCG133890"
FT                   /note="gene_id=mCG133890.2 transcript_id=mCT135262.2
F