Dbfetch

ID   CH466547; SV 2; linear; genomic DNA; CON; MUS; 27575588 BP.
XX
AC   CH466547;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009774422 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-27575588
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science, e1252229 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-27575588
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-27575588
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 8ed04a52d49dd0920a8d6603ed06d1ef.
DR   ENA; AAHY01000000; SET.
DR   ENA; AAHY00000000; SET.
DR   ENA-CON; CM000211.
DR   BioSample; SAMN03004379.
DR   Ensembl-Gn; ENSMUSG00000001017; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001021; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001023; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001025; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001416; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001419; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003382; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004892; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004894; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004895; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004896; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015852; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027776; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027782; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027792; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027827; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027828; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027931; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027932; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027937; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027995; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027996; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028003; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028004; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028040; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028049; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028051; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028059; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028063; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028064; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028076; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028081; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031286; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033831; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033981; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034139; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041237; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041355; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041423; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042520; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042747; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042784; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044080; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048416; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049741; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050144; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052310; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059743; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074457; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074513; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000090733; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091175; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000104043; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022573; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027271; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027279; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027281; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027287; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027293; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027301; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027302; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027304; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027319; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027320; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027328; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027330; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027333; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027336; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027337; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027341; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027350; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027353; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027360; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027364; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027369; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027371; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027378; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027382; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027384; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027388; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027392; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027396; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027397; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027400; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027403; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027405; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027407; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027415; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027416; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027417; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027419; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027423; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027424; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027431; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027445; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027450; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027451; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027457; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027464; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027467; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027468; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027471; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027475; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027476; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027477; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027479; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027480; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0027483; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022534; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027232; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027241; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027243; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027249; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027255; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027263; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027264; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027266; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027281; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027282; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027290; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027294; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027297; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027300; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027301; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027305; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027314; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027317; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027324; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027328; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027333; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027335; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027342; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027346; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027348; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027352; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027356; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027360; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027361; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027364; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027367; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027369; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027371; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027379; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027380; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027381; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027383; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027387; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027388; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027395; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027409; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027414; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027415; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027421; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027428; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027431; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027432; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027435; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027439; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027440; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027441; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027443; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027444; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AJ_G0027447; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022511; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027201; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027209; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027211; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027217; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027223; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027231; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027232; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027234; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027249; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027250; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027258; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027260; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027263; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027266; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027267; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027271; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027280; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027283; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027290; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027294; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027299; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027301; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027308; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027312; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027314; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027318; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027322; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027324; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027325; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027328; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027331; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027333; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027335; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027343; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027344; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027345; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027347; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027351; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027352; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027359; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027373; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027378; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027379; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027385; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027387; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027393; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027396; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027397; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027400; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027404; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027405; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027406; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027408; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027409; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_AKRJ_G0027412; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022537; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0025529; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027244; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027252; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027254; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027260; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027266; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027274; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027275; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027277; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027292; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027293; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027301; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027303; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027306; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027309; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027310; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027314; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027323; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027326; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027333; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027337; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027342; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027344; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027351; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027355; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027357; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027361; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027365; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027369; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027370; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027373; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027376; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027378; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027380; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027388; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027389; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027390; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027392; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027396; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027397; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027404; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027418; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027423; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027424; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027430; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027437; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027440; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027441; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027444; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027448; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027449; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027450; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027452; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027453; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_BALBcJ_G0027456; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022304; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026988; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026996; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0026998; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027004; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027010; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027018; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027019; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027021; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027036; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027037; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027045; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027047; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027050; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027053; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027054; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027058; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027067; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027070; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027080; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027085; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027087; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027094; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027098; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027100; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027104; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027108; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027111; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027112; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027115; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027118; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027120; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027122; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027130; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027131; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027132; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027134; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027138; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027139; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027146; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027160; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027165; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027166; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027172; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027179; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027182; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027183; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027186; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027190; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027191; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027192; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027194; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027195; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C3HHeJ_G0027198; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022988; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0025974; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027690; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027698; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027700; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027706; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027712; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027720; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027721; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027723; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027738; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027739; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027747; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027749; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027752; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027755; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027756; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027760; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027762; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027769; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027772; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027779; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027783; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027788; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027790; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027797; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027801; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027803; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027807; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027811; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027815; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027816; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027819; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027822; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027824; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027826; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027834; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027835; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027836; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027838; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027842; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027843; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027850; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027864; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027869; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027870; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027876; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027883; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027886; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027887; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027890; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027894; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027895; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027896; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027898; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027899; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0027902; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021832; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026435; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026443; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026445; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026451; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026457; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026465; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026466; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026468; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026483; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026484; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026492; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026494; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026497; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026500; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026501; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026505; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026514; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026517; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026523; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026527; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026532; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026534; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026540; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026544; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026546; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026550; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026554; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026557; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026558; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026561; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026564; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026566; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026568; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026576; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026577; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026578; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026580; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026584; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026585; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026592; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026606; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026611; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026612; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026618; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026625; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026629; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026632; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026636; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026637; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026638; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026640; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CASTEiJ_G0026641; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0022275; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026963; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026971; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026973; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026979; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026985; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026993; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026994; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0026996; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027011; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027012; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027020; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027022; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027025; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027028; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027029; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027033; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027042; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027045; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027051; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027055; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027060; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027062; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027069; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027073; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027075; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027079; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027083; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027085; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027086; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027089; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027092; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027094; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027096; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027104; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027105; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027106; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027108; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027112; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027113; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027120; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027134; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027140; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027146; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027154; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027157; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027158; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027161; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027165; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027166; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027167; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027169; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027170; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_CBAJ_G0027173; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022405; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027099; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027107; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027109; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027115; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027121; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027129; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027130; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027132; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027147; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027148; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027156; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027158; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027161; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027164; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027165; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027169; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027178; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027181; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027187; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027191; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027196; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027198; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027205; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027209; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027211; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027215; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027219; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027223; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027224; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027227; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027230; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027232; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027234; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027242; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027243; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027244; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027246; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027250; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027251; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027258; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027272; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027277; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027278; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027284; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027291; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027294; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027295; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027298; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027302; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027303; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027304; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027306; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027307; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_DBA2J_G0027310; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022381; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027067; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027075; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027077; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027083; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027089; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027097; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027098; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027100; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027115; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027116; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027124; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027126; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027129; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027132; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027133; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027137; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027146; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027149; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027156; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027160; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027165; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027167; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027174; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027178; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027180; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027184; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027191; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027192; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027195; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027198; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027200; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027202; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027210; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027211; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027212; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027214; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027218; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027219; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027226; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027240; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027246; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027252; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027259; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027262; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027263; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027266; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027270; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027271; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027272; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027274; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027275; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_FVBNJ_G0027278; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022472; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027207; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027215; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027217; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027223; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027229; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027237; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027238; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027240; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027255; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027256; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027264; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027266; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027269; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027272; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027273; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027277; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027286; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027289; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027295; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027299; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027304; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027306; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027313; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027317; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027319; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027323; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027327; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027332; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027333; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027336; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027339; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027341; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027343; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027351; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027352; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027353; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027355; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027359; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027360; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027367; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027381; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027386; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027387; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027393; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027400; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027403; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027404; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027407; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027411; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027412; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027413; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027415; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027416; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_LPJ_G0027419; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022402; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027085; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027094; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027096; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027102; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027108; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027116; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027117; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027119; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027134; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027135; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027143; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027145; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027148; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027151; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027152; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027156; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027165; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027168; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027175; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027179; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027184; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027186; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027193; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027197; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027199; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027203; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027207; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027211; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027212; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027215; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027218; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027220; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027222; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027230; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027231; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027232; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027234; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027238; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027239; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027246; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027260; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027265; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027266; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027272; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027280; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027283; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027284; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027287; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027291; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027292; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027293; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027295; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027296; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0027299; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022999; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027748; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027756; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027758; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027764; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027770; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027778; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027779; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027781; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027796; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027797; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027805; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027807; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027810; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027813; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027814; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027818; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027827; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027830; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027837; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027841; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027846; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027848; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027855; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027859; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027861; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027865; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027869; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027874; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027875; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027878; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027881; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027883; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027885; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027893; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027894; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027895; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027897; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027901; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027902; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027909; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027923; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027929; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027935; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027942; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027945; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027946; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027949; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027953; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027954; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027955; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027957; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027958; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0027961; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021575; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026169; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026177; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026179; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026185; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026191; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026199; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026200; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026202; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026217; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026218; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026226; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026228; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026231; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026234; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026235; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026239; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026248; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026251; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026256; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026260; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026265; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026267; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026273; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026277; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026279; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026283; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026287; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026291; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026292; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026295; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026298; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026300; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026302; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026311; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026312; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026314; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026318; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026319; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026326; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026340; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026345; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026346; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026352; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026359; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026362; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026363; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026366; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026370; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026371; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026372; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026374; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0026375; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021879; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026513; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026521; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026523; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026529; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026535; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026543; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026544; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026546; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026561; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026562; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026570; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026572; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026575; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026578; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026579; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026583; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026585; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026592; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026595; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026606; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026611; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026613; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026620; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026624; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026626; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026630; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026634; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026639; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026640; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026643; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026646; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026648; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026650; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026658; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026659; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026660; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026662; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026666; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026667; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026674; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026688; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026693; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026694; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026700; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026707; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026710; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026711; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026714; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026718; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026719; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026720; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026722; mus_musculus_wsbeij.
DR   Ensembl-Gn; MGP_WSBEiJ_G0026723; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000001043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001046; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001049; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001051; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005015; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005016; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008745; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029414; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029540; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029541; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029562; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029682; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029717; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000036252; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000041142; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049937; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060738; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077916; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081848; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090908; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098911; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107329; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107340; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107342; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117167; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000120377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000126628; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143514; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166237; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000168900; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169222; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176500; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182831; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000192477; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193882; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000193934; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000194558; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000195998; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000196709; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000197786; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198128; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000198322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200289; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200290; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000200508; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0043400; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061074; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061119; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061127; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061144; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061179; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061203; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061205; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061214; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061284; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061292; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061326; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061333; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061338; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061345; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061348; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061368; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061410; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061419; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061444; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061458; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061493; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061500; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061530; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061546; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061554; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061566; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061599; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061611; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061615; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061638; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061652; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061687; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061698; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061739; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061746; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061751; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061766; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061806; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061818; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061847; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061915; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061941; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0061948; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062003; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062044; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062060; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062070; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062077; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062092; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062094; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062096; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062101; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062103; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0062109; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0043367; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061096; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061143; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061151; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061168; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061203; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061227; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061229; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061238; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061307; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061315; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061349; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061358; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061363; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061370; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061373; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061393; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061436; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061445; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061469; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061484; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061519; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061526; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061556; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061572; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061580; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061592; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061625; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061641; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061645; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061668; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061682; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061718; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061729; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061771; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061778; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061783; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061798; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061838; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061850; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061880; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061949; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061975; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0061981; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062040; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062081; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062097; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062106; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062113; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062128; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062130; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062132; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062137; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062139; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AJ_T0062145; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0043341; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061030; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061079; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061087; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061104; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061139; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061163; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061165; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061174; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061245; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061253; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061287; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061294; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061299; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061306; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061309; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061329; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061372; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061381; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061406; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061421; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061456; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061463; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061493; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061509; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061517; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061530; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061563; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061575; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061579; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061602; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061616; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061652; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061663; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061707; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061711; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061716; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061731; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061771; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061783; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061813; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061881; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061907; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061911; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061973; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0061979; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062015; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062031; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062035; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062042; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062057; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062059; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062061; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062068; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_AKRJ_T0062074; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0043349; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0053720; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061021; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061068; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061076; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061093; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061128; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061152; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061154; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061163; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061233; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061241; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061275; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061282; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061287; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061294; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061297; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061317; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061361; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061370; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061396; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061411; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061446; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061483; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061499; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061507; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061520; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061553; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061569; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061573; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061596; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061610; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061644; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061655; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061696; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061703; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061708; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061724; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061765; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061777; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061807; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061876; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061902; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061913; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0061970; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062011; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062027; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062030; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062037; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062052; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062054; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062056; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062061; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062063; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_BALBcJ_T0062069; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0043092; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060714; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060762; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060770; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060787; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060822; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060846; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060848; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060857; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060930; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060938; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060972; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060979; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060984; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060991; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0060994; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061014; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061058; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061067; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061105; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061140; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061147; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061177; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061193; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061201; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061213; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061246; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061259; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061263; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061286; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061300; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061335; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061346; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061387; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061394; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061399; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061414; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061454; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061466; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061496; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061568; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061594; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061604; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061665; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061706; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061722; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061731; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061738; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061753; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061755; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061757; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061762; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061764; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C3HHeJ_T0061770; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0043838; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0054211; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061499; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061546; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061554; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061571; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061606; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061630; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061632; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061641; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061712; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061720; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061753; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061760; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061765; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061772; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061775; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061795; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061813; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061838; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061847; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061873; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061887; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061922; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061929; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061959; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061975; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061983; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0061997; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062030; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062046; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062050; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062073; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062087; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062122; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062133; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062175; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062182; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062187; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062202; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062242; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062254; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062283; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062354; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062380; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062392; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062453; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062494; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062510; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062519; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062526; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062541; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062543; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062545; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062550; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062552; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0062558; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0043194; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061009; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061056; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061064; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061081; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061116; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061140; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061142; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061151; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061223; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061231; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061266; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061273; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061278; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061286; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061289; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061310; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061353; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061361; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061386; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061400; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061435; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061442; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061471; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061487; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061495; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061507; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061540; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061554; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061558; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061585; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061598; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061631; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061642; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061682; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061690; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061695; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061710; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061751; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061764; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061794; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061860; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061888; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061896; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061951; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0061992; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062016; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062023; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062038; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062040; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062042; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062047; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CASTEiJ_T0062049; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0043005; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060690; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060739; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060747; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060763; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060798; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060822; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060824; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060833; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060904; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060912; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060946; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060953; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060958; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060965; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060968; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0060988; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061031; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061040; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061063; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061078; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061114; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061121; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061151; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061167; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061175; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061187; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061220; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061230; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061234; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061256; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061270; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061305; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061316; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061357; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061364; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061369; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061384; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061424; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061436; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061466; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061535; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061569; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061630; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061672; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061688; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061695; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061702; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061717; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061719; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061721; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061726; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061728; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_CBAJ_T0061734; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0043161; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060785; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060834; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060842; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060859; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060894; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060917; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060919; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060928; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0060997; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061005; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061039; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061046; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061051; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061058; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061061; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061081; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061125; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061134; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061158; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061173; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061208; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061215; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061245; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061261; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061269; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061282; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061315; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061329; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061333; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061356; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061370; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061405; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061416; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061459; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061466; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061471; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061486; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061526; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061538; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061568; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061639; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061665; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061673; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061731; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061772; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061788; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061797; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061804; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061819; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061821; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061823; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061828; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061830; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_DBA2J_T0061836; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0043114; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060775; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060820; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060828; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060845; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060879; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060903; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060905; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060913; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060983; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0060991; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061024; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061031; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061036; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061044; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061047; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061067; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061110; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061119; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061144; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061158; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061194; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061201; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061231; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061247; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061255; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061267; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061310; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061314; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061337; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061351; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061384; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061395; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061438; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061445; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061450; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061465; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061505; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061517; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061547; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061615; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061650; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061707; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061748; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061764; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061768; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061775; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061790; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061792; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061794; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061799; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061801; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_FVBNJ_T0061807; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0043225; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060932; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060977; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0060985; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061002; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061037; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061059; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061061; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061070; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061138; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061146; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061180; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061187; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061192; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061199; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061202; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061222; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061266; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061275; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061299; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061313; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061348; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061355; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061385; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061401; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061409; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061421; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061454; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061471; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061475; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061498; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061512; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061547; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061558; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061601; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061608; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061613; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061628; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061668; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061680; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061709; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061777; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061803; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061815; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061872; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061912; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061928; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061937; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061944; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061959; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061961; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061963; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061968; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061970; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_LPJ_T0061976; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0043095; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060745; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060789; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060797; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060814; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060849; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060870; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060872; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060881; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060950; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060958; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060991; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0060998; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061003; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061010; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061013; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061033; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061077; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061086; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061112; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061126; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061161; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061168; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061198; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061214; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061223; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061235; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061268; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061281; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061285; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061308; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061322; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061358; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061369; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061410; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061417; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061422; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061437; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061477; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061489; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061518; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061586; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061613; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061625; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061685; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061727; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061743; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061752; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061759; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061774; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061776; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061778; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061783; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061785; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0061791; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0043875; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061687; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061732; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061740; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061757; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061792; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061817; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061819; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061828; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061898; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061906; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061938; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061945; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061950; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061957; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061960; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0061981; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062024; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062033; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062058; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062072; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062107; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062114; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062144; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062160; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062169; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062182; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062215; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062232; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062236; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062259; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062273; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062307; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062318; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062364; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062371; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062376; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062391; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062431; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062443; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062473; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062546; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062584; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062645; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062686; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062702; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062711; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062718; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062733; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062735; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062737; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062742; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062744; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0062750; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0042782; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060565; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060611; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060619; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060636; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060671; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060693; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060695; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060704; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060773; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060781; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060817; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060824; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060829; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060836; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060839; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060859; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060903; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060912; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060937; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060951; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060985; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0060992; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061021; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061037; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061045; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061058; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061090; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061104; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061108; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061135; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061149; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061185; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061196; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061242; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061247; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061262; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061303; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061316; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061346; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061413; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061441; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061448; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061504; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061545; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061561; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061570; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061577; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061592; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061594; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061596; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061601; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0061603; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0042477; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0059991; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060036; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060044; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060061; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060096; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060120; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060122; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060131; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060200; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060208; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060242; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060249; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060254; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060261; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060264; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060284; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060302; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060327; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060336; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060376; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060411; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060418; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060448; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060464; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060472; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060485; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060518; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060535; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060539; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060562; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060576; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060610; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060621; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060664; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060671; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060676; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060691; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060731; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060743; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060773; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060843; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060869; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060878; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060925; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060965; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060981; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060985; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0060992; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061007; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061009; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061011; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061016; mus_musculus_wsbeij.
DR   Ensembl-Tr; MGP_WSBEiJ_T0061018; mus_musculus_wsbeij.
DR   PubMed; 12040188.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980433.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..27575588
FT                   /organism="Mus musculus"
FT                   /chromosome="3"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   assembly_gap    6746..6765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13254..13854
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    15257..17483
FT                   /estimated_length=2227
FT                   /gap_type="unknown"
FT   assembly_gap    33772..35253
FT                   /estimated_length=1482
FT                   /gap_type="unknown"
FT   gene            <64984..73897
FT                   /locus_tag="mCG_6369"
FT                   /note="gene_id=mCG6369.1"
FT   mRNA            join(<64984..65116,70676..70769,72542..72714,73750..73897)
FT                   /locus_tag="mCG_6369"
FT                   /product="mCG6369"
FT                   /note="gene_id=mCG6369.1 transcript_id=mCT5944.1 created on
FT                   19-NOV-2002"
FT   CDS             join(<64985..65116,70676..70769,72542..72714,73750..73851)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6369"
FT                   /product="mCG6369"
FT                   /note="gene_id=mCG6369.1 transcript_id=mCT5944.1
FT                   protein_id=mCP8210.1"
FT                   /protein_id="EDL15549.1"
FT                   /translation="SQPHTLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQL
FT                   CVESQVKMNLTGNLLFSLPDLYLKCVITLTGFAGKISQMPVILTPLHFDRDPLQKQPSC
FT                   QRSVVIRTFITSDFMTGVPETPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPETT
FT                   EWE"
FT   assembly_gap    88580..89017
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   gene            91735..92544
FT                   /pseudo
FT                   /locus_tag="mCG_1032246"
FT                   /note="gene_id=mCG1032246.1"
FT   mRNA            91735..92544
FT                   /pseudo
FT                   /locus_tag="mCG_1032246"
FT                   /note="gene_id=mCG1032246.1 transcript_id=mCT149950.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    94372..95338
FT                   /estimated_length=967
FT                   /gap_type="unknown"
FT   assembly_gap    99039..100953
FT                   /estimated_length=1915
FT                   /gap_type="unknown"
FT   assembly_gap    102023..104439
FT                   /estimated_length=2417
FT                   /gap_type="unknown"
FT   gene            complement(<104527..189842)
FT                   /locus_tag="mCG_119118"
FT                   /note="gene_id=mCG119118.1"
FT   mRNA            complement(join(<104527..104818,157533..157656,
FT                   171711..171941,180449..181318,184035..184326,
FT                   189507..189842))
FT                   /locus_tag="mCG_119118"
FT                   /product="mCG119118"
FT                   /note="gene_id=mCG119118.1 transcript_id=mCT120282.1
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(<104527..104818,157533..157656,
FT                   171711..171941,180449..181318,184035..184326,
FT                   189507..189748))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119118"
FT                   /product="mCG119118"
FT                   /note="gene_id=mCG119118.1 transcript_id=mCT120282.1
FT                   protein_id=mCP65693.1"
FT                   /protein_id="EDL15548.1"
FT                   /translation="MASRNKCLILGFTVFLWVELYTQYPHIDQNVTCRLLRKFNLTGYV
FT                   EAENHSVVIGGLFPVHYRTMPTSDSDEEIESPMCEGFNFRGFRWMKTMIHTIKEINERK
FT                   DILPNHTLGYQIFDNCFSITKAMESSSVFLTGQEEYKPNWRNSTGKFLIGIIGAGGSTM
FT                   SAAVSRIVGIHHVPQVGYASSSSIFSNDIQFPYILRTIPSDKFQSEAIVNLIRHFGWVW
FT                   VGAIASDDDYGKYGVKFFREEMESANLCVAFSETIPKVYSNEKMKIAVDAVKSSTAKVI
FT                   VLYATDIDLSPFVLEVIHHNITDRTWIATEAWITSALIAKPEYFPYFGGTFGFAVPRSV
FT                   IPGLKEFLYDVHPSKDPNDVLTIEFWQTAFNCTWPNSTVPYNVDHRVNMTGKEDRLYDM
FT                   SDQLCTGEEKLEDLKSTYLDTSQLRITNNVRQAVYLLAHAIDLFSQADIREEYRENAVL
FT                   ENKPNFESVKLWLYLTKIKFITHDGRKIELGRNGDVLNGSYDILNWHMDNTGEITFVKV
FT                   GEYKFTSSKYEFVLPKNSTLFWNTESSRLPDSVCTKVCPPGTRKGIHQGQPICCFDCIP
FT                   CTDGYVSEKPGQRECDPCGEDDWSNAEKSKCVPKLVEFLAYEEALGFTLVILSIFGALV
FT                   VLAVTAVYVVHRHTPLVKANDRELSFLIQMSLGITVLSSMLFIGKPCN"
FT   assembly_gap    105553..105832
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    107149..107168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    111502..146114
FT                   /estimated_length=34613
FT                   /gap_type="unknown"
FT   assembly_gap    153431..156186
FT                   /estimated_length=2756
FT                   /gap_type="unknown"
FT   assembly_gap    157715..158594
FT                   /estimated_length=880
FT                   /gap_type="unknown"
FT   assembly_gap    159527..159635
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    162735..165337
FT                   /estimated_length=2603
FT                   /gap_type="unknown"
FT   assembly_gap    167410..169090
FT                   /estimated_length=1681
FT                   /gap_type="unknown"
FT   assembly_gap    193180..193199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222569..222588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    278378..279757
FT                   /estimated_length=1380
FT                   /gap_type="unknown"
FT   gene            361012..361860
FT                   /pseudo
FT                   /locus_tag="mCG_1032245"
FT                   /note="gene_id=mCG1032245.1"
FT   mRNA            361012..361860
FT                   /pseudo
FT                   /locus_tag="mCG_1032245"
FT                   /note="gene_id=mCG1032245.1 transcript_id=mCT149949.1
FT                   created on 31-MAR-2003"
FT   assembly_gap    375403..375986
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    385941..386455
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   gene            411148..673208
FT                   /locus_tag="mCG_147520"
FT                   /note="gene_id=mCG147520.0"
FT   mRNA            join(411148..411459,671346..673208)
FT                   /locus_tag="mCG_147520"
FT                   /product="mCG147520"
FT                   /note="gene_id=mCG147520.0 transcript_id=mCT187783.0
FT                   created on 13-JAN-2004"
FT   CDS             join(411185..411459,671346..671634)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147520"
FT                   /product="mCG147520"
FT                   /note="gene_id=mCG147520.0 transcript_id=mCT187783.0
FT                   protein_id=mCP109364.0"
FT                   /protein_id="EDL15547.1"
FT                   /translation="MLAARTGAAGSQISEDNSKFRKQSGLSSGGKDRSPKKAPENAKDS
FT                   SLSPTGQSQLRARQLALLREVEMNWYLKLCELSSEHTTAHTTGMPHSLSQIDFDASLSS
FT                   CPSQAFKPRHFYHLHVLNLVGLLRHHHQTVVTHSKTQSVRQRWKPDSAHRKRQCRLCLR
FT                   ARLMGRISVWTLTEEQKFRGKGKE"
FT   assembly_gap    418194..418213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    419809..419828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    424426..424630
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    437021..437040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    441003..441022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    442943..442962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    471324..471343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    472455..472478
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    500410..500429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    517437..517465
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    551339..551415
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   gene            <566384..>834881
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /note="gene_id=mCG13445.3"
FT   mRNA            join(<566384..567009,716069..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   823626..824133)
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, transcript variant mCT190986"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT190986.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<566660..567009,711308..711423,716061..716112,
FT                   753555..753592,755958..756037,757877..757921,
FT                   760429..760473,762400..762443,777753..777839,
FT                   814602..814687,815361..815481,816587..816681,
FT                   822947..823067,829658..829750,834792..834881)
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, transcript variant mCT11663"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT11663.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(<566762..567009,716069..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   823626..823642)
FT                   /codon_start=1
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, isoform CRA_c"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT190986.0
FT                   protein_id=mCP111940.0 isoform=CRA_c"
FT                   /protein_id="EDL15544.1"
FT                   /translation="EDLALSWEAMQVSIACTEHNLKSRNGEDRLLSKQSSNAPNVVNAA
FT                   RAKFRTVAIIARSLGTFTPQHHISLKESTAKQTGMKYRNLGKSGLRVSCLGLGTWVTFG
FT                   GQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLY
FT                   WGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQ
FT                   GMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGV
FT                   GAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAE
FT                   RLGCTLPQLAVGSSPC"
FT   mRNA            join(<566789..567009,716069..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   829658..829746,834792..>834881)
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, transcript variant mCT190985"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT190985.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(566789..567009,716069..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   829658..829746,834792..834881)
FT                   /codon_start=1
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, isoform CRA_b"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT190985.0
FT                   protein_id=mCP111939.0 isoform=CRA_b"
FT                   /db_xref="GOA:P63143"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR005400"
FT                   /db_xref="InterPro:IPR005983"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:109155"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63143"
FT                   /protein_id="EDL15543.1"
FT                   /translation="MQVSIACTEHNLKSRNGEDRLLSKQSSNAPNVVNAARAKFRTVAI
FT                   IARSLGTFTPQHHISLKESTAKQTGMKYRNLGKSGLRVSCLGLGTWVTFGGQISDEVAE
FT                   RLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETER
FT                   GLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTS
FT                   RWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLA
FT                   CGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQL
FT                   AVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDY
FT                   RS"
FT   assembly_gap    585857..586035
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   gene            complement(590233..>760967)
FT                   /locus_tag="mCG_145238"
FT                   /note="gene_id=mCG145238.0"
FT   mRNA            complement(join(590233..591787,594145..594359,
FT                   713432..713537,756582..756815,760881..>760967))
FT                   /locus_tag="mCG_145238"
FT                   /product="mCG145238"
FT                   /note="gene_id=mCG145238.0 transcript_id=mCT184662.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(590997..>591299)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145238"
FT                   /product="mCG145238"
FT                   /note="gene_id=mCG145238.0 transcript_id=mCT184662.0
FT                   protein_id=mCP105805.0"
FT                   /protein_id="EDL15546.1"
FT                   /translation="SQRHGQGSRAGHQRSFGRESLPGLFVATAFCHTQPSALSSDPAVN
FT                   TLPSVCHQNFPLLHSQEGVFVVALSCAWIIQDNLLSSGSPNKLQLQISRATHSQC"
FT   assembly_gap    592217..592236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    593374..593393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    623498..623617
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    646277..646296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    649842..649890
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    663051..663070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    677339..677920
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    680589..680608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    703709..704020
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   CDS             join(<711400..711423,716061..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   829658..829750,834792..834802)
FT                   /codon_start=1
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, isoform CRA_a"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT11663.2
FT                   protein_id=mCP18402.2 isoform=CRA_a"
FT                   /protein_id="EDL15542.1"
FT                   /translation="LSGDTAFKCSRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMT
FT                   IAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSR
FT                   KHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSA
FT                   MEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGII
FT                   SGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAW
FT                   CLRNEGVSSVLLGSSTPEQLIENLGAIQASPP"
FT   assembly_gap    717340..717537
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    728951..729850
FT                   /estimated_length=900
FT                   /gap_type="unknown"
FT   assembly_gap    731156..731175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    732748..732767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    734044..734758
FT                   /estimated_length=715
FT                   /gap_type="unknown"
FT   assembly_gap    735937..736679
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    737870..737889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    739403..739422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    740983..742112
FT                   /estimated_length=1130
FT                   /gap_type="unknown"
FT   assembly_gap    763084..763224
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   gene            complement(782354..>807763)
FT                   /locus_tag="mCG_144656"
FT                   /note="gene_id=mCG144656.0"
FT   mRNA            complement(join(782354..783414,784487..784717,
FT                   807339..807400,807734..>807763))
FT                   /locus_tag="mCG_144656"
FT                   /product="mCG144656"
FT                   /note="gene_id=mCG144656.0 transcript_id=mCT184080.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(784605..784717,807339..807400,
FT                   807734..>807762))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144656"
FT                   /product="mCG144656"
FT                   /note="gene_id=mCG144656.0 transcript_id=mCT184080.0
FT                   protein_id=mCP105801.0"
FT                   /protein_id="EDL15545.1"
FT                   /translation="RQKNGSHERGYLKGVARRGAMSRMESEKGKALYLSEELRLSRDRN
FT                   LPECRCGQSLDLKLSALPCALC"
FT   assembly_gap    824415..824469
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    832414..832500
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   gene            complement(837970..850935)
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /note="gene_id=mCG13448.2"
FT   mRNA            complement(join(837970..840347,841305..841436,
FT                   846102..846200,849697..849823,850777..850935))
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /product="signal sequence receptor, gamma, transcript
FT                   variant mCT11666"
FT                   /note="gene_id=mCG13448.2 transcript_id=mCT11666.2 created
FT                   on 18-NOV-2002"
FT   CDS             complement(join(840281..840347,841305..841436,
FT                   846102..846200,849697..849823,850777..850909))
FT                   /codon_start=1
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /product="signal sequence receptor, gamma, isoform CRA_a"
FT                   /note="gene_id=mCG13448.2 transcript_id=mCT11666.2
FT                   protein_id=mCP18388.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK79"
FT                   /db_xref="InterPro:IPR009779"
FT                   /db_xref="MGI:MGI:1914687"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK79"
FT                   /protein_id="EDL15540.1"
FT                   /translation="MAPKGGSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIW
FT                   LYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKL
FT                   SEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPT
FT                   VNYILSISASSGLIALLSTGSK"
FT   mRNA            complement(join(840343..841436,846102..846200,
FT                   849697..849823,850777..>850926))
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /product="signal sequence receptor, gamma, transcript
FT                   variant mCT190988"
FT                   /note="gene_id=mCG13448.2 transcript_id=mCT190988.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(841256..841436,846102..846200,
FT                   849697..849823,850777..>850924))
FT                   /codon_start=1
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /product="signal sequence receptor, gamma, isoform CRA_b"
FT                   /note="gene_id=mCG13448.2 transcript_id=mCT190988.0
FT                   protein_id=mCP111941.0 isoform=CRA_b"
FT                   /protein_id="EDL15541.1"
FT                   /translation="VFSSAMAPKGGSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVS
FT                   AIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKE
FT                   VTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILK
FT                   NFNPTVYPLESFPINSSLLCF"
FT   assembly_gap    844811..844920
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   gene            851693..853635
FT                   /locus_tag="mCG_63314"
FT                   /note="gene_id=mCG63314.1"
FT   mRNA            851693..853635
FT                   /locus_tag="mCG_63314"
FT                   /product="mCG63314"
FT                   /note="gene_id=mCG63314.1 transcript_id=mCT63497.1 created
FT                   on 19-NOV-2002"
FT   CDS             851709..853556
FT                   /codon_start=1
FT                   /locus_tag="mCG_63314"
FT                   /product="mCG63314"
FT                   /note="gene_id=mCG63314.1 transcript_id=mCT63497.1
FT                   protein_id=mCP38993.0"
FT                   /protein_id="EDL15539.1"
FT                   /translation="MAVYHGMLRFGRLCIASLGARGPRTLLTRPRPNSKLQSVRALSSG
FT                   MVNCTNPLPIGGLSYIQGHTDSHLVNTTVGECLDATAQRFPDREALVILHENIRLNFAQ
FT                   LKEEVDKAASGLLSIGLRKGDRLGMQGPNSYAWVLIQLATAQAGIILVSVNPAYQSSEL
FT                   EYVLRKVGCKGIVFPKQFKTQQYYDILKQVCPELEKAQPGALKSERLPDLTTVISVDAP
FT                   LPGTLLLDNIVAAGGKEQNLAQLRYNQRFLSCYDPINIQFTSGTTGNPKGATLSHHNIV
FT                   NNSMLIGQRLKMPTKTAEELRVVLPSPLYHCLGSVGGTMVSMMHGATLLLSFPSFNGKK
FT                   ALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTSIRGGVIAGSPAPPELIRAIINKM
FT                   NMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTKAQIVNVETGELTNLNVP
FT                   GELYIRGYCVMQGYWGEPQKTFETVGQDKWYRTGDIASMDEQGFCKIVGRSKDMIIRGG
FT                   ENIYPAELEDFFLKHPQVQEAQVVGVKDKRMGEEICACIPLKSGETTTAEEIKAFCKGK
FT                   ISHFKIPRYIVFVEGYPLTISGKIQKFKLREQMEQHLKL"
FT   assembly_gap    918312..918331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    920041..920587
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    921399..921445
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    930018..930049
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   gene            complement(957982..958411)
FT                   /pseudo
FT                   /locus_tag="mCG_1032206"
FT                   /note="gene_id=mCG1032206.1"
FT   mRNA            complement(957982..958411)
FT                   /pseudo
FT                   /locus_tag="mCG_1032206"
FT                   /note="gene_id=mCG1032206.1 transcript_id=mCT149910.1
FT                   created on 28-MAR-2003"
FT   gene            complement(967036..>980890)
FT                   /locus_tag="mCG_144655"
FT                   /note="gene_id=mCG144655.0"
FT   mRNA            complement(join(967036..967367,968335..968382,
FT                   968843..969081,980754..>980890))
FT                   /locus_tag="mCG_144655"
FT                   /product="mCG144655"
FT                   /note="gene_id=mCG144655.0 transcript_id=mCT184079.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(967129..967367,968335..968382,
FT                   968843..>968942))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144655"
FT                   /product="mCG144655"
FT                   /note="gene_id=mCG144655.0 transcript_id=mCT184079.0
FT                   protein_id=mCP105799.0"
FT                   /protein_id="EDL15538.1"
FT                   /translation="SETGDIHISSRRSKEKPSKAKHIKIRRLKKEYKPSKGKARTFSCI
FT                   NRTPAYSTELVPEQPGLHQETLSKKEEEEEEEEAAAAAAAAAAAAAAAREMAQQLRVLP
FT                   QDQGLIPSTYMVTYNCLYHQFQKI"
FT   assembly_gap    978043..978062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            979925..1007522
FT                   /gene="Tiparp"
FT                   /locus_tag="mCG_13447"
FT                   /note="gene_id=mCG13447.1"
FT   mRNA            join(979925..980147,982742..983702,998210..998378,
FT                   999528..999688,1004539..1004814,1005121..1007522)
FT                   /gene="Tiparp"
FT                   /locus_tag="mCG_13447"
FT                   /product="TCDD-inducible poly(ADP-ribose) polymerase"
FT                   /note="gene_id=mCG13447.1 transcript_id=mCT11665.1 created
FT                   on 18-NOV-2002"
FT   CDS             join(982783..983702,998210..998378,999528..999688,
FT                   1004539..1004814,1005121..1005568)
FT                   /codon_start=1
FT                   /gene="Tiparp"
FT                   /locus_tag="mCG_13447"
FT                   /product="TCDD-inducible poly(ADP-ribose) polymerase"
FT                   /note="gene_id=mCG13447.1 transcript_id=mCT11665.1
FT                   protein_id=mCP18384.2"
FT                   /protein_id="EDL15537.1"
FT                   /translation="MEVETTEPEPDCVVQPPSPSDDFSCQMRISEKISPLKTCFKKKQE
FT                   QKRLGTGTLRSLRPILNTLLESGSLDGVFRARDQNRDESSLHEHIVKKPLEINPSCPPA
FT                   ENSMPVLIPDGTNVEGQLPEAHPSTDAPEQGVPIQDHSFPPETISGTVADSTTGHFQTD
FT                   LLHPVSGDVPTSPDCVDKVMDYVPGAFQDNSFTIQYILDTSDKLSTELFQDKSEEASLE
FT                   LVFELVNQLQYHTHQENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQS
FT                   VSNDSQEHLERFYCNPENDRMRMKYGGQDFWADLNAMTVFETTEFDQLRRLSTPPCSNS
FT                   NSIYHTFWKFFCRDHFGWREYPESVVRLIEEANSRGLKEVRFMMWNNHYILHNSFFRRE
FT                   IKRRPLFRSCFILIPYLQTLGGVPTQASLPLEATSSQIICPDGVTSANFYPETWVYMHP
FT                   SQDFIQVPVSAEDKSYRIIYNLFHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRK
FT                   MSGRDRIINERHLFHGTSQDVVDGICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFS
FT                   KKSSKGVHFMFLAKVLTGRYTMGSHGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIF
FT                   NDDQSYPYFVIQYEEVSNTVSI"
FT   assembly_gap    990664..990683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1018933..1018952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1025527..1025546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1036757..1036776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1067698..1068448)
FT                   /pseudo
FT                   /locus_tag="mCG_1032244"
FT                   /note="gene_id=mCG1032244.1"
FT   mRNA            complement(1067698..1068448)
FT                   /pseudo
FT                   /locus_tag="mCG_1032244"
FT                   /note="gene_id=mCG1032244.1 transcript_id=mCT149948.1
FT                   created on 31-MAR-2003"
FT   assembly_gap    1082951..1083180
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    1095125..1095144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1096182..1096201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1102562..1102581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1118177..1118196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            1119118..>1181947
FT                   /locus_tag="mCG_121055"
FT                   /note="gene_id=mCG121055.1"
FT   mRNA            join(1119118..1119473,1122252..1122340,1137147..1137361,
FT                   1180002..1180121,1181772..>1181947)
FT                   /locus_tag="mCG_121055"
FT                   /product="mCG121055"
FT                   /note="gene_id=mCG121055.1 transcript_id=mCT122251.1
FT                   created on 18-NOV-2002"
FT   CDS             join(1122293..1122340,1137147..1137361,1180002..1180121,
FT                   1181772..>1181947)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121055"
FT                   /product="mCG121055"
FT                   /note="gene_id=mCG121055.1 transcript_id=mCT122251.1
FT                   protein_id=mCP65738.1"
FT                   /protein_id="EDL15536.1"
FT                   /translation="MDRHIPMHALPEEIQKMSPEETVCKYCGVSYLILHEFKAMEEKLK
FT                   AVQEEMKFYQGSVEREKKLQEKLQSLSQEFEQYKSDSESKKARVEDASIQLKKQQNGFQ
FT                   RVQKELGHLQLELKIKQKQSQVFSQRLSEYKYFWNKTLLLLTFTKRELTSIKYEIYDNF
FT                   QNWTSLKGEVFLQIKSISDTALA"
FT   assembly_gap    1131329..1131348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1156143..1156310
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    1164916..1165610
FT                   /estimated_length=695
FT                   /gap_type="unknown"
FT   assembly_gap    1212974..1212993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1223248..1223403
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    1333147..1333344
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    1336614..1336633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1349422..1349490
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    1359698..1359771
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    1372844..1372924
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    1384925..1385106
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    1389578..1389721
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    1396831..1397074
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   gene            complement(1400642..>1412688)
FT                   /locus_tag="mCG_8564"
FT                   /note="gene_id=mCG8564.2"
FT   mRNA            complement(join(1400642..1401438,1402181..1402279,
FT                   1402387..1402498,1402752..1402893,1402986..1403090,
FT                   1403181..1403280,1404970..1405034,1405924..1406044,
FT                   1411343..1411452,1411991..1412065,1412298..>1412670))
FT                   /locus_tag="mCG_8564"
FT                   /product="mCG8564, transcript variant mCT7392"
FT                   /note="gene_id=mCG8564.2 transcript_id=mCT7392.1 created on
FT                   14-OCT-2002"
FT   mRNA            complement(join(1400646..1401438,1402181..1402279,
FT                   1402387..1402893,1402986..1403090,1403181..1405034,
FT                   1405924..1406044,1409694..1409766,1411343..1411452,
FT                   1411991..1412065,1412298..>1412688))
FT                   /locus_tag="mCG_8564"
FT                   /product="mCG8564, transcript variant mCT190993"
FT                   /note="gene_id=mCG8564.2 transcript_id=mCT190993.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1401090..1401438,1402181..1402279,
FT                   1402387..1402498,1402752..1402893,1402986..1403090,
FT                   1403181..1403280,1404970..1405034,1405924..1406044,
FT                   1411343..1411452,1411991..1412065,1412298..>1412669))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8564"
FT                   /product="mCG8564, isoform CRA_b"
FT                   /note="gene_id=mCG8564.2 transcript_id=mCT7392.1
FT                   protein_id=mCP18404.1 isoform=CRA_b"
FT                   /protein_id="EDL15535.1"
FT                   /translation="VSLWVPAASGVRGARWNYGVRASPDLDRCRRRRRCRLRLVRRPER
FT                   GASSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD
FT                   LRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIE
FT                   EAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQVIKAERRVLKELGFCVHVK
FT                   HPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQ
FT                   IPLPTRPHWFLLFGTTEEEIQEICIETLRLYTRKKPNYELLEKEVEKRKVALQEAKLKA
FT                   KGLNLDGTPALSTLGGFSPASKPSSPREVKAEEKSPVSINVKTVKKEPEDRQQASKSPY
FT                   NGVRKDSKRSRTSRSASRSRSRTRSRSRSHSPRRHYNNRRSRSGTYSSRSRSRSRSHSE
FT                   SPRRHHNHGSPHLKAKHTREDLKSSNRHGHKRKKSRSRSQSKTRDHSDVTKKHRHERGH
FT                   HRDRRERSRSFERSHKGKHHGGSRSGHGRHRR"
FT   CDS             complement(join(1409736..1409766,1411343..1411452,
FT                   1411991..1412065,1412298..>1412687))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8564"
FT                   /product="mCG8564, isoform CRA_a"
FT                   /note="gene_id=mCG8564.2 transcript_id=mCT190993.0
FT                   protein_id=mCP111953.0 isoform=CRA_a"
FT                   /protein_id="EDL15534.1"
FT                   /translation="RRGRWLVSLWVPAASGVRGARWNYGVRASPDLDRCRRRRRCRLRL
FT                   VRRPERGASSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLD
FT                   LPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACIN
FT                   LASKIEEAPRRIRDVINVFHHLRQLRGKSDQLHLPKPG"
FT   assembly_gap    1454390..1454579
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    1477684..1477798
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   gene            complement(1484101..1486034)
FT                   /locus_tag="mCG_8565"
FT                   /note="gene_id=mCG8565.2"
FT   mRNA            complement(join(1484101..1484523,1485750..1486034))
FT                   /locus_tag="mCG_8565"
FT                   /product="mCG8565"
FT                   /note="gene_id=mCG8565.2 transcript_id=mCT7393.2 created on
FT                   19-NOV-2002"
FT   CDS             complement(1484216..1484359)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8565"
FT                   /product="mCG8565"
FT                   /note="gene_id=mCG8565.2 transcript_id=mCT7393.2
FT                   protein_id=mCP18377.1"
FT                   /protein_id="EDL15533.1"
FT                   /translation="MEVPYSIIKGKARLGRMVHRKPYATVTFTQEDKGALVKLVEAIKE
FT                   QL"
FT   assembly_gap    1498416..1498460
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    1500461..1500480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(1510733..1723767)
FT                   /gene="Veph1"
FT                   /locus_tag="mCG_122317"
FT                   /note="gene_id=mCG122317.1"
FT   mRNA            complement(join(1510733..1511437,1515152..1515288,
FT                   1541248..1541365,1575052..1575186,1579294..1579433,
FT                   1611358..1611755,1612677..1612886,1625423..1625643,
FT                   1665828..1666037,1675763..1675929,1704045..1704219,
FT                   1714476..1714691,1723483..1723767))
FT                   /gene="Veph1"
FT                   /locus_tag="mCG_122317"
FT                   /product="ventricular zone expressed PH domain homolog 1
FT                   (zebrafish)"
FT                   /note="gene_id=mCG122317.1 transcript_id=mCT123534.1
FT                   created on 18-NOV-2002"
FT   CDS             complement(join(1511201..1511437,1515152..1515288,
FT                   1541248..1541365,1575052..1575186,1579294..1579433,
FT                   1611358..1611755,1612677..1612886,1625423..1625643,
FT                   1665828..1666037,1675763..1675929,1704045..1704219,
FT                   1714476..1714691,1723483..1723722))
FT                   /codon_start=1
FT                   /gene="Veph1"
FT                   /locus_tag="mCG_122317"
FT                   /product="ventricular zone expressed PH domain homolog 1
FT                   (zebrafish)"
FT                   /note="gene_id=mCG122317.1 transcript_id=mCT123534.1
FT                   protein_id=mCP65644.1"
FT                   /protein_id="EDL15531.1"
FT                   /translation="MEYEVYQLLRGFLSLTLTTDHGPGFTEIQLIQHTMHQLFRLVLGQ
FT                   KDLSKAGDLFSLDDAEIEDSLTEALEQIKVISSSLDYQTNNNDQAVVEICITRITTAIR
FT                   ETESIEKHARALVGLWDSCLEHNLRPAGKDEDTPHAKIASDIMSCILQNYNRTPVMVLA
FT                   VPIAVKFLHRGSKELCRNMSNYLSLAAITKADLLADHTEGIIKSILQGNAMLLRVLPAV
FT                   YEKQPQPINRHLAELLALMSQLEQTEQYHLLRLLHVAAKRKDVEVVQKCVPFLIRNLKD
FT                   STYNDIILNILIEIAGHEPLALNSFLPMLKEIAEQFPYLTGQMARIFGAVGHVDEERAR
FT                   SCLRYLVSQLANMEHPFHHILLLEIKSITDAFSSILGPHSRDIFRMSNSFTNIAKLLSR
FT                   QLENSKADSSRRKTSTEVSIPEKLRELNSMEPESEDHEKLQVKIQAFEDKINAESNTPG
FT                   SGRRYSLDHISKEERKSIRFSRSRSLALNTVLTNGVSVEDNEVEEKAGMHASISLSQID
FT                   PLSHGIGKLPFKTDTHGSPLRNSSASHPSIIHTEPETMPETFKENIQEEILEAATSPIE
FT                   YQDKLYLHLRENLSKVKAYALEIAKKVPIPDQCTIEDTMRSCVAKLFFTCSLKGHYCLY
FT                   SKSSFILVSQAPQPWIQVMFLSQQSLFPEPLSIQSGSVQFLKALWEKTQDTGAHSFEVA
FT                   MTESTFPQQKDLEQLQLHLEEVRFFDVFGFSETAGAWQCFMCNNPEKATVVNQDGQPLI
FT                   EGKLKEKQVRWKFIKRWKTHYFTLAGNQLLFQKGKSKDDPDDSPIELSKVQSVKAVAKK
FT                   RRDRSLPRAFEIFTDSKTYVFKAKDEKNAEEWLQCINVALAQAKERESREVTTYL"
FT   assembly_gap    1526739..1531558
FT                   /estimated_length=4820
FT                   /gap_type="unknown"
FT   assembly_gap    1554526..1554627
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1566307..1566326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1607850..1607998
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1610419..1610438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1613941..1613960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1623965..1623984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1640489..1640508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1644140..1644159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1645240..1645259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1646638..1646657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1665586..1665698
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   gene            1680315..1686156
FT                   /gene="Ptx3"
FT                   /locus_tag="mCG_8563"
FT                   /note="gene_id=mCG8563.1"
FT   mRNA            join(1680315..1680543,1681002..1681403,1684944..1686156)
FT                   /gene="Ptx3"
FT                   /locus_tag="mCG_8563"
FT                   /product="pentraxin related gene"
FT                   /note="gene_id=mCG8563.1 transcript_id=mCT7391.1 created on
FT                   14-OCT-2002"
FT   CDS             join(1680414..1680543,1681002..1681403,1684944..1685557)
FT                   /codon_start=1
FT                   /gene="Ptx3"
FT                   /locus_tag="mCG_8563"
FT                   /product="pentraxin related gene"
FT                   /note="gene_id=mCG8563.1 transcript_id=mCT7391.1
FT                   protein_id=mCP18403.2"
FT                   /protein_id="EDL15532.1"
FT                   /translation="MHLPAILLCALWSAVVAETSDDYELMYVNLDNEIDNGLHPTEDPT
FT                   PCDCRQEHSEWDKLFIMLENSQMREGMLLQATDDVLRGELQRLRAELGRLAGGMARPCA
FT                   AGGPADARLVRALEPLLQESRDASLRLARLEDAEARRPEATVPGLGAVLEELRRTRADL
FT                   SAVQSWVARHWLPAGCETAIFFPMRSKKIFGSVHPVRPMKLESFSTCIWVKATDVLNKT
FT                   ILFSYGTKWNPYEIQLYLSSQSLVLVVGGKENKLAADTVVSLGRWSHLCGTWSSEQGSM
FT                   SLWANGELVATTVEMAKSHSVPEGGLLQIGQEKNGCCVGGGFDESLAFSGRITGFNIWD
FT                   RVLSEEEIRASGGVESCHIRGNVVGWGVTEIQAHGGAQYVS"
FT   assembly_gap    1686600..1691110
FT                   /estimated_length=4511
FT                   /gap_type="unknown"
FT   assembly_gap    1709217..1709236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1718091..1718182
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    1727778..1730711
FT                   /estimated_length=2934
FT                   /gap_type="unknown"
FT   assembly_gap    1740059..1740128
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1749710..1749729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1769783..1769816
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    1777264..1777283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1830127..1830185
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    1842453..1842557
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    1844156..1844201
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1980577..1980596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1999768..1999860
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    2021475..2022316
FT                   /estimated_length=842
FT                   /gap_type="unknown"
FT   assembly_gap    2028569..2028668
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    2049564..2049740
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    2086784..2092009
FT                   /estimated_length=5226
FT                   /gap_type="unknown"
FT   assembly_gap    2129852..2131938
FT                   /estimated_length=2087
FT                   /gap_type="unknown"
FT   assembly_gap    2137278..2137320
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2142042..2142132
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    2163895..2167178
FT                   /estimated_length=3284
FT                   /gap_type="unknown"
FT   assembly_gap    2173717..2173772
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    2262550..2263914
FT                   /estimated_length=1365
FT                   /gap_type="unknown"
FT   assembly_gap    2265279..2266005
FT                   /estimated_length=727
FT                   /gap_type="unknown"
FT   assembly_gap    2271452..2271471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2285866..2286116
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    2291493..2294701
FT                   /estimated_length=3209
FT                   /gap_type="unknown"
FT   assembly_gap    2303649..2303863
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    2310625..2312045
FT                   /estimated_length=1421
FT                   /gap_type="unknown"
FT   assembly_gap    2355111..2361807
FT                   /estimated_length=6697
FT                   /gap_type="unknown"
FT   assembly_gap    2366820..2371945
FT                   /estimated_length=5126
FT                   /gap_type="unknown"
FT   assembly_gap    2398899..2398918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2423082..2423101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(2425239..2433710)
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /note="gene_id=mCG4342.1"
FT   mRNA            complement(join(2425239..2425911,2427412..2427500,
FT                   2427821..2427878,2430154..2430362,2433177..2433710))
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, transcript variant
FT                   mCT181553"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT181553.0 created
FT                   on 26-MAR-2003"
FT   mRNA            complement(join(2425239..2425869,2427408..2427500,
FT                   2427821..2427878,2430154..2430362,2433177..2433710))
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, transcript variant
FT                   mCT2754"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT2754.2 created on
FT                   26-MAR-2003"
FT   mRNA            complement(join(2425239..2425875,2427412..2427500,
FT                   2427821..2427878,2430154..2430362,2433032..>2433107))
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, transcript variant
FT                   mCT190955"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT190955.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2425618..2425911,2427412..2427500,
FT                   2427821..2427878,2430154..2430362,2433177..2433522))
FT                   /codon_start=1
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, isoform CRA_a"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT181553.0
FT                   protein_id=mCP104475.0 isoform=CRA_a"
FT                   /protein_id="EDL15528.1"
FT                   /translation="MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPGCVEP
FT                   GRDDRSSPAVRAAGGGGGAGGGGGGGGGGGGGAGGGGAGGGAGGGRSPVRELDMGAAER
FT                   SREPGSPRLTEVSPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETH
FT                   YPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPY
FT                   VNVGALRMPFQQDSHCNVTPLSFQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAPP
FT                   FGLPLATLAADSASAASVVAAAAAAKTTSKNSSIADLRLKAKKHAAALGL"
FT   CDS             complement(join(2425618..2425875,2427412..2427500,
FT                   2427821..2427878,2430154..2430362,2433032..>2433038))
FT                   /codon_start=1
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, isoform CRA_b"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT190955.0
FT                   protein_id=mCP111920.0 isoform=CRA_b"
FT                   /protein_id="EDL15529.1"
FT                   /translation="WRVSPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERL
FT                   FDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEAC
FT                   RVAPYVNVGALRMPFQQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAPPFGLPLAT
FT                   LAADSASAASVVAAAAAAKTTSKNSSIADLRLKAKKHAAALGL"
FT   CDS             complement(join(2425646..2425869,2427408..2427500,
FT                   2427821..2427878,2430154..2430362,2433177..2433522))
FT                   /codon_start=1
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, isoform CRA_c"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT2754.2
FT                   protein_id=mCP18390.2 isoform=CRA_c"
FT                   /protein_id="EDL15530.1"
FT                   /translation="MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPGCVEP
FT                   GRDDRSSPAVRAAGGGGGAGGGGGGGGGGGGGAGGGGAGGGAGGGRSPVRELDMGAAER
FT                   SREPGSPRLTEVSPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETH
FT                   YPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPY
FT                   VNVGALRMPFQQASAAAAGQRRGARAPPPASAPGRARALHDVPGTALRTAAGHAGRGLG
FT                   LGRLGGGRCRRRQDHQQELQHRGSQTES"
FT   gene            <2433372..2808633
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /note="gene_id=mCG4343.2"
FT   mRNA            join(<2433372..2433508,2534596..2534769,2631147..2631183,
FT                   2656744..2656795,2740372..2740445,2800153..2800259,
FT                   2805710..2805862,2806457..2808633)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT120907"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT120907.1 created
FT                   on 27-MAR-2003"
FT   assembly_gap    2433711..2433868
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   mRNA            join(<2437481..2437646,2446397..2446592,2448345..2448470,
FT                   2534596..2534784,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800259,2806457..2808633)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT2752"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT2752.2 created on
FT                   27-MAR-2003"
FT   CDS             join(2437481..2437646,2446397..2446592,2448345..2448470,
FT                   2534596..2534773)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT2752.2
FT                   protein_id=mCP18385.2 isoform=CRA_e"
FT                   /protein_id="EDL15527.1"
FT                   /translation="MTIHSLGIPNGPAACIDALDSSAEAAWCWNQEGAELKLKQVLRTP
FT                   VAPWLEEGVPEMGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRPRSDS
FT                   RSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRSRSRGRGKPYRVQRSRSKSRTRR
FT                   SRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDKEKREKEKDKGKDKEVHSIKRG"
FT   mRNA            join(<2437556..2437686,2446397..2446592,2448345..2448470,
FT                   2534596..2534769,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800263,2805714..2805862,
FT                   2806457..2807191)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT190958"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190958.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2437565..2437686,2446397..2446592,2448345..2448470,
FT                   2631147..2631183,2656744..2656795,2740377..2740445,
FT                   2800153..2800259,2801940..2803958)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT190959"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190959.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2437598..2437686,2446397..2446592,2448345..2448470,
FT                   2534596..2534769,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800259,2805710..2805862,
FT                   2806457..2808633)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT190957"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190957.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2437632..2437686,2446397..2446592,2448345..2448470,
FT                   2534596..2534769,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800263,2805714..2805862,
FT                   2806457..2806549)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190958.0
FT                   protein_id=mCP111922.0 isoform=CRA_c"
FT                   /protein_id="EDL15525.1"
FT                   /translation="KRGFQVPTSGGANPKVEPEMGRRSSDTEEESRSKRKKKHRRRSSS
FT                   SSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRS
FT                   RSRGRGKPYRVQRSRSKSRTRRSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDK
FT                   EKREKEKDKGKDKEVHSIKRGDSGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKA
FT                   KERSEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKKVIEPSEVQH
FT                   VTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDDNSLAHPNLFIEKAEAEEKWFKRLI
FT                   ALRQERLMGSPVA"
FT   CDS             join(<2437632..2437686,2446397..2446592,2448345..2448470,
FT                   2534596..2534769,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800259,2805710..2805862,
FT                   2806457..2806549)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190957.0
FT                   protein_id=mCP111921.0 isoform=CRA_b"
FT                   /protein_id="EDL15524.1"
FT                   /translation="KRGFQVPTSGGANPKVEPEMGRRSSDTEEESRSKRKKKHRRRSSS
FT                   SSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRS
FT                   RSRGRGKPYRVQRSRSKSRTRRSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDK
FT                   EKREKEKDKGKDKEVHSIKRGDSGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKA
FT                   KERSEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKKAVEPSEVQH
FT                   VTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDDNSLAHPNLFIEKAEAEEKWFKRLI
FT                   ALRQERLMGSPVA"
FT   CDS             join(<2437632..2437686,2446397..2446592,2448345..2448470,
FT                   2631147..2631183,2656744..2656795,2740377..2740445,
FT                   2800153..2800259,2801940..2801996)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190959.0
FT                   protein_id=mCP111923.0 isoform=CRA_d"
FT                   /protein_id="EDL15526.1"
FT                   /translation="KRGFQVPTSGGANPKVEPEMGRRSSDTEEESRSKRKKKHRRRSSS
FT                   SSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRS
FT                   RSRGRGKPYRVQRSRSKSRTRRDSGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALK
FT                   AKERSEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKKVLGRHDGL
FT                   SSLHSNDYLC"
FT   assembly_gap    2497997..2498016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2504158..2504922
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   assembly_gap    2548522..2549874
FT                   /estimated_length=1353
FT                   /gap_type="unknown"
FT   assembly_gap    2563044..2563063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2605360..2611884
FT                   /estimated_length=6525
FT                   /gap_type="unknown"
FT   assembly_gap    2629716..2629735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<2656788..2656795,2740372..2740445,2800153..2800259,
FT                   2805710..2805862,2806457..2806549)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT120907.1
FT                   protein_id=mCP65849.1 isoform=CRA_a"
FT                   /protein_id="EDL15523.1"
FT                   /translation="SCCAAKADEALKAKERSEEEAKRRKEEDQATLVEQVKRVKEIEAI
FT                   ESDSFVQQTFRSSKDVKKAVEPSEVQHVTAASGPASAAAEPPSTGKEIDPDSIPTAIKY
FT                   QDDNSLAHPNLFIEKAEAEEKWFKRLIALRQERLMGSPVA"
FT   assembly_gap    2747221..2747240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2815772..2815791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2819195..2819289
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    2824186..2824205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2824441..2850217
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /note="gene_id=mCG4348.2"
FT   mRNA            join(2824441..2824561,2834792..2834939,2843059..2843194,
FT                   2844154..2844282,2845471..2845518)
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, transcript variant
FT                   mCT181551"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT181551.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(2824447..2824561,2834792..2834939,2841232..2841276,
FT                   2843111..2843194,2844154..2844282,2845471..2845630,
FT                   2848000..2848129,2849921..2850217)
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, transcript variant
FT                   mCT181550"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT181550.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(2824482..2824561,2834792..2834939,2843111..2843194,
FT                   2844154..2844282,2845471..2845630,2848000..2848129,
FT                   2849921..2850181)
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, transcript variant
FT                   mCT2736"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT2736.1 created on
FT                   26-MAR-2003"
FT   CDS             join(2824515..2824561,2834792..2834939,2841232..2841276,
FT                   2843111..2843194,2844154..2844282,2845471..2845630,
FT                   2848000..2848129,2849921..2850026)
FT                   /codon_start=1
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT181550.0
FT                   protein_id=mCP104473.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8JZS2"
FT                   /db_xref="InterPro:IPR019376"
FT                   /db_xref="MGI:MGI:1341819"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JZS2"
FT                   /protein_id="EDL15520.1"
FT                   /translation="MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSIS
FT                   DGRGRTHNRRERDDGEDSLTATSFSLVPFGRFGGMHADVNPFQTMDRMMANMRSGIQEL
FT                   QRNFGQLSMDPNGHSFCSSSVMTYSKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSD
FT                   SGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQNEVLKYK
FT                   SIGRSGNTGMRSVGHEHPGSRELKRREKIHRNSAIESGRRSNVFVDKLNVKGSPVKITK
FT                   K"
FT   CDS             join(2824515..2824561,2834792..2834939,2843111..2843194,
FT                   2844154..2844282,2845471..2845630,2848000..2848129,
FT                   2849921..2850026)
FT                   /codon_start=1
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT2736.1
FT                   protein_id=mCP18379.1 isoform=CRA_c"
FT                   /db_xref="InterPro:IPR019376"
FT                   /db_xref="MGI:MGI:1341819"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V042"
FT                   /protein_id="EDL15522.1"
FT                   /translation="MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSIS
FT                   DGRGRTHNRRERDDGEDSLTHADVNPFQTMDRMMANMRSGIQELQRNFGQLSMDPNGHS
FT                   FCSSSVMTYSKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDR
FT                   GHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQNEVLKYKSIGRSGNTGMRSVGH
FT                   EHPGSRELKRREKIHRNSAIESGRRSNVFVDKLNVKGSPVKITKK"
FT   CDS             join(2824515..2824561,2834792..2834939,2843059..2843079)
FT                   /codon_start=1
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT181551.0
FT                   protein_id=mCP104472.0 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR019376"
FT                   /db_xref="MGI:MGI:1341819"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A6YVP7"
FT                   /protein_id="EDL15521.1"
FT                   /translation="MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSIS
FT                   DGRGRTHNRRERDDGEDSLTKTYLHL"
FT   assembly_gap    2825259..2825385
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    2864864..2865102
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    2871300..2871319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            2872533..2918954
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /note="gene_id=mCG4344.2"
FT   mRNA            join(2872533..2872735,2874063..2874215,2875768..2875900,
FT                   2877918..2878122,2880959..2881075,2882520..2882670,
FT                   2885973..2886127,2887191..2887275,2892097..2892234,
FT                   2893717..2893818,2896088..2896144,2898991..2899128,
FT                   2900306..2900388,2910225..2910387,2911884..2912028,
FT                   2915889..2916049,2916979..2917032,2917145..2917493)
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /product="G elongation factor, mitochondrial 1, transcript
FT                   variant mCT181552"
FT                   /note="gene_id=mCG4344.2 transcript_id=mCT181552.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(2872597..2872735,2874063..2874215,2875768..2875900,
FT                   2877918..2878122,2880959..2881075,2882520..2882674,
FT                   2885977..2886127,2887191..2887275,2892097..2892265,
FT                   2893727..2893818,2896088..2896144,2898991..2899128,
FT                   2900306..2900388,2910225..2910387,2911884..2912028,
FT                   2915889..2916049,2916979..2917032,2917145..2918954)
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /product="G elongation factor, mitochondrial 1, transcript
FT                   variant mCT2743"
FT                   /note="gene_id=mCG4344.2 transcript_id=mCT2743.2 created on
FT                   26-MAR-2003"
FT   CDS             join(2872652..2872735,2874063..2874215,2875768..2875900,
FT                   2877918..2878122,2880959..2881075,2882520..2882674,
FT                   2885977..2886127,2887191..2887275,2892097..2892265,
FT                   2893727..2893818,2896088..2896144,2898991..2899128,
FT                   2900306..2900388,2910225..2910387,2911884..2912028,
FT                   2915889..2916049,2916979..2917032,2917145..2917276)
FT                   /codon_start=1
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /product="G elongation factor, mitochondrial 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4344.2 transcript_id=mCT2743.2
FT                   protein_id=mCP18400.2 isoform=CRA_b"
FT                   /protein_id="EDL15517.1"
FT                   /translation="MRLLRVAAALGRGPFPRVPAVLGWQGKQADWKTRRWCSSGPVPNE
FT                   KIRNIGISAHIDSGKTTLTERVLYYTGRIATMHEVKGKDGVGAVMDSMELERQRGITIQ
FT                   SAATYTMWKDININIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVSRQM
FT                   KRYNVPFLTFINKLDRMGSNPSRALQQMRSKLNHNAAFVQIPIGLEGDFKGIIDLIEER
FT                   AIYFDGDFGQIVRYDEIPAGLRAAAADHRQELIECVANSDEQLGELFLEEKIPSVSDLK
FT                   ATIRRATLSRSFTPVFLGSALKNKGVQPLLDAVLEYLPNPSEVQNYAILNQNDSKEKTK
FT                   ILMNPQRDDSHPFVGLAFKLEAGRFGQLTYVRNYQGELKKGSTIYNTRTGKKVRVQRLV
FT                   RMHADMMEASISAATRRREVYAGDICALFGIDCASGDTFTNKDNSDLSMESIHVPEPVI
FT                   SIAMRPSNKNDLEKFSKGIGRFTREDPTFKVHFDPESKETIVSGMGELHLEIYAQRMER
FT                   EYGCPCITGKPKVAFRETIVAPVPFDFTHKKQSGGAGQFGKVIGVLEPLPPEDYTKLEF
FT                   SDETFGSNVPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIR
FT                   AGEGALKQALANGTLCIIEPIMSVEVIAPNEFQGTVFAGINRRHGVITGQDGIEDYFTL
FT                   YADVPLNNMFGYSTELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKK
FT                   GKAKN"
FT   CDS             join(2872652..2872735,2874063..2874215,2875768..2875900,
FT                   2877918..2878122,2880959..2881075,2882520..2882670,
FT                   2885973..2886127,2887191..2887275,2892097..2892234,
FT                   2893717..2893818,2896088..2896144,2898991..2899128,
FT                   2900306..2900388,2910225..2910387,2911884..2912028,
FT                   2915889..2916049,2916979..2917032,2917145..2917276)
FT                   /codon_start=1
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /product="G elongation factor, mitochondrial 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4344.2 transcript_id=mCT181552.0
FT                   protein_id=mCP104474.0 isoform=CRA_a"
FT                   /protein_id="EDL15516.1"
FT                   /translation="MRLLRVAAALGRGPFPRVPAVLGWQGKQADWKTRRWCSSGPVPNE
FT                   KIRNIGISAHIDSGKTTLTERVLYYTGRIATMHEVKGKDGVGAVMDSMELERQRGITIQ
FT                   SAATYTMWKDININIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVSRQM
FT                   KRYNVPFLTFINKLDRMGSNPSRALQQMRSKLNHNAAFVQIPIGLEGDFKGIIDLIEER
FT                   AIYFDGDFGQIVRYDEIPAGLRAAAADHRQELIECVANSDEQLGELFLEEKIPSVSDLK
FT                   RAIRRATLSRSFTPVFLGSALKNKGVQPLLDAVLEYLPNPSEVQNYAILNQNDSKEKTK
FT                   ILMNPQRDDSHPFVGLAFKLEAGRFGQLTYVRNYQGELKKGSTIYNTRTGKKVRVQRLV
FT                   RMHADMMEDVEEVYAGDICALFGIDCASGDTFTNKDNSDLSMESIHVPEPVISIAMRPS
FT                   NKNDLEKFSKGIGRFTREDPTFKVHFDPESKETIVSGMGELHLEIYAQRMEREYGCPCI
FT                   TGKPKVAFRETIVAPVPFDFTHKKQSGGAGQFGKVIGVLEPLPPEDYTKLEFSDETFGS
FT                   NVPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALK
FT                   QALANGTLCIIEPIMSVEVIAPNEFQGTVFAGINRRHGVITGQDGIEDYFTLYADVPLN
FT                   NMFGYSTELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKKGKAKN"
FT   gene            complement(2900415..2906289)
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /note="gene_id=mCG4347.1"
FT   mRNA            complement(join(2900415..2900745,2901012..2901074,
FT                   2903340..2903476,2903730..2903907,2904777..2904839,
FT                   2906004..2906231))
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /product="latexin, transcript variant mCT2735"
FT                   /note="gene_id=mCG4347.1 transcript_id=mCT2735.0 created on
FT                   26-MAR-2003"
FT   mRNA            complement(join(2900416..2900745,2901012..2901074,
FT                   2903730..2903907,2904777..2904839,2906004..2906289))
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /product="latexin, transcript variant mCT181549"
FT                   /note="gene_id=mCG4347.1 transcript_id=mCT181549.0 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(2900647..2900745,2901012..2901074,
FT                   2903340..2903476,2903730..2903907,2904777..2904839,
FT                   2906004..2906132))
FT                   /codon_start=1
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /product="latexin, isoform CRA_b"
FT                   /note="gene_id=mCG4347.1 transcript_id=mCT2735.0
FT                   protein_id=mCP18374.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q14BZ3"
FT                   /db_xref="InterPro:IPR009684"
FT                   /db_xref="MGI:MGI:107633"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BZ3"
FT                   /protein_id="EDL15519.1"
FT                   /translation="MEIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDI
FT                   PGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDN
FT                   TFYQSLMSLKRPLEAQDIPDNFGNVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKI
FT                   QTVKQVQRNDDFIELDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE
FT                   "
FT   CDS             complement(join(2901061..2901074,2903730..2903907,
FT                   2904777..2904839,2906004..2906132))
FT                   /codon_start=1
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /product="latexin, isoform CRA_a"
FT                   /note="gene_id=mCG4347.1 transcript_id=mCT181549.0
FT                   protein_id=mCP104471.0 isoform=CRA_a"
FT                   /protein_id="EDL15518.1"
FT                   /translation="MEIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDI
FT                   PGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDN
FT                   TFYQSLMSLKRPLEAQDIPAKKR"
FT   gene            complement(2921318..>2957975)
FT                   /locus_tag="mCG_4346"
FT                   /note="gene_id=mCG4346.1"
FT   mRNA            complement(join(2921318..2922038,2922118..2922180,
FT                   2927690..2927826,2933412..2933592,2938187..2938252,
FT                   2957522..2957653,2957667..>2957975))
FT                   /locus_tag="mCG_4346"
FT                   /product="mCG4346"
FT                   /note="gene_id=mCG4346.1 transcript_id=mCT2734.1 created on
FT                   18-NOV-2002"
FT   CDS             complement(join(2921889..2922038,2922118..2922180,
FT                   2927690..2927826,2933412..2933592,2938187..2938252,
FT                   2957522..2957653,2957667..2957975))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4346"
FT                   /product="mCG4346"
FT                   /note="gene_id=mCG4346.1 transcript_id=mCT2734.1
FT                   protein_id=mCP18386.1"
FT                   /protein_id="EDL15515.1"
FT                   /translation="MGHDPLSRRRLLVLLLGQGGEEGRRPGGGGEWPPWPISVSTANRV
FT                   QGAQRQLSPSTQPRGPLPPVSMQPRQPPMPALLLSLWLLPSLALAAAVTEPADLEYTEP
FT                   AAVGLPRGILQLAARAALHFFNFRAGSPSALRVLATVQEGRAWVNPQEGCEVDLVFSTE
FT                   QYNPEQEGERLGKCSARVFFKNEKPRPAVNVTCARLFDKVKRQEKDYRLYKQMKQLKTP
FT                   LHSISIPDSHGHIDNSLRPLWDLAFLGSSYVMWEKTTQVLHYYLVQLSSVERLKTDDDS
FT                   IDFDFTVLLHEFSTQEIIPCRIHLVWYPGKPLKVNYHCQEQQSPEEASGTMEASAMAPP
FT                   EFGNF"
FT   assembly_gap    2937060..2937215
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    2940271..2940372
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    2968971..2968990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2973200..2973219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2978765..2980011
FT                   /estimated_length=1247
FT                   /gap_type="unknown"
FT   assembly_gap    3008350..3008638
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   gene            complement(3013604..3015860)
FT                   /locus_tag="mCG_147519"
FT                   /note="gene_id=mCG147519.0"
FT   mRNA            complement(join(3013604..3014230,3015825..3015860))
FT                   /locus_tag="mCG_147519"
FT                   /product="mCG147519"
FT                   /note="gene_id=mCG147519.0 transcript_id=mCT187782.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3013826..3014008)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147519"
FT                   /product="mCG147519"
FT                   /note="gene_id=mCG147519.0 transcript_id=mCT187782.0
FT                   protein_id=mCP109363.0"
FT                   /protein_id="EDL15514.1"
FT                   /translation="MGEAVLPLVCCVVPSPPFCPHHLWQVGKLSKDLESGRTSLVPSWL
FT                   QHPGELVLHLAWTTG"
FT   assembly_gap    3017150..3017176
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    3020097..3020116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            3025735..3047200
FT                   /gene="Mfsd1"
FT                   /locus_tag="mCG_4345"
FT                   /note="gene_id=mCG4345.1"
FT   mRNA            join(3025735..3025944,3027611..3027663,3028565..3028677,
FT                   3030268..3030310,3030885..3030952,3032798..3032906,
FT                   3035537..3035639,3037266..3037364,3037735..3037846,
FT                   3039136..3039192,3039561..3039717,3040995..3041092,
FT                   3042907..3043019,3043560..3043607,3044289..3044346,
FT                   3045662..3047200)
FT                   /gene="Mfsd1"
FT                   /locus_tag="mCG_4345"
FT                   /product="major facilitator superfamily domain containing
FT                   1"
FT                   /note="gene_id=mCG4345.1 transcript_id=mCT2738.2 created on
FT                   18-NOV-2002"
FT   CDS             join(3025785..3025944,3027611..3027663,3028565..3028677,
FT                   3030268..3030310,3030885..3030952,3032798..3032906,
FT                   3035537..3035639,3037266..3037364,3037735..3037846,
FT                   3039136..3039192,3039561..3039717,3040995..3041092,
FT                   3042907..3043019,3043560..3043607,3044289..3044346,
FT                   3045662..3045665)
FT                   /codon_start=1
FT                   /gene="Mfsd1"
FT                   /locus_tag="mCG_4345"
FT                   /product="major facilitator superfamily domain containing
FT                   1"
FT                   /note="gene_id=mCG4345.1 transcript_id=mCT2738.2
FT                   protein_id=mCP18378.2"
FT                   /protein_id="EDL15513.1"
FT                   /translation="MEDEDGEDRALLGGRREADSAVHGAPRALSALCDPSRLAHRLVVL
FT                   SLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFLGGFLIDR
FT                   IFGIRWGTVIFSCFVCIGQVIFALGGIFNAFWLMELGRFVFGIGGESLAVAQNTYAVSW
FT                   FKGKELNLVFGLQLSMARIGSTVNMNLMGWLYGKIEALLGSAGHMTLGVTLMIGCITCI
FT                   FSLICALALAYLDRRAEKILHKEQGKTGEVIKLRDIKDFSLPLILVFVICVCYYVAVFP
FT                   FIGLGKVFFMEKFRFSSQSASAINSIVYIISAPMSPLFGLLVDKTGKNIIWVLYAVAAT
FT                   LVSHMMLAFTFWNPWIAMCLLGFSYSLLACALWPMVAFIVPEHQLGTAYGFMQSIQNLG
FT                   LAVIAILAGMILDSKGYLLLEVFFIACVSLSLLAVVCLYLVNRAQGGNLNYSAKQRERM
FT                   KLSHPE"
FT   assembly_gap    3047661..3047714
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   gene            complement(3048708..>3050812)
FT                   /locus_tag="mCG_48670"
FT                   /note="gene_id=mCG48670.2"
FT   mRNA            complement(join(3048708..3048937,3049021..>3050812))
FT                   /locus_tag="mCG_48670"
FT                   /product="mCG48670"
FT                   /note="gene_id=mCG48670.2 transcript_id=mCT48853.2 created
FT                   on 18-NOV-2002"
FT   CDS             complement(3049985..>3050566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48670"
FT                   /product="mCG48670"
FT                   /note="gene_id=mCG48670.2 transcript_id=mCT48853.2
FT                   protein_id=mCP39015.2"
FT                   /protein_id="EDL15512.1"
FT                   /translation="RCKLASRVDTVASKVQTAVTMKGVTKNMAQVTKALDKALSAMDLQ
FT                   KVSAVMDRFEQQVQNLDVYTSVMEDSVSSATMLTTPQEQVDSLIVQIAEENGLEVLDQL
FT                   SQLPEGASAVGESSVRSQEDQLSRRLAALRNQHVHGRCCLPCPMMFWRLLPNCASLSPT
FT                   LRSCLGSFPTCQAGALELSLRLGSRSLSWY"
FT   assembly_gap    3061069..3061088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3077973..3077992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3080257..3080588
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    3123268..3126175
FT                   /estimated_length=2908
FT                   /gap_type="unknown"
FT   assembly_gap    3137690..3137709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3143462..3143563
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    3183589..3183738
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    3230822..3234371
FT                   /estimated_length=3550
FT                   /gap_type="unknown"
FT   assembly_gap    3279323..3279525
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    3281986..3282005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3304380..3304399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <3332996..3497137
FT                   /gene="D230050A05"
FT                   /locus_tag="mCG_144654"
FT                   /note="gene_id=mCG144654.0"
FT   mRNA            join(<3332996..3333098,3481881..3481945,3487782..3487862,
FT                   3495807..3497137)
FT                   /gene="D230050A05"
FT                   /locus_tag="mCG_144654"
FT                   /product="hypothetical protein LOC208426"
FT                   /note="gene_id=mCG144654.0 transcript_id=mCT184078.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<3332997..3333098,3481881..3481945,3487782..3487862,
FT                   3495807..3495984)
FT                   /codon_start=1
FT                   /gene="D230050A05"
FT                   /locus_tag="mCG_144654"
FT                   /product="hypothetical protein LOC208426"
FT                   /note="gene_id=mCG144654.0 transcript_id=mCT184078.0
FT                   protein_id=mCP105800.0"
FT                   /protein_id="EDL15511.1"
FT                   /translation="TVTPGSVLPRNTVRQPLIQSPLTCRCSRNFKMRLEELKRLQNPLE
FT                   QVDDGKYLLENHQLAMDVENNIENYPLSLQPLESKVKIIQRAWREYLQRQDPLEKRSPS
FT                   PPSVSSDKLSSSVSMNTFSDSSTPVSVSRPLAWTVLH"
FT   assembly_gap    3346474..3346635
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3366821..3367120
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    3378899..3378918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3485606..3485625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3510444..3510483
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    3563634..3563653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3606974..3608965
FT                   /estimated_length=1992
FT                   /gap_type="unknown"
FT   assembly_gap    3664661..3667699
FT                   /estimated_length=3039
FT                   /gap_type="unknown"
FT   assembly_gap    3690286..3690471
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    3695287..3695444
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    3706674..3706923
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    3715847..3715866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3720867..3721025
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    3767910..3768446
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    3846446..3846465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3902195..3902455
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   gene            3942164..>3943932
FT                   /locus_tag="mCG_52724"
FT                   /note="gene_id=mCG52724.2"
FT   mRNA            join(3942164..3942279,3943248..>3943932)
FT                   /locus_tag="mCG_52724"
FT                   /product="mCG52724"
FT                   /note="gene_id=mCG52724.2 transcript_id=mCT52907.2 created
FT                   on 18-NOV-2002"
FT   CDS             3943266..>3943932
FT                   /codon_start=1
FT                   /locus_tag="mCG_52724"
FT                   /product="mCG52724"
FT                   /note="gene_id=mCG52724.2 transcript_id=mCT52907.2
FT                   protein_id=mCP39036.2"
FT                   /protein_id="EDL15510.1"
FT                   /translation="MDLGSDAGSSSSSRASSQSNSTKVTPCSECKSSSSPGGSLDLVSA
FT                   LEDYEEPFPVYQKKVIDEWAPEEDGEEEEEEDDRGYRDDGCPAREPGDVSARIGSSGSG
FT                   SRSAATTMPSPMPNGNLHPHDPQDLRHNGNVVVAGRPNASRVPRRPIQKTQPPGSRRGG
FT                   RNRASGGLCLQPPDGGTRVPEEPPAPPMDWEALEKHLAGLQFREQEVRNQGQARTNSTS
FT                   "
FT   assembly_gap    3967878..3971214
FT                   /estimated_length=3337
FT                   /gap_type="unknown"
FT   assembly_gap    3981690..3981821
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    4004046..4004240
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    4011387..4011728
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    4019364..4019383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4021073..4075073
FT                   /gene="Schip1"
FT                   /locus_tag="mCG_15117"
FT                   /note="gene_id=mCG15117.2"
FT   mRNA            join(<4021073..4021323,4044815..4044933,4065060..4065177,
FT                   4066231..4066428,4067216..4067339,4069593..4069686,
FT                   4074421..4075073)
FT                   /gene="Schip1"
FT                   /locus_tag="mCG_15117"
FT                   /product="schwannomin interacting protein 1"
FT                   /note="gene_id=mCG15117.2 transcript_id=mCT12852.2 created
FT                   on 03-SEP-2002"
FT   CDS             join(<4021174..4021323,4044815..4044933,4065060..4065177,
FT                   4066231..4066428,4067216..4067339,4069593..4069686,
FT                   4074421..4074472)
FT                   /codon_start=1
FT                   /gene="Schip1"
FT                   /locus_tag="mCG_15117"
FT                   /product="schwannomin interacting protein 1"
FT                   /note="gene_id=mCG15117.2 transcript_id=mCT12852.2
FT                   protein_id=mCP18396.2"
FT                   /protein_id="EDL15509.1"
FT                   /translation="SAGSPCLTRAFSRACGCSALSLRSLAQQSSFGVCVLGCSEMVHQE
FT                   NCSYQAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSARLQSGMNLQICFVND
FT                   SGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKKLQA
FT                   EAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMTIG
FT                   QLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEKM
FT                   PAK"
FT   assembly_gap    4084774..4084793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4103704..4103856
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    4125445..4125544
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   gene            4136922..4144826
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /note="gene_id=mCG15114.2"
FT   mRNA            join(4136922..4137019,4137769..4137844,4138301..4138434,
FT                   4140439..4140552,4141468..4141509,4141583..4141624,
FT                   4141715..4141858,4144173..4144803)
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, transcript variant mCT181511"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT181511.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(4137702..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141509,4141583..4141624,4141715..4141858,
FT                   4144173..4144826)
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, transcript variant mCT10117"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT10117.2 created
FT                   on 26-MAR-2003"
FT   mRNA            join(<4137805..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141624,4141715..4141858,4144173..4144369)
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, transcript variant mCT190970"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT190970.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4137805..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141554)
FT                   /codon_start=1
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, isoform CRA_b"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT190970.0
FT                   protein_id=mCP111879.0 isoform=CRA_b"
FT                   /protein_id="EDL15508.1"
FT                   /translation="SSSQCRSSMCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQS
FT                   RNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATR
FT                   ETSSTTVSKHSKGSFPMTDS"
FT   CDS             join(4137829..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141509,4141583..4141624,4141715..4141858,
FT                   4144173..4144328)
FT                   /codon_start=1
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, isoform CRA_a"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT10117.2
FT                   protein_id=mCP18399.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q549G3"
FT                   /db_xref="InterPro:IPR004281"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:96539"
FT                   /db_xref="UniProtKB/TrEMBL:Q549G3"
FT                   /protein_id="EDL15506.1"
FT                   /translation="MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTD
FT                   DMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRG
FT                   SCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELM
FT                   QSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA"
FT   CDS             join(4137829..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141509,4141583..4141624,4141715..4141858,
FT                   4144173..4144328)
FT                   /codon_start=1
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, isoform CRA_a"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT181511.0
FT                   protein_id=mCP104433.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q549G3"
FT                   /db_xref="InterPro:IPR004281"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="MGI:MGI:96539"
FT                   /db_xref="UniProtKB/TrEMBL:Q549G3"
FT                   /protein_id="EDL15507.1"
FT                   /translation="MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTD
FT                   DMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRG
FT                   SCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELM
FT                   QSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA"
FT   assembly_gap    4150611..4167041
FT                   /estimated_length=16431
FT                   /gap_type="unknown"
FT   gene            complement(4188763..>4190301)
FT                   /locus_tag="mCG_1032467"
FT                   /note="gene_id=mCG1032467.0"
FT   mRNA            complement(join(4188763..4189342,4190222..>4190301))
FT                   /locus_tag="mCG_1032467"
FT                   /product="mCG1032467"
FT                   /note="gene_id=mCG1032467.0 transcript_id=mCT150171.0
FT                   created on 27-MAR-2003"
FT   CDS             complement(4188921..>4189106)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032467"
FT                   /product="mCG1032467"
FT                   /note="gene_id=mCG1032467.0 transcript_id=mCT150171.0
FT                   protein_id=mCP65633.0"
FT                   /protein_id="EDL15505.1"
FT                   /translation="DLTSSSTSRRRTERARLDLAWTFETPKPTLSDIPPPRRPHLLILP
FT                   NSPSAGNQLLKRLCRN"
FT   assembly_gap    4191012..4191031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4260519..4260538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4271867..4272027
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            <4274980..4276876
FT                   /locus_tag="mCG_15115"
FT                   /note="gene_id=mCG15115.0"
FT   mRNA            join(<4274980..4275831,4276020..4276876)
FT                   /locus_tag="mCG_15115"
FT                   /product="mCG15115"
FT                   /note="gene_id=mCG15115.0 transcript_id=mCT10118.1 created
FT                   on 18-NOV-2002"
FT   CDS             join(<4275747..4275831,4276020..4276387)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15115"
FT                   /product="mCG15115"
FT                   /note="gene_id=mCG15115.0 transcript_id=mCT10118.1
FT                   protein_id=mCP18394.1"
FT                   /protein_id="EDL15504.1"
FT                   /translation="EIHAENMWRCLRQSFFFFFFLKIYLFIIWSYRRLRLIEDCNPVLK
FT                   RYAKEGGEFDYVISDLTVVPISTSPEEDCTWEFLRLIVDLSVKVLKQDGKYFTQGNCVN
FT                   LTEALSLYGEQLGRLYCPVEFSKEIICVPSYLELCVFYTVWKKVKP"
FT   gene            complement(4296877..4299230)
FT                   /locus_tag="mCG_147524"
FT                   /note="gene_id=mCG147524.0"
FT   mRNA            complement(4296877..4299230)
FT                   /locus_tag="mCG_147524"
FT                   /product="mCG147524"
FT                   /note="gene_id=mCG147524.0 transcript_id=mCT187787.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(4298443..4298949)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147524"
FT                   /product="mCG147524"
FT                   /note="gene_id=mCG147524.0 transcript_id=mCT187787.0
FT                   protein_id=mCP109369.0"
FT                   /protein_id="EDL15503.1"
FT                   /translation="MAKSTSRMSSPESLRTNQPTLSRKAWSGSLQQRTAVALAESQQRS
FT                   RSPHASSAQPPPPREGATNASANSSSSGSSGGGAGATDRPSAVTPGPHMAGADLRWRPG
FT                   PRGSELRLAPALRWVPRAPPPAPRLPAARAVLTWPRWGGRRSPGRARRLREAAAAHRCR
FT                   RLGSL"
FT   assembly_gap    4302807..4302826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4321460..4428666)
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /note="gene_id=mCG120371.1"
FT   mRNA            complement(join(4321460..4323129,4327433..4327556,
FT                   4338664..4338836,4338946..4339035,4340144..4340315,
FT                   4342009..4342156,4342542..4342677,4351859..4351923,
FT                   4354954..4355117,4359979..4360053,4364220..4364338,
FT                   4374451..4374630,4386274..4386411,4387717..4387806,
FT                   4391941..4392050,4409522..4409590,4411991..4412101,
FT                   4414849..4415076,4418610..4418689,4428555..4428666))
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas), transcript variant mCT121560"
FT                   /note="gene_id=mCG120371.1 transcript_id=mCT121560.1
FT                   created on 18-NOV-2002"
FT   CDS             complement(join(4323019..4323129,4327433..4327556,
FT                   4338664..4338836,4338946..4339035,4340144..4340315,
FT                   4342009..4342156,4342542..4342677,4351859..4351923,
FT                   4354954..4355117,4359979..4360053,4364220..4364338,
FT                   4374451..4374630,4386274..4386411,4387717..4387806,
FT                   4391941..4392050,4409522..4409549))
FT                   /codon_start=1
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG120371.1 transcript_id=mCT121560.1
FT                   protein_id=mCP65466.1 isoform=CRA_a"
FT                   /protein_id="EDL15500.1"
FT                   /translation="MLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVL
FT                   QWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYGSQPHEHPITSVAWAPDG
FT                   ELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVE
FT                   QRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFS
FT                   TKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILN
FT                   AQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGLTNDR
FT                   KIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDTCNILCGIQDTRFTVWYYPN
FT                   TIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHISISPYPAILHEY
FT                   VSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEIAYAAVGEIDKVRYINAIKD
FT                   LPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQININLYNWERALELAVKYKTHVD
FT                   TVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKAKIEMEITKERDRSSSGQSSKS
FT                   VGLKH"
FT   assembly_gap    4337551..4337608
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   mRNA            complement(join(4341497..4342677,4354954..4355117,
FT                   4359979..4360053,4364220..4364338,4374451..4374630,
FT                   4386274..4386411,4387717..4387806,4391941..4392050,
FT                   4409522..4409590,4411991..4412101,4414849..4415076,
FT                   4418610..4418689,4428555..>4428621))
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas), transcript variant mCT190928"
FT                   /note="gene_id=mCG120371.1 transcript_id=mCT190928.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(4342673..4342677,4354954..4355117,
FT                   4359979..4360053,4364220..4364338,4374451..4374630,
FT                   4386274..4386411,4387717..4387806,4391941..4392050,
FT                   4409522..4409590,4411991..4412101,4414849..4415076,
FT                   4418610..>4418634))
FT                   /codon_start=1
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas), isoform CRA_b"
FT                   /note="gene_id=mCG120371.1 transcript_id=mCT190928.0
FT                   protein_id=mCP111874.0 isoform=CRA_b"
FT                   /protein_id="EDL15501.1"
FT                   /translation="RYLSQRNQTSHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSET
FT                   SLIVKLPDDIYPIDLHWFPKSLGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHC
FT                   GAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYT
FT                   AGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYG
FT                   SQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQ
FT                   IAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASL
FT                   NHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEG
FT                   RFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKK"
FT   assembly_gap    4349303..4349322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4372534..4372553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <4376109..>4376793
FT                   /locus_tag="mCG_1032464"
FT                   /note="gene_id=mCG1032464.0"
FT   mRNA            join(<4376109..4376182,4376279..4376414,4376468..>4376793)
FT                   /locus_tag="mCG_1032464"
FT                   /product="mCG1032464"
FT                   /note="gene_id=mCG1032464.0 transcript_id=mCT150168.0
FT                   created on 28-MAR-2003"
FT   CDS             join(<4376288..4376414,4376468..4376793)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032464"
FT                   /product="mCG1032464"
FT                   /note="gene_id=mCG1032464.0 transcript_id=mCT150168.0
FT                   protein_id=mCP65615.0"
FT                   /protein_id="EDL15502.1"
FT                   /translation="YRQVPASPCNYLRMCNSIAPPLPLINTSPFACIAPSIPLISICTS
FT                   PFACVFKPWAWLIHFGVLIQLQNGFRVVIRTRPSSLSTPHLVIRRRSPRDPRITGPAGQ
FT                   VTSASQVLGLKLNNFLSLSILDSRKESFCFVVYSLWFLTKLVLHQT"
FT   assembly_gap    4407013..4408015
FT                   /estimated_length=1003
FT                   /gap_type="unknown"
FT   assembly_gap    4426574..4426593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            4428901..>4455990
FT                   /gene="Smc4"
FT                   /locus_tag="mCG_120372"
FT                   /note="gene_id=mCG120372.0"
FT   mRNA            join(4428901..4429213,4430129..4430336,4431312..4431490,
FT                   4432052..4432243,4433617..4433793,4440225..4440389,
FT                   4440758..4440885,4442177..4442317,4443272..4443422,
FT                   4446326..4446559,4448242..4448427,4449901..4450062,
FT                   4451553..4451778,4451879..4451958,4452506..4452658,
FT                   4453462..4453588,4454300..4454489,4455487..4455631,
FT                   4455816..>4455990)
FT                   /gene="Smc4"
FT                   /locus_tag="mCG_120372"
FT                   /product="structural maintenance of chromosomes 4"
FT                   /note="gene_id=mCG120372.0 transcript_id=mCT121561.0
FT                   created on 18-NOV-2002"
FT   CDS             join(4430204..4430336,4431312..4431490,4432052..4432243,
FT                   4433617..4433793,4440225..4440389,4440758..4440885,
FT                   4442177..4442317,4443272..4443422,4446326..4446559,
FT                   4448242..4448427,4449901..4450062,4451553..4451778,
FT                   4451879..4451958,4452506..4452658,4453462..4453588,
FT                   4454300..4454489,4455487..4455631,4455816..>4455990)
FT                   /codon_start=1
FT                   /gene="Smc4"
FT                   /locus_tag="mCG_120372"
FT                   /product="structural maintenance of chromosomes 4"
FT                   /note="gene_id=mCG120372.0 transcript_id=mCT121561.0
FT                   protein_id=mCP65482.1"
FT                   /protein_id="EDL15499.1"
FT                   /translation="MRRKGTKPSTACHQEEGPPPSQDGAHSDEEMEQPAGEAESAAPAK
FT                   PPGEELDNRSLEEILNSIPPPPPPAMASEAGAPRLMITHIVNQNFKSYAGEKVLGPFHK
FT                   RFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSKKLSVLIHNSDEHKDIQSCTVEVHFQ
FT                   KIIDKEGDDYEVLPNSNFYVSRTAYRDSTSVYHISGKKKTFKDVGNLLRSHGIDLDHNR
FT                   FLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGCGRLNEPIKVLCRRVEILNEHRGE
FT                   KLNRVKMVEKEKDALEGEKNIAIEFLTLENEMFKKKNHICQYYIYDLQNRIAEITTQKE
FT                   KIHEDTKEITEKSNVLSNEMKAKNSAVKDVEKKLNKVTKFIEQNKEKFTQLDLEDVQVR
FT                   EKLKHATSKAKKLEKQLQKDKEKIQEKELMGFNKSVNEARSKMEVAQSELDIYLSRHNT
FT                   AVSQLSKAKEALITASETLKERKAAIKDINTKLPQTQQELKEKEKELQKLTQEEINLKS
FT                   LVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYDIAI
FT                   SSCCHALDYIVVDSIDTAQECVNFLKKHNIGIATFIGLDKMTVWAKKMSKIQTPENTPR
FT                   LFDLVKVKNEEIRQAFYFALRDTLVANNLDQATRVAYQRDRRWRVVTLQGQIIEQSGTM
FT                   SGGGSKVMRGRMGSSVIDEISVEEVNKMESQLERHSKQAMQIQEQKVQHEEAVVKLRHS
FT                   ERDMRNTLEKFAASIQGLSEQEEYLCVQIKELEANVLTTAPDRKQQKLLEENVSVFKKE
FT                   YDAVAEKAGKVEAEIKRLHNTIIDINNRKLKAQQNKLDTINKQLDECASAITKAQVAIK
FT                   TADRNLKKAQDSVCRTEKEIKDTEKEINDLKTELKNIEDKAEEVINNTKTAETSLPEIQ
FT                   KEHRNLLQELKVIQENEHALQKDALSIKLKLEQIDGHISEHNSKIKYWQKE"
FT   assembly_gap    4440593..4440612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4456454..4460633
FT                   /estimated_length=4180
FT                   /gap_type="unknown"
FT   assembly_gap    4461907..4461926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4466636..4466655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4468268..4468410
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    4475839..4476156
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   gene            complement(4494726..4549973)
FT                   /gene="Kpna4"
FT                   /locus_tag="mCG_4359"
FT                   /note="gene_id=mCG4359.2"
FT   mRNA            complement(join(4494726..4496696,4499287..4499381,
FT                   4502368..4502530,4504148..4504219,4507039..4507143,
FT                   4508678..4508806,4510450..4510581,4512769..4512813,
FT                   4512901..4513070,4515809..4515895,4517651..4517736,
FT                   4518381..4518476,4523915..4523967,4524065..4524094,
FT                   4524204..4524293,4525067..4525111,4549612..4549973))
FT                   /gene="Kpna4"
FT                   /locus_tag="mCG_4359"
FT                   /product="karyopherin (importin) alpha 4"
FT                   /note="gene_id=mCG4359.2 transcript_id=mCT3111.2 created on
FT                   29-NOV-2004"
FT   CDS             complement(join(4496598..4496696,4499287..4499381,
FT                   4502368..4502530,4504148..4504219,4507039..4507143,
FT                   4508678..4508806,4510450..4510581,4512769..4512813,
FT                   4512901..4513070,4515809..4515895,4517651..4517736,
FT                   4518381..4518476,4523915..4523967,4524065..4524094,
FT                   4524204..4524293,4525067..4525111,4549612..4549680))
FT                   /codon_start=1
FT                   /gene="Kpna4"
FT                   /locus_tag="mCG_4359"
FT                   /product="karyopherin (importin) alpha 4"
FT                   /note="gene_id=mCG4359.2 transcript_id=mCT3111.2
FT                   protein_id=mCP18393.1"
FT                   /db_xref="GOA:Q4FJX1"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="InterPro:IPR032413"
FT                   /db_xref="MGI:MGI:1100848"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJX1"
FT                   /protein_id="EDL15498.1"
FT                   /translation="MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHL
FT                   LKRRNVPQEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRN
FT                   PPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFL
FT                   RLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTW
FT                   VMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVI
FT                   DSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKE
FT                   KINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISG
FT                   RKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDQAETIANLIEECGG
FT                   LEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPESVQGGTFGFNSSTNVPTE
FT                   GFQF"
FT   assembly_gap    4500034..4500053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4559808..4560066
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    4567608..4567627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4576308..4576512
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    4579995..4584981
FT                   /estimated_length=4987
FT                   /gap_type="unknown"
FT   assembly_gap    4592048..4592099
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    4602175..4602194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4606274..4606471
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    4627034..4627247
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    4630411..4630430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4640218..4641404
FT                   /estimated_length=1187
FT                   /gap_type="unknown"
FT   assembly_gap    4643541..4643560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4644837..4654616
FT                   /estimated_length=9780
FT                   /gap_type="unknown"
FT   assembly_gap    4660338..4660392
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    4661224..4661252
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    4676902..4676946
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    4677838..4677869
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4706520..4706866
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    4709538..4709557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4732252..4732271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4733828..4733847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4767955..4768801
FT                   /estimated_length=847
FT                   /gap_type="unknown"
FT   assembly_gap    4769848..4770088
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    4775489..4776041
FT                   /estimated_length=553
FT                   /gap_type="unknown"
FT   assembly_gap    4815556..4815575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4821817..4822166
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    4848582..4848601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(4854498..4855861)
FT                   /pseudo
FT                   /locus_tag="mCG_1032236"
FT                   /note="gene_id=mCG1032236.1"
FT   mRNA            complement(4854498..4855861)
FT                   /pseudo
FT                   /locus_tag="mCG_1032236"
FT                   /note="gene_id=mCG1032236.1 transcript_id=mCT149940.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    4902825..4902892
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            4921238..4979458
FT                   /gene="Ppm1l"
FT                   /locus_tag="mCG_4352"
FT                   /note="gene_id=mCG4352.1"
FT   mRNA            join(4921238..4921414,4973414..4973575,4976890..4978088,
FT                   4978440..4979458)
FT                   /gene="Ppm1l"
FT                   /locus_tag="mCG_4352"
FT                   /product="protein phosphatase 1 (formerly 2C)-like"
FT                   /note="gene_id=mCG4352.1 transcript_id=mCT3121.1 created on
FT                   18-NOV-2002"
FT   CDS             join(4921378..4921414,4973414..4973575,4976890..4977236)
FT                   /codon_start=1
FT                   /gene="Ppm1l"
FT                   /locus_tag="mCG_4352"
FT                   /product="protein phosphatase 1 (formerly 2C)-like"
FT                   /note="gene_id=mCG4352.1 transcript_id=mCT3121.1
FT                   protein_id=mCP18375.2"
FT                   /protein_id="EDL15497.1"
FT                   /translation="MLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNA
FT                   IPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPD
FT                   ILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPD
FT                   NITVMVVKFRNSSKTEEH"
FT   assembly_gap    4921423..4921486
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    4930617..4930636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4935762..4935789
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    4938862..4938881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4957500..4957631
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    4961241..4961320
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    4987543..4987703
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   gene            complement(4990544..4991638)
FT                   /pseudo
FT                   /locus_tag="mCG_4354"
FT                   /note="gene_id=mCG4354.2"
FT   mRNA            complement(4990544..4991638)
FT                   /pseudo
FT                   /locus_tag="mCG_4354"
FT                   /note="gene_id=mCG4354.2 transcript_id=mCT3116.2 created on
FT                   26-JUN-2003"
FT   assembly_gap    4992650..4992669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<4998019..5019393)
FT                   /gene="B3galnt1"
FT                   /locus_tag="mCG_4357"
FT                   /note="gene_id=mCG4357.1"
FT   mRNA            complement(join(<4998019..4999048,5002427..5002492,
FT                   5019220..5019393))
FT                   /gene="B3galnt1"
FT                   /locus_tag="mCG_4357"
FT                   /product="UDP-GalNAc:betaGlcNAc beta
FT                   1,3-galactosaminyltransferase, polypeptide 1"
FT                   /note="gene_id=mCG4357.1 transcript_id=mCT3114.1 created on
FT                   30-AUG-2002"
FT   CDS             complement(4998019..4999014)
FT                   /codon_start=1
FT                   /gene="B3galnt1"
FT                   /locus_tag="mCG_4357"
FT                   /product="UDP-GalNAc:betaGlcNAc beta
FT                   1,3-galactosaminyltransferase, polypeptide 1"
FT                   /note="gene_id=mCG4357.1 transcript_id=mCT3114.1
FT                   protein_id=mCP18392.0"
FT                   /protein_id="EDL15496.1"
FT                   /translation="MAPAVLTALPNRMSLRSLKWSLLLLSLLSFLVIWYLSLPHYNVIE
FT                   RVNWMYFYEYEPIYRQDFRFTLREHSNCSHQNPFLVILVTSRPSDVKARQAIRVTWGEK
FT                   KSWWGYEVLTFFLLGQQAEREDKTLALSLEDEHVLYGDIIRQDFLDTYNNLTLKTIMAF
FT                   RWVMEFCPNAKYIMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFFHKN
FT                   HISYQEYPFKVFPPYCSGLGYIMSGDLVPRVYEMMSHVKPIKFEDVYVGICLNLLKVDI
FT                   HIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY"
FT   assembly_gap    5019781..5019800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5023970..5024221
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    5031094..5031409
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    5043023..5043042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5070719..5070752
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    5085642..5086624
FT                   /estimated_length=983
FT                   /gap_type="unknown"
FT   assembly_gap    5087839..5087858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(5092458..5092984)
FT                   /locus_tag="mCG_4355"
FT                   /note="gene_id=mCG4355.0"
FT   mRNA            complement(5092458..5092984)
FT                   /locus_tag="mCG_4355"
FT                   /product="mCG4355"
FT                   /note="gene_id=mCG4355.0 transcript_id=mCT3112.0 created on
FT                   18-NOV-2002"
FT   CDS             complement(5092473..5092901)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4355"
FT                   /product="mCG4355"
FT                   /note="gene_id=mCG4355.0 transcript_id=mCT3112.0
FT                   protein_id=mCP18391.1"
FT                   /protein_id="EDL15495.1"
FT                   /translation="MGGGEIAFAITAIKGVGRSYAPVVLGKADIDLTKRAGEPTEDEVE
FT                   RVITIMQNPRQYKIPDWFLTRQKDVKDGKCSQVLANGLDNKLRDDLERLKKIRAHRGLR
FT                   YFWGPLCPRSAHQDHWPQGPCCGGIQEEMSLWAFAVNK"
FT   assembly_gap    5114625..5114726
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    5131502..5131521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5132597..5132616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5134106..5134125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            5147051..5173659
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /note="gene_id=mCG4358.2"
FT   mRNA            join(5147051..5147118,5147405..5147462,5149254..5149388,
FT                   5151358..5151454,5154336..5154416,5155403..5155531,
FT                   5156560..5156650,5160041..5160119,5160988..5161084,
FT                   5164918..5165035,5166506..5166651,5168512..5168624,
FT                   5170194..5170266,5171705..5171811,5172909..5172979,
FT                   5173383..5173655)
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /product="NMD3 homolog (S. cerevisiae), transcript variant
FT                   mCT181554"
FT                   /note="gene_id=mCG4358.2 transcript_id=mCT181554.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(<5147251..5147462,5149254..5149388,5151358..5151454,
FT                   5154336..5154416,5155403..5155531,5156560..5156650,
FT                   5160041..5160119,5160988..5161084,5164918..5165035,
FT                   5166506..5166651,5168512..5168624,5170194..5170266,
FT                   5171705..5171811,5172909..5172979,5173383..5173659)
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /product="NMD3 homolog (S. cerevisiae), transcript variant
FT                   mCT3115"
FT                   /note="gene_id=mCG4358.2 transcript_id=mCT3115.2 created on
FT                   26-MAR-2003"
FT   CDS             join(5147251..5147462,5149254..5149388,5151358..5151454,
FT                   5154336..5154416,5155403..5155531,5156560..5156650,
FT                   5160041..5160119,5160988..5161084,5164918..5165035,
FT                   5166506..5166651,5168512..5168624,5170194..5170266,
FT                   5171705..5171811,5172909..5172979,5173383..5173513)
FT                   /codon_start=1
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /product="NMD3 homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG4358.2 transcript_id=mCT3115.2
FT                   protein_id=mCP18397.2 isoform=CRA_b"
FT                   /protein_id="EDL15494.1"
FT                   /translation="MRSRGAEEGGRAVLGGGSRPPGLCAARMAVPELRRLDLMDPSLTG
FT                   PSLPLIGRARTMEYMAESIEHSPGHILCCECGVPISPNPANICVACLRSKVDISQGVPK
FT                   QVSISFCKQCQRYFQPPASWVQCALESRELLALCLKKIKAPLSKVRLVDAGFVWTEPHS
FT                   KRLKVKLTIQKEVMNGAILQQVFVVDYVVQSQMCGDCHRVEAKDFWKAVIQVRQKTLHK
FT                   KTFYYLEQLILKYGMHQNTLRIKEIHDGLDFYYSSKQHAQKMVEFLQGIVPCRYKASQR
FT                   LISQDIHSNTYNYKSTFSVEIVPICKDNVVCLSPKLAQSLGNMSQICICIRVTSAIHLI
FT                   DPNTLQVADIDGNTFWSHPFNSLCHPKQLEEFIVIECSTVRDLKRSAGAGVISKKHTLG
FT                   EVWIQKTSEMNTDKQYFCRTHLGHLLNPGDLVLGFDLANCNLNDEYVNKMNSDRVPDVV
FT                   LIKKSYDRTKRQRRRNWKLKELARDRENMDTDDERQYQDFLEDLEEDEAIRKHVNIYRD
FT                   ATIPVESDTDDEGAPRISLAEMLEDLHISQDATGEEGASMMS"
FT   CDS             join(5147419..5147462,5149254..5149388,5151358..5151454,
FT                   5154336..5154416,5155403..5155531,5156560..5156650,
FT                   5160041..5160119,5160988..5161084,5164918..5165035,
FT                   5166506..5166651,5168512..5168624,5170194..5170266,
FT                   5171705..5171811,5172909..5172979,5173383..5173513)
FT                   /codon_start=1
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /product="NMD3 homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG4358.2 transcript_id=mCT181554.0
FT                   protein_id=mCP104476.0 isoform=CRA_a"
FT                   /protein_id="EDL15493.1"
FT                   /translation="MEYMAESIEHSPGHILCCECGVPISPNPANICVACLRSKVDISQG
FT                   VPKQVSISFCKQCQRYFQPPASWVQCALESRELLALCLKKIKAPLSKVRLVDAGFVWTE
FT                   PHSKRLKVKLTIQKEVMNGAILQQVFVVDYVVQSQMCGDCHRVEAKDFWKAVIQVRQKT
FT                   LHKKTFYYLEQLILKYGMHQNTLRIKEIHDGLDFYYSSKQHAQKMVEFLQGIVPCRYKA
FT                   SQRLISQDIHSNTYNYKSTFSVEIVPICKDNVVCLSPKLAQSLGNMSQICICIRVTSAI
FT                   HLIDPNTLQVADIDGNTFWSHPFNSLCHPKQLEEFIVIECSTVRDLKRSAGAGVISKKH
FT                   TLGEVWIQKTSEMNTDKQYFCRTHLGHLLNPGDLVLGFDLANCNLNDEYVNKMNSDRVP
FT                   DVVLIKKSYDRTKRQRRRNWKLKELARDRENMDTDDERQYQDFLEDLEEDEAIRKHVNI
FT                   YRDATIPVESDTDDEGAPRISLAEMLEDLHISQDATGEEGASMMS"
FT   assembly_gap    5184223..5184304
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    5203452..5203515
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    5220005..5220266
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   gene            complement(5243841..>5277493)
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /note="gene_id=mCG67056.2"
FT   mRNA            complement(join(5243841..5245425,5262726..5262820,
FT                   5277429..>5277493))
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /product="RIKEN cDNA 1110032A04, transcript variant
FT                   mCT190984"
FT                   /note="gene_id=mCG67056.2 transcript_id=mCT190984.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(5243841..5245425,5262726..5262820,
FT                   5277017..5277047,5277429..>5277493))
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /product="RIKEN cDNA 1110032A04, transcript variant
FT                   mCT67239"
FT                   /note="gene_id=mCG67056.2 transcript_id=mCT67239.2 created
FT                   on 28-MAR-2003"
FT   CDS             complement(join(5245185..5245425,5262726..>5262808))
FT                   /codon_start=1
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /product="RIKEN cDNA 1110032A04, isoform CRA_a"
FT                   /note="gene_id=mCG67056.2 transcript_id=mCT190984.0
FT                   protein_id=mCP111952.0 isoform=CRA_a"
FT                   /protein_id="EDL15491.1"
FT                   /translation="SPERRNNLHQIVQRKSITEYQAWILLHRQTFPSLRKSHGFQAREG
FT                   VFCLALLSIPDHHLLCCHGALGTIDAQHHHTDHCGYGGIHCLCLHPHPHPPGLGIFLQN
FT                   MWL"
FT   CDS             complement(join(5245185..5245425,5262726..>5262808))
FT                   /codon_start=1
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /product="RIKEN cDNA 1110032A04, isoform CRA_a"
FT                   /note="gene_id=mCG67056.2 transcript_id=mCT67239.2
FT                   protein_id=mCP39037.2 isoform=CRA_a"
FT                   /protein_id="EDL15492.1"
FT                   /translation="SPERRNNLHQIVQRKSITEYQAWILLHRQTFPSLRKSHGFQAREG
FT                   VFCLALLSIPDHHLLCCHGALGTIDAQHHHTDHCGYGGIHCLCLHPHPHPPGLGIFLQN
FT                   MWL"
FT   assembly_gap    5255828..5255847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5259995..5260397
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    5263765..5263784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5271599..5271618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5275180..5275258
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    5313599..5313821
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    5326173..5326264
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    5329128..5329147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5334457..5334476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5335632..5336038
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    5337792..5337976
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    5339223..5339450
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    5348953..5349200
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    5357014..5357580
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    5359195..5359214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5360703..5360722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5362102..5363019
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    5365533..5365605
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    5367211..5367486
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    5368773..5373028
FT                   /estimated_length=4256
FT                   /gap_type="unknown"
FT   gene            complement(5377694..5378554)
FT                   /pseudo
FT                   /locus_tag="mCG_1032233"
FT                   /note="gene_id=mCG1032233.1"
FT   mRNA            complement(5377694..5378554)
FT                   /pseudo
FT                   /locus_tag="mCG_1032233"
FT                   /note="gene_id=mCG1032233.1 transcript_id=mCT149937.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    5379496..5379624
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    5382373..5383699
FT                   /estimated_length=1327
FT                   /gap_type="unknown"
FT   assembly_gap    5394926..5394945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5417976..5417995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5419094..5419113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5422450..5422469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5423721..5423740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <5445181..>5450086
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /note="gene_id=mCG61659.2"
FT   mRNA            join(<5445181..5445271,5449202..>5450067)
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /product="gene model 414, (NCBI), transcript variant
FT                   mCT181558"
FT                   /note="gene_id=mCG61659.2 transcript_id=mCT181558.0 created
FT                   on 28-MAR-2003"
FT   CDS             join(<5445181..5445271,5449202..>5450067)
FT                   /codon_start=1
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /product="gene model 414, (NCBI), isoform CRA_a"
FT                   /note="gene_id=mCG61659.2 transcript_id=mCT181558.0
FT                   protein_id=mCP104480.0 isoform=CRA_a"
FT                   /protein_id="EDL15489.1"
FT                   /translation="GPKGETGDTGSPGHPGTTGPQGPKGQKGEKGALGPKGDKGTIGPA
FT                   GTKGQKGSKGELCGNGTKGEKGDPGASGAHGFIGEPGAKGEKGGVGEKGYRGDLGERGE
FT                   KGQKGEKGMEGEKGSRGDVGSEGKRGSDGLPGLRGDSGPKGEKGEIGSPGFTGPAGPKG
FT                   ELGSKGVRGPTGKKGSRGVKGSKGEATQVPQSAFSALLSKPFPPPNVPIKFDKILSNDQ
FT                   GDYSPVTGKFNCSVPGTYIFSYHVTVRGRPARISLVARNRKQFKSRETLYGQQVDQASL
FT                   LLILKLSAGDQVWLEVSKDWNGLYVGPEDDSIFSGFLL"
FT   mRNA            join(<5445182..5445271,5448550..5448621,5449202..>5450086)
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /product="gene model 414, (NCBI), transcript variant
FT                   mCT61842"
FT                   /note="gene_id=mCG61659.2 transcript_id=mCT61842.1 created
FT                   on 28-MAR-2003"
FT   CDS             join(<5445184..5445271,5448550..5448621,5449202..>5450086)
FT                   /codon_start=1
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /product="gene model 414, (NCBI), isoform CRA_b"
FT                   /note="gene_id=mCG61659.2 transcript_id=mCT61842.1
FT                   protein_id=mCP31451.1 isoform=CRA_b"
FT                   /protein_id="EDL15490.1"
FT                   /translation="PKGETGDTGSPGHPGTTGPQGPKGQKGEKGLKGDRGDQGAGGIPG
FT                   YPGKPGEQGALGPKGDKGTIGPAGTKGQKGSKGELCGNGTKGEKGDPGASGAHGFIGEP
FT                   GAKGEKGGVGEKGYRGDLGERGEKGQKGEKGMEGEKGSRGDVGSEGKRGSDGLPGLRGD
FT                   SGPKGEKGEIGSPGFTGPAGPKGELGSKGVRGPTGKKGSRGVKGSKGEATQVPQSAFSA
FT                   LLSKPFPPPNVPIKFDKILSNDQGDYSPVTGKFNCSVPGTYIFSYHVTVRGRPARISLV
FT                   ARNRKQFKSRETLYGQQVDQASLLLILKLSAGDQVWLEVSKDWNGLYVGPEDDSIFSGF
FT                   LLYPEETF"
FT   assembly_gap    5465334..5465942
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    5468946..5472672
FT                   /estimated_length=3727
FT                   /gap_type="unknown"
FT   assembly_gap    5486045..5487104
FT                   /estimated_length=1060
FT                   /gap_type="unknown"
FT   assembly_gap    5490075..5490490
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    5496946..5496965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5509977..5510184
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    5513491..5513591
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5527341..5527729
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    5546639..5546739
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5568455..5568474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5570840..5570859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5585797..5585840
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    5587151..5587170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5591708..5591727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5592982..5593001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5594934..5595331
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    5596906..5596925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5627095..5627214
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    5631842..5632842
FT                   /estimated_length=1001
FT                   /gap_type="unknown"
FT   assembly_gap    5643400..5643419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5672038..5672462
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   assembly_gap    5700399..5700418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5703316..5703335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5734440..5735392
FT                   /estimated_length=953
FT                   /gap_type="unknown"
FT   assembly_gap    5747302..5747969
FT                   /estimated_length=668
FT                   /gap_type="unknown"
FT   assembly_gap    5757292..5757376
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    5775221..5776016
FT                   /estimated_length=796
FT                   /gap_type="unknown"
FT   assembly_gap    5790249..5790268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5811403..5811422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5832653..5832672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5839577..5840278
FT                   /estimated_length=702
FT                   /gap_type="unknown"
FT   assembly_gap    5866449..5866468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5874244..5874283
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5915772..5915791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5920681..5920700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5926495..5926651
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    5981897..5981916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6006636..6006944
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    6021836..6021864
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    6031171..6031329
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    6033176..6033324
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    6046794..6050452
FT                   /estimated_length=3659
FT                   /gap_type="unknown"
FT   assembly_gap    6070933..6071011
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    6109022..6109041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6113776..6113795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6138204..6138223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6140494..6140559
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    6142392..6143064
FT                   /estimated_length=673
FT                   /gap_type="unknown"
FT   assembly_gap    6144534..6144553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(6155837..6156963)
FT                   /locus_tag="mCG_19960"
FT                   /note="gene_id=mCG19960.0"
FT   mRNA            complement(6155837..6156963)
FT                   /locus_tag="mCG_19960"
FT                   /product="mCG19960"
FT                   /note="gene_id=mCG19960.0 transcript_id=mCT17852.0 created
FT                   on 18-NOV-2002"
FT   CDS             complement(6155931..6156914)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19960"
FT                   /product="mCG19960"
FT                   /note="gene_id=mCG19960.0 transcript_id=mCT17852.0
FT                   protein_id=mCP9312.1"
FT                   /protein_id="EDL15488.1"
FT                   /translation="MKPGFSPRGGGFGGRGGFGDRGGRGGGRGGRGGFGGGRGGFGGGG
FT                   RGRGGGGGGFRGRGGGGGRGGGFQSGGNRGRGGGRGGKRGNQSGKNVMVEPHRHEGVFI
FT                   CRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHI
FT                   KPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIED
FT                   ARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASA
FT                   EAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN"
FT   assembly_gap    6176081..6176100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6186327..6187255
FT                   /estimated_length=929
FT                   /gap_type="unknown"
FT   assembly_gap    6208080..6208099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6221594..6221613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6243329..6243348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6247579..6249628
FT                   /estimated_length=2050
FT                   /gap_type="unknown"
FT   assembly_gap    6251000..6251876
FT                   /estimated_length=877
FT                   /gap_type="unknown"
FT   assembly_gap    6279163..6279182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6330015..6330054
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    6333742..6334287
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    6417211..6417230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6418594..6418613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6421651..6421670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6425505..6425524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6456783..6456802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6466280..6466628
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    6480711..6480730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6483872..6483891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6485357..6485376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6486823..6487376
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    6488694..6489815
FT                   /estimated_length=1122
FT                   /gap_type="unknown"
FT   assembly_gap    6492006..6492025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6513473..6513492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6515841..6516368
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    6529235..6529254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6530834..6530853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6538057..6538076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6542591..6548177
FT                   /estimated_length=5587
FT                   /gap_type="unknown"
FT   assembly_gap    6550976..6550995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6555272..6559494
FT                   /estimated_length=4223
FT                   /gap_type="unknown"
FT   assembly_gap    6563448..6567456
FT                   /estimated_length=4009
FT                   /gap_type="unknown"
FT   assembly_gap    6572889..6572908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6574237..6574256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6578910..6579162
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    6580355..6580374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6582691..6590544
FT                   /estimated_length=7854
FT                   /gap_type="unknown"
FT   assembly_gap    6591744..6599804
FT                   /estimated_length=8061
FT                   /gap_type="unknown"
FT   assembly_gap    6601674..6601693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6603029..6610461
FT                   /estimated_length=7433
FT                   /gap_type="unknown"
FT   assembly_gap    6612506..6612525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6620973..6624628
FT                   /estimated_length=3656
FT                   /gap_type="unknown"
FT   assembly_gap    6626681..6626700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6644225..6644244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6645924..6646285
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    6647580..6647599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6648984..6649003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6682397..6682487
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    6684651..6684670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6703942..6703961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6708879..6708898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6736826..6737395
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    6741678..6741844
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    6743268..6743287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6749958..6749977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6762929..6763258
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    6767412..6768672
FT                   /estimated_length=1261
FT                   /gap_type="unknown"
FT   assembly_gap    6838452..6838490
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   gene            complement(6846984..6847431)
FT                   /pseudo
FT                   /locus_tag="mCG_1032301"
FT                   /note="gene_id=mCG1032301.1"
FT   mRNA            complement(6846984..6847431)
FT                   /pseudo
FT                   /locus_tag="mCG_1032301"
FT                   /note="gene_id=mCG1032301.1 transcript_id=mCT150005.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    6857029..6857048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6865449..6865468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6872855..6872947
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    6880092..6882710
FT                   /estimated_length=2619
FT                   /gap_type="unknown"
FT   assembly_gap    6884017..6884164
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    6895832..6896679
FT                   /estimated_length=848
FT                   /gap_type="unknown"
FT   assembly_gap    6897430..6897580
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    6910446..6910465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6915383..6915751
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    6932370..6935189
FT                   /estimated_length=2820
FT                   /gap_type="unknown"
FT   assembly_gap    6942725..6942744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6943839..6943858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6945200..6950190
FT                   /estimated_length=4991
FT                   /gap_type="unknown"
FT   assembly_gap    6954326..6954345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6975730..6976331
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    6978124..6978143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6995060..6995079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6997091..6997415
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    7016325..7016344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7027994..7028013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7086469..7086512
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    7105983..7106002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7139527..7139546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7160890..7161149
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    7182553..7182631
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    7221816..7221835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7223453..7223575
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    7232197..7232304
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    7253218..7253237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7282107..7282126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7292796..7292815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7293882..7293901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7294988..7295007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7296013..7296032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7298072..7298363
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    7302824..7302843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7308087..7308106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7312542..7312561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7370743..7370801
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    7381657..7381894
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    7383300..7383319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7385088..7385107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7386145..7386164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7411990..7412009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7457552..7457571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7466908..7470149
FT                   /estimated_length=3242
FT                   /gap_type="unknown"
FT   assembly_gap    7471418..7471437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7472615..7472634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7482551..7482787
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    7493840..7493869
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7502734..7502753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7529322..7529341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7537850..7538114
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    7549548..7549567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7593453..7594568
FT                   /estimated_length=1116
FT                   /gap_type="unknown"
FT   assembly_gap    7607050..7607336
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    7616471..7616552
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    7648092..7648111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7660048..7660067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7661237..7661256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7715227..7720213
FT                   /estimated_length=4987
FT                   /gap_type="unknown"
FT   assembly_gap    7802213..7802309
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    7805385..7805404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7853686..7854838
FT                   /estimated_length=1153
FT                   /gap_type="unknown"
FT   assembly_gap    7864377..7864396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7883036..7883117
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    7884957..7884976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7904729..7904748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7909802..7909823
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    7942712..7942984
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    7969290..7969309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7986998..7987017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8064741..8064760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8084406..8084425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8088493..8089570
FT                   /estimated_length=1078
FT                   /gap_type="unknown"
FT   assembly_gap    8092847..8093240
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    8132561..8133008
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    8137030..8137049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8192869..8192888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8201423..8201442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8217607..8217626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8222992..8223050
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    8224994..8225013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8247802..8247821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8270214..8270233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8278980..8279617
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    8280754..8280773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8303520..8303539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8328807..>8403182)
FT                   /locus_tag="mCG_120052"
FT                   /note="gene_id=mCG120052.1"
FT   mRNA            complement(join(8328807..8329305,8332273..8332440,
FT                   8332645..8332694,8334807..8334895,8337956..8338080,
FT                   8338627..8338683,8338766..8338850,8341435..8341583,
FT                   8343258..8343374,8343459..8343493,8346249..8346382,
FT                   8347726..8347864,8349073..8349160,8350458..8350574,
FT                   8351832..8351894,8353196..8353306,8354174..8354302,
FT                   8355604..8355729,8355817..8355929,8356034..8356130,
FT                   8357503..8357671,8359630..8359784,8361656..8361862,
FT                   8364426..8364584,8364812..8364982,8365645..8365694,
FT                   8368321..8368397,8370347..8370471,8372122..8372178,
FT                   8373449..8373533,8374860..8375014,8377227..8377343,
FT                   8379808..8379979,8381414..8381531,8382877..8382961,
FT                   8383726..8383839,8385823..8385942,8386030..8386161,
FT                   8387875..8388000,8388725..8388837,8389410..8389509,
FT                   8392447..8392618,8394429..8394580,8396574..8396683,
FT                   8397329..8397446,8401895..8402001,8403065..>8403182))
FT                   /locus_tag="mCG_120052"
FT                   /product="mCG120052"
FT                   /note="gene_id=mCG120052.1 transcript_id=mCT121233.1
FT                   created on 15-NOV-2002"
FT   CDS             complement(join(8329237..8329305,8332273..8332440,
FT                   8332645..8332694,8334807..8334895,8337956..8338080,
FT                   8338627..8338683,8338766..8338850,8341435..8341583,
FT                   8343258..8343374,8343459..8343493,8346249..8346382,
FT                   8347726..8347864,8349073..8349160,8350458..8350574,
FT                   8351832..8351894,8353196..8353306,8354174..8354302,
FT                   8355604..8355729,8355817..8355929,8356034..8356130,
FT                   8357503..8357671,8359630..8359784,8361656..8361862,
FT                   8364426..8364584,8364812..8364982,8365645..8365694,
FT                   8368321..8368397,8370347..8370471,8372122..8372178,
FT                   8373449..8373533,8374860..8375014,8377227..8377343,
FT                   8379808..8379979,8381414..8381531,8382877..8382961,
FT                   8383726..8383839,8385823..8385942,8386030..8386161,
FT                   8387875..8388000,8388725..8388837,8389410..8389509,
FT                   8392447..8392618,8394429..8394580,8396574..8396683,
FT                   8397329..8397446,8401895..8402001,8403065..8403182))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120052"
FT                   /product="mCG120052"
FT                   /note="gene_id=mCG120052.1 transcript_id=mCT121233.1
FT                   protein_id=mCP65947.1"
FT                   /protein_id="EDL15487.1"
FT                   /translation="MAKKKFSGLEISLIVLFIIVTIIAIALVVVLATKVPAVEEVKSPT
FT                   STPSPGRCPPEQGEPLNERINCIPEQHPTKAKCEERGCCWRPWNNTIIPWCFFADNHGY
FT                   TAASVTNDNSGLKATLSRIPSPTLFGEDIKSVLLTTQSQTRNRFRFKLTDPNNKRYEVP
FT                   HQFVKDGNGIPAADTLYDVKVSENPFSIKVIRKSNNKVLFDTSIGPLVYSNQYLQISTR
FT                   LPSEYIYGFGEHIHKRFRHDLYWKTWPIFTRDEIPGDNNHNLYGHQTFFMGIEDNSGKS
FT                   YGVFLMNSNAMEVFIQPTPIITYRVTGGVLDFYIFLGDTPEQVVQQYQELIGRPAMPAY
FT                   WNLGFQLSRWNYVSLDKVKEVVRRNREAGIPYDAQVTDIDYMEDKKDFTYDEVAFKGLP
FT                   EFAQDLHNHGQKYIIILDPAISINKRANGAEYQTYVRGNEQNVWVKESDGTTSLIGEVW
FT                   PGLTVYPDFTNPRTWEWWANECNLFHQQVEYDGLWIDMNEVSSFIHGSQKGCAPNLLNY
FT                   PPFTPGILDKIMYSKTLCMDAVQHWGNQYDVHSLYGYSMAIATEKAVEKVFPNKRSFIL
FT                   TRSTFAGSGHHAAHWLGDNTASWEQMEWSITGMLEFGMFGMPLVGADICGFLANTTEEL
FT                   CRRWMQLGAFYPFSRNHNAEGYAEQDPAFWGADSLLVNTSRHYLTIRYTLLPFLYTLFY
FT                   RAHAFGETVARPFLHEFYEDPNSWIEDTQFLWGPALLITPVLRPETKYVSAYIPDATWY
FT                   DYETGEKRPWRKQRVDMYLPEDKIGLHLRGGYIIPTQQPDVTTTASRKNPLGLIVALDE
FT                   NQAAKGELFWDDDTIEKKIYILYEFSVSNNNLIVNCTHSSYPEGNTLVFKTIKVLGLSA
FT                   TVTAVTVGENDQQMNPHLAFTFDAFNKILSITDLTFNLGKTFIVRWTTQSFSDNEKFTC
FT                   YPDVGTATEKTCVERGCIWEPVSGLANVPPCYFPSNHNPYLLTSTQKLATGITAELQLN
FT                   PASARIKLPSNPISTLRVEVKYHKNDMLQFKIYDAHHKRYEVPVPLNIPDTPTSSEENR
FT                   LYDVEIKENPFGIQVRRRSTGKLIWDSCLPGFAFNDQFIQISTRLPSQYLYGFGEAEHT
FT                   AFKRNLNWHTWGMFTRDQPPGYKLNSYGFHPYYMALEDEGNAHGVLLQNSNGMDVTFQP
FT                   TPALTYRTIGGILDFYMFLGPTPEGATKQYHEVIGFPVMPPYWALGFQLCRYGYRNTSE
FT                   IEQLYNDMKAAQIPYDVQYTDINYMERQLDFTIGERFKTLPQFVEKIRKEGMKYIVILD
FT                   PAISGNETQPYPAFERGIQKDVFVKWPNTNDICWAKVWPDLPNITIDETITEDEAVNAS
FT                   RAHVAFPDFFRNSTSEWWTREIYDFYNEKMKFDGLWIDMNEPSSFVNGTVTNKCRNDTL
FT                   NYPPYFPELTKRNEGLHFRTMCMETEHILSDGSSVLHYDVHNLYGWSQVKPTLDALRNT
FT                   TGLRGIVISRSTYPTAGRWGGHWLGDNYANWENLEKSLIGMLEFNLFGIPYVGADICGF
FT                   FNDSEYHLCARWMQVGAFYPYSRNHNIQFTRRQDPVSWNETFAQMSKKVLEIRYTLLPY
FT                   FYTQMHEAHIHGGTVIRPLMHEFFDDKETWEIYKQFLWGPAFMVTPVIGPFQTAVNGYV
FT                   PKARWFDYHTGEDIKVRGKLQTFSAPFDTINLHVRGGYILPCQEPAQNTYYSRQNYMKL
FT                   IVAADDNQTAKGSLFWDDGESIDTYEKNQYTLIEFNLNQKNLTSTVLKDGYRNKSEMKL
FT                   GSIYVWGKGTTSISQVNLTYGGNEQQLSFTQDEAKEILTIDLKNVTVTLDEPIQISWS"
FT   assembly_gap    8330008..8330027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8334106..8334125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8344806..8345932
FT                   /estimated_length=1127
FT                   /gap_type="unknown"
FT   assembly_gap    8412223..8412242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8438025..8438044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8442529..8442548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8445634..8445653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8447697..8450479
FT                   /estimated_length=2783
FT                   /gap_type="unknown"
FT   assembly_gap    8451963..8454524
FT                   /estimated_length=2562
FT                   /gap_type="unknown"
FT   assembly_gap    8473412..8473431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(8477810..8486179)
FT                   /gene="Slitrk3"
FT                   /locus_tag="mCG_52101"
FT                   /note="gene_id=mCG52101.1"
FT   mRNA            complement(join(8477810..8480812,8485862..8486179))
FT                   /gene="Slitrk3"
FT                   /locus_tag="mCG_52101"
FT                   /product="SLIT and NTRK-like family, member 3"
FT                   /note="gene_id=mCG52101.1 transcript_id=mCT52284.1 created
FT                   on 15-NOV-2002"
FT   CDS             complement(8477852..8480794)
FT                   /codon_start=1
FT                   /gene="Slitrk3"
FT                   /locus_tag="mCG_52101"
FT                   /product="SLIT and NTRK-like family, member 3"
FT                   /note="gene_id=mCG52101.1 transcript_id=mCT52284.1
FT                   protein_id=mCP38006.2"
FT                   /db_xref="GOA:Q810B9"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:2679447"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810B9"
FT                   /protein_id="EDL15486.1"
FT                   /translation="MMKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPC
FT                   FDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRRLYTNSFLHLNNA
FT                   VSINLGNNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIK
FT                   RIESGAFRNLSKLRVLILNDNLIPVLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIG
FT                   RSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIKKTEL
FT                   CPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQP
FT                   RTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFN
FT                   NISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPN
FT                   LKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLL
FT                   RTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEHLNAIVQIDLNENPWDCTCDLVPFKQ
FT                   WIETISSVSVVGDVLCRTPENLTHRDVRTIELEVLCPEMLHIAQPGPSPPQPGDYHPNG
FT                   GPTSASPYEFSPPGGPVPLSVLILSLLVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQ
FT                   EGVDLTGIQMQCHRLFEDSGGNSGGSGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCN
FT                   NPIYKPREEEEVAASAAQDTGATDRGGPGTQPTGMAEVLLGSEQFAETPKENHSNYRTL
FT                   LEKEKEWALAVSNSQLNTIVTVNHHHPHPHHSAVGGVSGVGGGTGGDLAGFRHHEKNGG
FT                   VVLFPPGGGCGGGSLLLDRERPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQ
FT                   DARLKETLLFSAGKGFTDHQTPKSDYLDLRAKLQTKPDYLEVLEKTAYRF"
FT   assembly_gap    8481588..8481607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8483879..8484433
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    8486427..8486641
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   gene            <8495715..9016664
FT                   /locus_tag="mCG_145240"
FT                   /note="gene_id=mCG145240.0"
FT   mRNA            join(<8495715..8495947,8668874..8668987,8981440..8981517,
FT                   8986705..8987149,9016177..9016664)
FT                   /locus_tag="mCG_145240"
FT                   /product="mCG145240"
FT                   /note="gene_id=mCG145240.0 transcript_id=mCT184664.0
FT                   created on 05-JUN-2003"
FT   assembly_gap    8499762..8499803
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    8548831..8549175
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    8551584..8551603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8581456..8581587
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    8583983..8584111
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    8617360..8617379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8680247..8680266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8694532..8694551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8724819..8725063
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    8725953..8726156
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    8728901..8729134
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    8734134..8734153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8735395..8735414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8736430..8736449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8739663..8739682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            8750098..8891198
FT                   /locus_tag="mCG_1050990"
FT                   /note="gene_id=mCG1050990.0"
FT   mRNA            join(8750098..8750178,8752313..8752383,8753662..8753761,
FT                   8759607..8759720,8890946..8891198)
FT                   /locus_tag="mCG_1050990"
FT                   /product="mCG1050990"
FT                   /note="gene_id=mCG1050990.0 transcript_id=mCT194779.0
FT                   created on 27-JAN-2005"
FT   CDS             join(8752358..8752383,8753662..8753761,8759607..8759612)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050990"
FT                   /product="mCG1050990"
FT                   /note="gene_id=mCG1050990.0 transcript_id=mCT194779.0
FT                   protein_id=mCP115808.0"
FT                   /protein_id="EDL15485.1"
FT                   /translation="MAERNAKTGCPKLKDFQKFKRNFGFLKRHDFIKETTFNVFELK"
FT   assembly_gap    8755494..8755979
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   gene            complement(8771782..>8902919)
FT                   /locus_tag="mCG_1032438"
FT                   /note="gene_id=mCG1032438.0"
FT   mRNA            complement(join(8771782..8772402,8780565..8780706,
FT                   8782548..8782728,8783757..8783874,8812668..8812855,
FT                   8813735..8813833,8899548..8899612,8902776..>8902919))
FT                   /locus_tag="mCG_1032438"
FT                   /product="mCG1032438"
FT                   /note="gene_id=mCG1032438.0 transcript_id=mCT150142.0
FT                   created on 27-MAR-2003"
FT   CDS             complement(join(8772184..8772402,8780565..>8780576))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032438"
FT                   /product="mCG1032438"
FT                   /note="gene_id=mCG1032438.0 transcript_id=mCT150142.0
FT                   protein_id=mCP65445.0"
FT                   /protein_id="EDL15484.1"
FT                   /translation="VCTKAATRKFEPNVRKIFPPQVSNQEKSSHIYTATWLWLFPGVVK
FT                   LTSKNGHHDFHYYGSQKSLRPVVSKHEFHKW"
FT   assembly_gap    8786419..8786749
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    8800736..8802652
FT                   /estimated_length=1917
FT                   /gap_type="unknown"
FT   assembly_gap    8808876..8809114
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    8817057..8817076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8823017..8823036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8826389..8827033
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    8841596..8841615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8853792..8854128
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    8855022..8857205
FT                   /estimated_length=2184
FT                   /gap_type="unknown"
FT   assembly_gap    8873617..8874172
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    8877077..8877359
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    8878942..8879458
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    8887379..8887398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8888507..8888526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8908390..8908409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8910515..8910534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8959972..8960242
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   CDS             join(<8987135..8987149,9016177..9016473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145240"
FT                   /product="mCG145240"
FT                   /note="gene_id=mCG145240.0 transcript_id=mCT184664.0
FT                   protein_id=mCP105807.0"
FT                   /protein_id="EDL15483.1"
FT                   /translation="DKCSQDLSPNIEKIGSQKDLDIPPPLPTALWLQHEAITGSLVLCH
FT                   EIQLSFSCLCTNPKSIIFPNGYFVFCICKYLFSFLNGVCRPISYFYSILSFRYDSFMF"
FT   assembly_gap    9013705..9013748
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    9025769..9032495
FT                   /estimated_length=6727
FT                   /gap_type="unknown"
FT   gene            complement(9068138..9127772)
FT                   /gene="Bche"
FT                   /locus_tag="mCG_9776"
FT                   /note="gene_id=mCG9776.2"
FT   mRNA            complement(join(9068138..9068567,9077163..9077329,
FT                   9126236..9127772))
FT                   /gene="Bche"
FT                   /locus_tag="mCG_9776"
FT                   /product="butyrylcholinesterase"
FT                   /note="gene_id=mCG9776.2 transcript_id=mCT9665.1 created on
FT                   30-AUG-2002"
FT   CDS             complement(join(9068443..9068567,9077163..9077329,
FT                   9126236..9127755))
FT                   /codon_start=1
FT                   /gene="Bche"
FT                   /locus_tag="mCG_9776"
FT                   /product="butyrylcholinesterase"
FT                   /note="gene_id=mCG9776.2 transcript_id=mCT9665.1
FT                   protein_id=mCP17190.1"
FT                   /db_xref="GOA:Q03311"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR014788"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:894278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03311"
FT                   /protein_id="EDL15482.1"
FT                   /translation="MQTQHTKVTQTHFLLWILLLCMPFGKSHTEEDFIITTKTGRVRGL
FT                   SMPVLGGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDIHNATQYANSCYQNIDQAFPG
FT                   FQGSEMWNPNTNLSEDCLYLNVWIPVPKPKNATVMVWIYGGGFQTGTSSLPVYDGKFLA
FT                   RVERVIVVSMNYRVGALGFLAFPGNPDAPGNMGLFDQQLALQWVQRNIAAFGGNPKSIT
FT                   IFGESAGAASVSLHLLCPQSYPLFTRAILESGSSNAPWAVKHPEEARNRTLTLAKFTGC
FT                   SKENEMEMIKCLRSKDPQEILRNERFVLPSDSILSINFGPTVDGDFLTDMPHTLLQLGK
FT                   VKKAQILVGVNKDEGTAFLVYGAPGFSKDNDSLITRKEFQEGLNMYFPGVSRLGKEAVL
FT                   FYYVDWLGEQSPEVYRDALDDVIGDYNIICPALEFTKKFAELENNAFFYFFEHRSSKLP
FT                   WPEWMGVMHGYEIEFVFGLPLGRRVNYTRAEEIFSRSIMKTWANFAKYGHPNGTQGNST
FT                   MWPVFTSTEQKYLTLNTEKSKIYSKLRAPQCQFWRLFFPKVLEMTGDIDETEQEWKAGF
FT                   HRWSNYMMDWQNQFNDYTSKKESCTAL"
FT   assembly_gap    9093231..9096473
FT                   /estimated_length=3243
FT                   /gap_type="unknown"
FT   assembly_gap    9139008..9139027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9160570..9160589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9180481..9180665
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    9199989..9200042
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    9218604..9218623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9223157..9223182
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    9267538..9267557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9271068..9271339
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    9279929..9287115
FT                   /estimated_length=7187
FT                   /gap_type="unknown"
FT   assembly_gap    9307815..9307834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9309913..9314477
FT                   /estimated_length=4565
FT                   /gap_type="unknown"
FT   assembly_gap    9356493..9356814
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    9363830..9363898
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    9393873..9395185
FT                   /estimated_length=1313
FT                   /gap_type="unknown"
FT   assembly_gap    9417713..9417732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9462089..9462490
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    9463691..9463710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9557834..9557853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9568533..9568552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9602581..9602678
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    9651313..9651758
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    9707908..9708024
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    9718998..9719017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9720441..9721664
FT                   /estimated_length=1224
FT                   /gap_type="unknown"
FT   assembly_gap    9741840..9743307
FT                   /estimated_length=1468
FT                   /gap_type="unknown"
FT   assembly_gap    9800081..9800100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9802871..9802890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9803945..9803964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9806748..9806767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9807854..9808610
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    9818864..9819292
FT                   /estimated_length=429
FT                   /gap_type="unknown"
FT   assembly_gap    9820376..9820395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9827656..9827751
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    9851526..9851563
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    9861712..9865280
FT                   /estimated_length=3569
FT                   /gap_type="unknown"
FT   assembly_gap    9870753..9870983
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    9877626..9878062
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    9881401..9885325
FT                   /estimated_length=3925
FT                   /gap_type="unknown"
FT   assembly_gap    9893831..9896032
FT                   /estimated_length=2202
FT                   /gap_type="unknown"
FT   assembly_gap    9910342..9910361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9915202..9915221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9937537..9937557
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    9941577..9941596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9952910..9952929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9955873..9957668
FT                   /estimated_length=1796
FT                   /gap_type="unknown"
FT   assembly_gap    9978658..9982947
FT                   /estimated_length=4290
FT                   /gap_type="unknown"
FT   assembly_gap    9987578..9987597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10000117..10000136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10011152..10011222
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    10019397..10019416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10079634..10079992
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT   assembly_gap    10123862..10123881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10141608..10142002
FT                   /estimated_length=395
FT                   /gap_type="unknown"
FT   assembly_gap    10148829..10149929
FT                   /estimated_length=1101
FT                   /gap_type="unknown"
FT   assembly_gap    10151102..10151267
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    10172355..10172479
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    10182376..10182395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10190273..10190292
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10195749..10196814
FT                   /estimated_length=1066
FT                   /gap_type="unknown"
FT   assembly_gap    10200105..10200315
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    10255993..10258977
FT                   /estimated_length=2985
FT                   /gap_type="unknown"
FT   assembly_gap    10263173..10263192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10264795..10270120
FT                   /estimated_length=5326
FT                   /gap_type="unknown"
FT   assembly_gap    10343590..10343637
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    10360260..10360279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10362042..10362375
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    10396974..10396993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10423296..10423315
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10428809..10534754)
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /note="gene_id=mCG21990.3"
FT   mRNA            complement(join(10428809..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10469466..10469755,10472807..10472946,10474697..10474776,
FT                   10476085..10476185,10476529..10476638,10484149..10484284,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..>10534702))
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, transcript variant
FT                   mCT190918"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT190918.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(10428810..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10476085..10476185,10476529..10476638,10484149..10484269,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..10534754))
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, transcript variant
FT                   mCT22292"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT22292.2 created
FT                   on 15-NOV-2002"
FT   mRNA            complement(join(10428818..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10469466..10469755,10472807..10472946,10474697..10474776,
FT                   10476085..10476185,10476529..10476638,10484149..10484269,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..>10534711))
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, transcript variant
FT                   mCT190917"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT190917.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(10428863..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10469466..10469755,10472807..10472946,10474697..10474776,
FT                   10476085..10476185,10476529..10476638,10484149..10484269,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..>10534590))
FT                   /codon_start=1
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, isoform CRA_a"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT190917.0
FT                   protein_id=mCP111899.0 isoform=CRA_a"
FT                   /protein_id="EDL15479.1"
FT                   /translation="RIFRAGCQLSAGKVKLKLLKEEIQVPAKQLSYKMAHSTGSENPKT
FT                   KRKVCGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIA
FT                   AHQFIKEENPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCKVMWEM
FT                   PFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPDSVEECEVQTNLKMWTEPINIEF
FT                   TEDSLSYMETLWLKKYRRTPQEQLRTMLPNTFTHPHQATAEAQCTQNENESDSDVEEIK
FT                   IKSPPLFMPVEKLNIERPPPSLTIVELDDTHGAEFEDPGIAVPYRVELADSESQLSSTF
FT                   TDYQTCFPCENEIHHHLIFNKGKADLLSLCLRTNSRYHKDDIKDFGNTVESCTYSDEFK
FT                   KIGETTSFEKNETEKNIDPQNNRDSVDSCMSLGSKGSLPTIDSSTSFIEENSSQDTNTS
FT                   LKCSNQNERSNLGNSKTAKEPLFQKVTIRKKLIKERYQGPKKFYSVDKNERLDVFPSSS
FT                   IKGSHSCSEITSTVSEDKMWIPLSSLSGYAGSADALCDQQSDENPLPNMQQQKSGQKSQ
FT                   RPSTANIPISNPDQKDTSCLLFSYTRSKSAAAQMPSRAASEISEIEYIDVTDQSELFGG
FT                   NTADRQALDTLEKELNILRKPADPSEDPHSLPSEELQAFNDNFLTLSQMSKDLLEMSRE
FT                   SDPHGAESSSSGRNPEIQPLLSLGDYSTDEEEDEFLDKQHVIKLPWEKRA"
FT   CDS             complement(join(10428863..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10469466..10469755,10472807..10472946,10474697..10474776,
FT                   10476085..10476185,10476529..10476638,10484149..10484284,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..>10534590))
FT                   /codon_start=1
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, isoform CRA_b"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT190918.0
FT                   protein_id=mCP111900.0 isoform=CRA_b"
FT                   /protein_id="EDL15480.1"
FT                   /translation="RIFRAGCQLSAGKVKLKLLKEEIQVPAKQLSYKMAHSTGSENPKT
FT                   KRKVCGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIA
FT                   AHQFIKEENPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCKVMWEM
FT                   PFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPVFIFLDSVEECEVQTNLKMWTEP
FT                   INIEFTEDSLSYMETLWLKKYRRTPQEQLRTMLPNTFTHPHQATAEAQCTQNENESDSD
FT                   VEEIKIKSPPLFMPVEKLNIERPPPSLTIVELDDTHGAEFEDPGIAVPYRVELADSESQ
FT                   LSSTFTDYQTCFPCENEIHHHLIFNKGKADLLSLCLRTNSRYHKDDIKDFGNTVESCTY
FT                   SDEFKKIGETTSFEKNETEKNIDPQNNRDSVDSCMSLGSKGSLPTIDSSTSFIEENSSQ
FT                   DTNTSLKCSNQNERSNLGNSKTAKEPLFQKVTIRKKLIKERYQGPKKFYSVDKNERLDV
FT                   FPSSSIKGSHSCSEITSTVSEDKMWIPLSSLSGYAGSADALCDQQSDENPLPNMQQQKS
FT                   GQKSQRPSTANIPISNPDQKDTSCLLFSYTRSKSAAAQMPSRAASEISEIEYIDVTDQS
FT                   ELFGGNTADRQALDTLEKELNILRKPADPSEDPHSLPSEELQAFNDNFLTLSQMSKDLL
FT                   EMSRESDPHGAESSSSGRNPEIQPLLSLGDYSTDEEEDEFLDKQHVIKLPWEKRA"
FT   CDS             complement(join(10428863..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10476085..10476185,10476529..10476638,10484149..10484269,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530589))
FT                   /codon_start=1
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, isoform CRA_c"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT22292.2
FT                   protein_id=mCP17203.2 isoform=CRA_c"
FT                   /protein_id="EDL15481.1"
FT                   /translation="MAHSTGSENPKTKRKVCGQCENKAALLVCLECGEDYCSGCFAKMH
FT                   QKGALKFHRTTLLQPKSQILSNILIAAHQFIKEENPPNEGNHPAEASSKSQQKPKALLQ
FT                   NSSEVGATASEGGEGENPRCKVMWEMPFDEEASAQSFREALTQWRAGHQEENKEEEVHA
FT                   KKPDSVEECEVQTNLKMWTEPINIEFTEDSLSYMETLWLKKYRRTPQEQLRTMLPNTFT
FT                   HPHQATAEAQCTQNENESDSDVEEIKIKSPPLFMPVEKLNIERPPPSLTIVELDDFQKV
FT                   TIRKKLIKERYQGPKKFYSVDKNERLDVFPSSSIKGSHSCSEITSTVSEDKMWIPLSSL
FT                   SGYAGSADALCDQQSDENPLPNMQQQKSGQKSQRPSTANIPISNPDQKDTSCLLFSYTR
FT                   SKSAAAQMPSRAASEISEIEYIDVTDQSELFGGNTADRQALDTLEKELNILRKPADPSE
FT                   DPHSLPSEELQAFNDNFLTLSQMSKDLLEMSRESDPHGAESSSSGRNPEIQPLLSLGDY
FT                   STDEEEDEFLDKQHVIKLPWEKRA"
FT   assembly_gap    10443821..10443840
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10486415..10486503
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    10512844..10513171
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    10521990..10522391
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    10522837..10523027
FT                   /estimated_length=191
FT                   /gap_type="unknown"
FT   assembly_gap    10524032..10524808
FT                   /estimated_length=777
FT                   /gap_type="unknown"
FT   assembly_gap    10526435..10526531
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    10535254..10535273
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10553581..10558435
FT                   /estimated_length=4855
FT                   /gap_type="unknown"
FT   gene            complement(10640004..10667749)
FT                   /gene="Serpini2"
FT                   /locus_tag="mCG_21987"
FT                   /note="gene_id=mCG21987.2"
FT   mRNA            complement(join(10640004..10640363,10644289..10644378,
FT                   10646948..10647034,10650317..10650414,10655415..10655607,
FT                   10655686..10655880,10657159..10657389,10665418..10665679,
FT                   10667708..10667749))
FT                   /gene="Serpini2"
FT                   /locus_tag="mCG_21987"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   I, member 2"
FT                   /note="gene_id=mCG21987.2 transcript_id=mCT22289.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(10640287..10640363,10644289..10644378,
FT                   10646948..10647034,10650317..10650414,10655415..10655607,
FT                   10655686..10655880,10657159..10657389,10665418..10665664))
FT                   /codon_start=1
FT                   /gene="Serpini2"
FT                   /locus_tag="mCG_21987"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   I, member 2"
FT                   /note="gene_id=mCG21987.2 transcript_id=mCT22289.2
FT                   protein_id=mCP17197.2"
FT                   /db_xref="GOA:Q4G0D3"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:1915181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4G0D3"
FT                   /protein_id="EDL15478.1"
FT                   /translation="MNKTILWSFLLFFSGSQTSRATDQKIADFAVDLYKAISLSHKNNI
FT                   IFSPLGTTMLLGMVQLGAKGKAQQQILKTLRMRGTPAGEEFSVLKSLFSAISKKKQEFT
FT                   FNLASALYLQEGFIVKETYLHSNKEFFQSATKLVDFLDAKTSAQAISTWVESKTDGKIK
FT                   NMFSEEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTEMTDFTKKDGSTVKVPMMKALLRA
FT                   QYGYFSQSSMTCQVLELPYKADEFSLVIILPTEDTSIEEVENQVTAPHVRRWFSELHEE
FT                   EVEVSLPRFKIEQKLDLKEALYSLNVTEIFSGGCDLSGITDSSEVYVSRVMQKVFFEIN
FT                   EDGSEAAASTGINIPAIMSLTQTQFLANHPFLFILKHIRTESILFMGKVTDPDIQTTKG
FT                   RDLDSL"
FT   assembly_gap    10648337..10648491
FT                   /estimated_length=155
FT                   /gap_type="unknown"
FT   assembly_gap    10651364..10651391
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    10661238..10661257
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10667096..10667124
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    10682315..10682813
FT                   /estimated_length=499
FT                   /gap_type="unknown"
FT   assembly_gap    10688817..10688836
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10697267..10702686
FT                   /estimated_length=5420
FT                   /gap_type="unknown"
FT   assembly_gap    10704135..10704178
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    10724008..10724027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10725493..10726885
FT                   /estimated_length=1393
FT                   /gap_type="unknown"
FT   assembly_gap    10733715..10734037
FT                   /estimated_length=323
FT                   /gap_type="unknown"
FT   assembly_gap    10738177..10738196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10748126..10748395
FT                   /estimated_length=270
FT                   /gap_type="unknown"
FT   assembly_gap    10755112..10755131
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10769540..10769559
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10780416..10780512
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    10781764..10781783
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10787112..10829333)
FT                   /locus_tag="mCG_57300"
FT                   /note="gene_id=mCG57300.2"
FT   mRNA            complement(join(10787112..10787999,10806698..10806846,
FT                   10808490..10808657,10827408..10827582,10828334..10828510,
FT                   10828893..10829333))
FT                   /locus_tag="mCG_57300"
FT                   /product="mCG57300"
FT                   /note="gene_id=mCG57300.2 transcript_id=mCT57483.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(10787673..10787999,10806698..10806846,
FT                   10808490..10808657,10827408..10827582,10828334..10828510,
FT                   10828893..10829306))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57300"
FT                   /product="mCG57300"
FT                   /note="gene_id=mCG57300.2 transcript_id=mCT57483.2
FT                   protein_id=mCP38041.2"
FT                   /protein_id="EDL15477.1"
FT                   /translation="MPREEFVQKMAETVGWGTKEEYGELFDKVDVARDGFIDWDKLTSF
FT                   ILLLLYERDERAKATVVPQWKDLEFLPGKHKDTIQKVVFLKSSSRYLTVSKEGLLGIWG
FT                   ENLKLQESLPITSDAIKLKHLWVTSLVSLENVNKIAVAFTSREICFYDLLSKEEFPCQY
FT                   KLQGLQGAPICMDYWYDPIDPKDSILSFGDITGKVQAVAFTAAMISLFERPANACDNEE
FT                   ATMTIDWAELVSGCHKCCHVLQHTLHHGDWVRQVTYNASLDAFISSTMSGINTVVLAWR
FT                   EKSKKLLKMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVLSKPVGVLWGHSA
FT                   SVIAVQFFAERKQLFSFSRDKVLRLWDIQHQLSIQRITCSFPKSQDFRCLFQFDETHGR
FT                   LFISFNNQLALLAIKNEASKRVKSHLKAVSCVLYNSLLKQVNTSSSLLLSWRFPKVRVS
FT                   FPLLNQKQNQR"
FT   assembly_gap    10811988..10812104
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    10829546..10829565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10831607..10831626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10833230..10833249
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(10860914..10863673)
FT                   /locus_tag="mCG_147528"
FT                   /note="gene_id=mCG147528.0"
FT   mRNA            complement(join(10860914..10863333,10863543..10863673))
FT                   /locus_tag="mCG_147528"
FT                   /product="mCG147528"
FT                   /note="gene_id=mCG147528.0 transcript_id=mCT187791.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10862964..10863206)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147528"
FT                   /product="mCG147528"
FT                   /note="gene_id=mCG147528.0 transcript_id=mCT187791.0
FT                   protein_id=mCP109372.0"
FT                   /protein_id="EDL15476.1"
FT                   /translation="MMQRGEVIRSYPEAALGLTVGPQSEPTRLEKTEGFTASEDYGTDL
FT                   FENKLSVEDFVKIQQVFEVSARFTDQRLWAVHKGQ"
FT   assembly_gap    10863897..10863916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10882087..10882484
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    10895980..10896463
FT                   /estimated_length=484
FT                   /gap_type="unknown"
FT   gene            complement(10898580..10938215)
FT                   /locus_tag="mCG_113365"
FT                   /note="gene_id=mCG113365.0"
FT   mRNA            complement(join(10898580..10899059,10902160..10902242,
FT                   10902489..10902567,10909046..10909172,10910268..10910385,
FT                   10914996..10915049,10922617..10922835,10938182..10938215))
FT                   /locus_tag="mCG_113365"
FT                   /product="mCG113365"
FT                   /note="gene_id=mCG113365.0 transcript_id=mCT114447.0
FT                   created on 03-SEP-2002"
FT   CDS             complement(join(10898978..10899059,10902160..10902242,
FT                   10902489..10902567,10909046..10909172,10910268..10910385,
FT                   10914996..10915049,10922617..10922712))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113365"
FT                   /product="mCG113365"
FT                   /note="gene_id=mCG113365.0 transcript_id=mCT114447.0
FT                   protein_id=mCP65874.0"
FT                   /protein_id="EDL15475.1"
FT                   /translation="MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLR
FT                   AAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLN
FT                   EKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQ
FT                   KKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA"
FT   assembly_gap    10927075..10927221
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   gene            10939025..11023828
FT                   /gene="Serpini1"
FT                   /locus_tag="mCG_9822"
FT                   /note="gene_id=mCG9822.1"
FT   mRNA            join(10939025..10939102,10994557..10994824,
FT                   10995931..10996161,10998045..10998239,11000596..11000800,
FT                   11005337..11005434,11019391..11019477,11021723..11021812,
FT                   11022149..11023828)
FT                   /gene="Serpini1"
FT                   /locus_tag="mCG_9822"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   I, member 1"
FT                   /note="gene_id=mCG9822.1 transcript_id=mCT9793.1 created on
FT                   30-AUG-2002"
FT   assembly_gap    10942735..10942781
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   CDS             join(10994575..10994824,10995931..10996161,
FT                   10998045..10998239,11000596..11000800,11005337..11005434,
FT                   11019391..11019477,11021723..11021812,11022149..11022225)
FT                   /codon_start=1
FT                   /gene="Serpini1"
FT                   /locus_tag="mCG_9822"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   I, member 1"
FT                   /note="gene_id=mCG9822.1 transcript_id=mCT9793.1
FT                   protein_id=mCP17199.1"
FT                   /protein_id="EDL15474.1"
FT                   /translation="MTYLELLALLALQSVVTGATFPDETITEWSVNMYNHLRGTGEDEN
FT                   ILFSPLSIALAMGMMELGAQGSTRKEIRHSMGYEGLKGGEEFSFLRDFSNMASAEENQY
FT                   VMKLANSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVENYTNSLL
FT                   KDLVSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGE
FT                   FYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEWAN
FT                   SVKKQKVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAMSDKKELFLSKAVHKS
FT                   CIEVNEEGSEAAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNPET
FT                   MNTSGHDFEEL"
FT   gene            complement(11028925..>11037215)
FT                   /locus_tag="mCG_145237"
FT                   /note="gene_id=mCG145237.0"
FT   mRNA            complement(join(11028925..11029415,11030275..11030465,
FT                   11036874..>11037215))
FT                   /locus_tag="mCG_145237"
FT                   /product="mCG145237"
FT                   /note="gene_id=mCG145237.0 transcript_id=mCT184661.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(11028981..>11029343)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145237"
FT                   /product="mCG145237"
FT                   /note="gene_id=mCG145237.0 transcript_id=mCT184661.0
FT                   protein_id=mCP105804.0"
FT                   /protein_id="EDL15473.1"
FT                   /translation="QLKEKIIYGELLPNSLLWLLEHFCVSVEPGSCPVMQTECLSALWL
FT                   ALVVCMKIAFVGSFGVAKLEEVCHYWGVGFEVSNAQAKPSQVSLFLPAACQSKCRSLSY
FT                   LSSIMSAFMLPCFLPW"
FT   assembly_gap    11104864..11104883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11108166..11108737
FT                   /estimated_length=572
FT                   /gap_type="unknown"
FT   assembly_gap    11111796..11112022
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    11126504..11126524
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    11160438..11160457
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11164524..11164609
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    11201042..11204674
FT                   /estimated_length=3633
FT                   /gap_type="unknown"
FT   assembly_gap    11207774..11207793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11208989..11209008
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11215642..11216108
FT                   /estimated_length=467
FT                   /gap_type="unknown"
FT   assembly_gap    11218615..11218634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11224730..11230258
FT                   /estimated_length=5529
FT                   /gap_type="unknown"
FT   assembly_gap    11233000..11233019
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11240987..11241006
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11254508..11254527
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(11259601..11343129)
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /note="gene_id=mCG9823.3"
FT   mRNA            complement(join(11259601..11261587,11262028..11262099,
FT                   11269664..11269732,11270062..11270229,11274490..11274599,
FT                   11275856..11275938,11276750..11277003,11281536..11281838,
FT                   11284534..11284695,11288965..11289048,11289819..11289901,
FT                   11292971..11293121,11294703..11294756,11296550..11296599,
FT                   11298116..11298190,11342315..11343063))
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /product="golgi phosphoprotein 4, transcript variant
FT                   mCT9794"
FT                   /note="gene_id=mCG9823.3 transcript_id=mCT9794.2 created on
FT                   09-JUN-2003"
FT   mRNA            complement(join(11259891..11261587,11262028..11262099,
FT                   11269664..11269732,11270062..11270229,11274490..11274599,
FT                   11275856..11275938,11276750..11277003,11281536..11281838,
FT                   11284534..11284695,11289819..11289901,11292971..11293121,
FT                   11294703..11294756,11296550..11296599,11298116..11298190,
FT                   11342315..11342926,11343007..11343063,11343084..11343129))
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /product="golgi phosphoprotein 4, transcript variant
FT                   mCT185530"
FT                   /note="gene_id=mCG9823.3 transcript_id=mCT185530.0 created
FT                   on 09-JUN-2003"
FT   CDS             complement(join(11261441..11261587,11262028..11262099,
FT                   11269664..11269732,11270062..11270229,11274490..11274599,
FT                   11275856..11275938,11276750..11277003,11281536..11281838,
FT                   11284534..11284695,11289819..11289901,11292971..11293121,
FT                   11294703..11294756,11296550..11296599,11298116..11298190,
FT                   11342315..11342501))
FT                   /codon_start=1
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /product="golgi phosphoprotein 4, isoform CRA_a"
FT                   /note="gene_id=mCG9823.3 transcript_id=mCT185530.0
FT                   protein_id=mCP106788.0 isoform=CRA_a"
FT                   /protein_id="EDL15471.1"
FT                   /translation="MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYLELQTQLRKAEA
FT                   VALKYQQHQDSLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGR
FT                   QDSNSRYSALNVQHQMLKSQHEELRKQHSDLEEEHRKQGEDFSRTFNDHKQRYLQLQQE
FT                   KEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKTQVAEYKQLKDTLNRIPSFRNP
FT                   DPVEQQNVTFPHGTHPPQGYNGREKLTGELQEVQPNHEAGPRRMEEKPLSSMQKDAGFQ
FT                   ALEEQNQVEPREPEERQVEEEHRKALEEEEMEQVGQAEHLEEEHDPSPEEQDRDWRDQQ
FT                   GQNAAHLLDGHPQAEVEHSTKAATNFQSPYEEQLEQQRLAARRDEEAQRLREHQEALHQ
FT                   QRLHGQLLRQQQQQQFLAREMAQQKQVAHEDGQQQHQEQLRQQAHYNAVENDIAQGVED
FT                   QGIPEEEGGAYDRDNQRQDEAEGDPGNRQELREPGHQEGDPEVEADRAAVEDINPADDP
FT                   NNQGEDEFEEAEQVREENLPEESEEQKQSEAKQGNVEMDEHLVMAGNPDQQEDNVDEQY
FT                   QDEGEEEVQEDLTEEKKREMEHNVEETYGEHPDDKNNDGEEQGVHNRVHPKGRQEHYEE
FT                   EEDEEDGAAVAEKSHRRAEM"
FT   CDS             complement(join(11261441..11261587,11262028..11262099,
FT                   11269664..11269732,11270062..11270229,11274490..11274599,
FT                   11275856..11275938,11276750..11277003,11281536..11281838,
FT                   11284534..11284695,11288965..11289048,11289819..11289901,
FT                   11292971..11293121,11294703..11294756,11296550..11296599,
FT                   11298116..11298190,11342315..11342501))
FT                   /codon_start=1
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /product="golgi phosphoprotein 4, isoform CRA_b"
FT                   /note="gene_id=mCG9823.3 transcript_id=mCT9794.2
FT                   protein_id=mCP17204.2 isoform=CRA_b"
FT                   /protein_id="EDL15472.1"
FT                   /translation="MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYLELQTQLRKAEA
FT                   VALKYQQHQDSLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGR
FT                   QDSNSRYSALNVQHQMLKSQHEELRKQHSDLEEEHRKQGEDFSRTFNDHKQRYLQLQQE
FT                   KEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKS
FT                   ALAAAQTQVAEYKQLKDTLNRIPSFRNPDPVEQQNVTFPHGTHPPQGYNGREKLTGELQ
FT                   EVQPNHEAGPRRMEEKPLSSMQKDAGFQALEEQNQVEPREPEERQVEEEHRKALEEEEM
FT                   EQVGQAEHLEEEHDPSPEEQDRDWRDQQGQNAAHLLDGHPQAEVEHSTKAATNFQSPYE
FT                   EQLEQQRLAARRDEEAQRLREHQEALHQQRLHGQLLRQQQQQQFLAREMAQQKQVAHED
FT                   GQQQHQEQLRQQAHYNAVENDIAQGVEDQGIPEEEGGAYDRDNQRQDEAEGDPGNRQEL
FT                   REPGHQEGDPEVEADRAAVEDINPADDPNNQGEDEFEEAEQVREENLPEESEEQKQSEA
FT                   KQGNVEMDEHLVMAGNPDQQEDNVDEQYQDEGEEEVQEDLTEEKKREMEHNVEETYGEH
FT                   PDDKNNDGEEQGVHNRVHPKGRQEHYEEEEDEEDGAAVAEKSHRRAEM"
FT   assembly_gap    11273384..11273403
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11278670..11279001
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    11281410..11281429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11343064..11343083
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11346801..11346869
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    11352634..11352653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11383637..11383684
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    11399621..11400362
FT                   /estimated_length=742
FT                   /gap_type="unknown"
FT   assembly_gap    11405001..11406312
FT                   /estimated_length=1312
FT                   /gap_type="unknown"
FT   assembly_gap    11412891..11412910
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11414014..11414033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11415555..11415574
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11416711..11416730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11444309..11444328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11452736..11452755
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11458097..11458116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11459832..11459851
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11470871..11470890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            11472907..12102033
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /note="gene_id=mCG51205.2"
FT   mRNA            join(11472907..11473338,11530839..11530980,
FT                   11613853..11613886,11712877..11713125,11802300..11802496,
FT                   11821268..11821388,11873356..11873526,11926454..11926573,
FT                   11979958..11980119,11984456..11984590,12009363..12009389,
FT                   12017706..12017824,12036699..12036848,12048101..12048208,
FT                   12050200..12050324,12099504..12102033)
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, transcript variant mCT150123"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT150123.1 created
FT                   on 27-AUG-2002"
FT   mRNA            join(<11472934..11473338,11530839..11530980,
FT                   11613853..11613886,11712877..11713125,11802300..11802496,
FT                   11821268..11821388,11873356..11873522,11926454..11926573,
FT                   11979958..11980119,11984456..11984590,12009363..12009389,
FT                   12017706..12017824,12036699..12036848,12048101..12048208,
FT                   12050200..12050324,12099504..12100666)
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, transcript variant mCT190982"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT190982.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<11473946..11474100,11530839..11530980,
FT                   11613853..11613886,11712877..11713125,11802300..11802496,
FT                   11821268..11821388,11873356..11873522,11926454..11926573,
FT                   11979958..11980119,11984456..11984590,12009363..12009389,
FT                   12017706..12017824,12036699..12036848,12048101..12048208,
FT                   12050200..12050324,12099504..12100665)
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, transcript variant mCT190983"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT190983.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(11473947..11474100,11530839..11530980,
FT                   11613853..11613886,11712877..11713125,11802300..11802496,
FT                   11821268..11821388,11873356..11873526,11926454..11926573,
FT                   11979958..11980119,11984456..11984590,12009363..12009389,
FT                   12017706..12017824,12036699..12036848,12048101..12048208,
FT                   12050200..12050324,12099504..12102033)
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, transcript variant mCT51388"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT51388.2 created
FT                   on 27-AUG-2002"
FT   assembly_gap    11485183..11485202
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11493237..11493341
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    11498302..11498321
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11518493..11518512
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11519625..11519644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11520792..11520811
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11522591..11522610
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11526906..11526925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(11530855..11530980,11613853..11613886,
FT                   11712877..11713125,11802300..11802496,11821268..11821388,
FT                   11873356..11873526,11926454..11926573,11979958..11980119,
FT                   11984456..11984590,12009363..12009389,12017706..12017824,
FT                   12036699..12036848,12048101..12048208,12050200..12050324,
FT                   12099504..12100206)
FT                   /codon_start=1
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT150123.1
FT                   protein_id=mCP65648.1 isoform=CRA_a"
FT                   /protein_id="EDL15467.1"
FT                   /translation="MFRCWSAILILGFIFLASEGRPTKESGYGLKSYQPLTRLRHKQEK
FT                   SQESSRIKEFLIHDGPFGSCENKYCGLGRHCVINRETRHAECACMDLCKQHYKPVCGSD
FT                   GEFYENHCEVHRAACLKKQKITIVHNEDCFFEGDNCMAIEYSKMKSMLLDLQNQKYITQ
FT                   ENENPNSDDISRKKPLVDQMFKYFDADSNGLVDINELTQVIKQEELNKDLSDCTLYDLL
FT                   KYDDFNADKHLALEEFYRAFQVIQLSLPEDQRVSITAATVGQSAVLSCAIVGTLRPPII
FT                   WKRNNIVLNNLDLEDINVRFGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNV
FT                   PPVIRVYPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEV
FT                   HISNVRYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVF
FT                   YEDGIKVIQPTECEFQRHIKPSEKLLGYQDEVCPKAEEDEVQRCVWASAVNVKDKFIYV
FT                   AQPTLDRILIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVIT
FT                   LASGNVPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMRFGFILHKDESALHKIDLETM
FT                   SYIKTINLKDSRCIPLSLAYTHLGGYYFISCKADITGATPPQLVVDSVTDSIIGFNSDV
FT                   TGTPYVSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAH
FT                   QYNIYGSSSQQTDVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLM
FT                   TPSKDSLFILDGRLNKLNCEITEVQKGNTVVWVGDA"
FT   CDS             join(11530855..11530980,11613853..11613886,
FT                   11712877..11713125,11802300..11802496,11821268..11821388,
FT                   11873356..11873526,11926454..11926573,11979958..11980119,
FT                   11984456..11984590,12009363..12009389,12017706..12017824,
FT                   12036699..12036848,12048101..12048208,12050200..12050324,
FT                   12099504..12100206)
FT                   /codon_start=1
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT51388.2
FT                   protein_id=mCP38004.2 isoform=CRA_a"
FT                   /protein_id="EDL15470.1"
FT                   /translation="MFRCWSAILILGFIFLASEGRPTKESGYGLKSYQPLTRLRHKQEK
FT                   SQESSRIKEFLIHDGPFGSCENKYCGLGRHCVINRETRHAECACMDLCKQHYKPVCGSD
FT                   GEFYENHCEVHRAACLKKQKITIVHNEDCFFEGDNCMAIEYSKMKSMLLDLQNQKYITQ
FT                   ENENPNSDDISRKKPLVDQMFKYFDADSNGLVDINELTQVIKQEELNKDLSDCTLYDLL
FT                   KYDDFNADKHLALEEFYRAFQVIQLSLPEDQRVSITAATVGQSAVLSCAIVGTLRPPII
FT                   WKRNNIVLNNLDLEDINVRFGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNV
FT                   PPVIRVYPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEV
FT                   HISNVRYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVF
FT                   YEDGIKVIQPTECEFQRHIKPSEKLLGYQDEVCPKAEEDEVQRCVWASAVNVKDKFIYV
FT                   AQPTLDRILIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVIT
FT                   LASGNVPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMRFGFILHKDESALHKIDLETM
FT                   SYIKTINLKDSRCIPLSLAYTHLGGYYFISCKADITGATPPQLVVDSVTDSIIGFNSDV
FT                   TGTPYVSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAH
FT                   QYNIYGSSSQQTDVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLM
FT                   TPSKDSLFILDGRLNKLNCEITEVQKGNTVVWVGDA"
FT   assembly_gap    11540966..11541015
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    11559776..11560305
FT                   /estimated_length=530
FT                   /gap_type="unknown"
FT   assembly_gap    11570252..11570271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11588124..11588234
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    11605757..11605922
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    11610167..11610206
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    11672412..11672431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11689591..11689776
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    11764008..11764027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11810421..11810440
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11823361..11823380
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11825926..11825945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11859442..11859461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11860498..11860517
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11889264..11889724
FT                   /estimated_length=461
FT                   /gap_type="unknown"
FT   assembly_gap    11901693..11901712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11905446..11905711
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   CDS             join(<11926456..11926573,11979958..11980119,
FT                   11984456..11984590,12009363..12009389,12017706..12017824,
FT                   12036699..12036848,12048101..12048208,12050200..12050324,
FT                   12099504..12100206)
FT                   /codon_start=1
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT190982.0
FT                   protein_id=mCP111950.0 isoform=CRA_b"
FT                   /protein_id="EDL15468.1"
FT                   /translation="FGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNVPPVIR
FT                   VYPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNV
FT                   RYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGI
FT                   KVIQPTECEFQRHIKPSEKLLGYQDEVCPKAEEDEVQRCVWASAVNVKDKFIYVAQPTL
FT                   DRILIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVITLASGN
FT                   VPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMRFGFILHKDESALHKIDLETMSYIKT
FT                   INLKDSRCIPLSLAYTHLGGYYFISCKADITGATPPQLVVDSVTDSIIGFNSDVTGTPY
FT                   VSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAHQYNIY
FT                   GSSSQQTDVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLMTPSKD
FT                   SLFILDGRLNKLNCEITEVQKGNTVVWVGDA"
FT   CDS             join(<11926456..11926573,11979958..11980119,
FT                   11984456..11984590,12009363..12009389,12017706..12017824,
FT                   12036699..12036848,12048101..12048208,12050200..12050324,
FT                   12099504..12100206)
FT                   /codon_start=1
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT190983.0
FT                   protein_id=mCP111951.0 isoform=CRA_b"
FT                   /protein_id="EDL15469.1"
FT                   /translation="FGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNVPPVIR
FT                   VYPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNV
FT                   RYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGI
FT                   KVIQPTECEFQRHIKPSEKLLGYQDEVCPKAEEDEVQRCVWASAVNVKDKFIYVAQPTL
FT                   DRILIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVITLASGN
FT                   VPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMRFGFILHKDESALHKIDLETMSYIKT
FT                   INLKDSRCIPLSLAYTHLGGYYFISCKADITGATPPQLVVDSVTDSIIGFNSDVTGTPY
FT                   VSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAHQYNIY
FT                   GSSSQQTDVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLMTPSKD
FT                   SLFILDGRLNKLNCEITEVQKGNTVVWVGDA"
FT   assembly_gap    11934389..11934408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11942762..11942781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11947027..11947046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11958280..11958299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11972433..11972497
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    11976782..11977284
FT                   /estimated_length=503
FT                   /gap_type="unknown"
FT   assembly_gap    11987405..11987424
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11988645..11988664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    11989715..11990001
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    11991044..11991298
FT                   /estimated_length=255
FT                   /gap_type="unknown"
FT   assembly_gap    11995074..11995191
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    12054009..12054028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12055812..12055831
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12057037..12057056
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12065396..12065431
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    12073656..12073675
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12081687..12081706
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12087148..12087167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12138507..12138622
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    12156723..12156904
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    12158509..12158681
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    12169113..12169132
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12202501..12202579
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   gene            12214465..12214811
FT                   /pseudo
FT                   /locus_tag="mCG_53463"
FT                   /note="gene_id=mCG53463.2"
FT   mRNA            12214465..12214811
FT                   /pseudo
FT                   /locus_tag="mCG_53463"
FT                   /note="gene_id=mCG53463.2 transcript_id=mCT53646.2 created
FT                   on 28-MAR-2003"
FT   assembly_gap    12215661..12215810
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    12241718..12241737
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12242919..12242938
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12246193..12246212
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12258486..12258505
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12281715..12281734
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12283645..12283664
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12295166..12295257
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    12302124..12302143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12320625..12320644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12348136..12348346
FT                   /estimated_length=211
FT                   /gap_type="unknown"
FT   assembly_gap    12352799..12354232
FT                   /estimated_length=1434
FT                   /gap_type="unknown"
FT   assembly_gap    12403283..12403353
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    12408776..12408795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12445618..12445820
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    12472543..12473065
FT                   /estimated_length=523
FT                   /gap_type="unknown"
FT   assembly_gap    12477949..12477970
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    12523518..12523624
FT                   /estimated_length=107
FT                   /gap_type="unknown"
FT   assembly_gap    12536969..12537790
FT                   /estimated_length=822
FT                   /gap_type="unknown"
FT   assembly_gap    12572531..12573837
FT                   /estimated_length=1307
FT                   /gap_type="unknown"
FT   assembly_gap    12576677..12583036
FT                   /estimated_length=6360
FT                   /gap_type="unknown"
FT   assembly_gap    12620260..12620279
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12628185..12628204
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12629165..12629184
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12629986..12632151
FT                   /estimated_length=2166
FT                   /gap_type="unknown"
FT   assembly_gap    12647661..12648038
FT                   /estimated_length=378
FT                   /gap_type="unknown"
FT   assembly_gap    12650819..12650838
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12660784..12660803
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12710400..12710419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12711552..12711571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12725590..12726049
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    12759511..12759530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12795413..12795432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12838188..12838207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12863152..12863171
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12897658..12897677
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12934546..12934565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12948369..12948388
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12961996..12962015
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12968726..12969327
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    12976768..12977600
FT                   /estimated_length=833
FT                   /gap_type="unknown"
FT   assembly_gap    12993744..12993763
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    12994991..12995609
FT                   /estimated_length=619
FT                   /gap_type="unknown"
FT   assembly_gap    13013924..13013943
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13017490..13017603
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    13054998..13056407
FT                   /estimated_length=1410
FT                   /gap_type="unknown"
FT   assembly_gap    13060267..13060286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13065835..13068955
FT                   /estimated_length=3121
FT                   /gap_type="unknown"
FT   assembly_gap    13101771..13102392
FT                   /estimated_length=622
FT                   /gap_type="unknown"
FT   assembly_gap    13104194..13104674
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    13142069..13142088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13154716..13154916
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   assembly_gap    13204003..13204022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13213049..13216678
FT                   /estimated_length=3630
FT                   /gap_type="unknown"
FT   assembly_gap    13272236..13272255
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13285884..13285944
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    13313047..13313066
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13325589..13329998
FT                   /estimated_length=4410
FT                   /gap_type="unknown"
FT   assembly_gap    13335524..13342813
FT                   /estimated_length=7290
FT                   /gap_type="unknown"
FT   assembly_gap    13366052..13367677
FT                   /estimated_length=1626
FT                   /gap_type="unknown"
FT   assembly_gap    13371403..13371422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13373560..13373579
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13375201..13375220
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13376235..13376254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            13407157..13407606
FT                   /pseudo
FT                   /locus_tag="mCG_49957"
FT                   /note="gene_id=mCG49957.1"
FT   mRNA            13407157..13407606
FT                   /pseudo
FT                   /locus_tag="mCG_49957"
FT                   /note="gene_id=mCG49957.1 transcript_id=mCT50140.2 created
FT                   on 28-MAR-2003"
FT   assembly_gap    13426710..13431530
FT                   /estimated_length=4821
FT                   /gap_type="unknown"
FT   assembly_gap    13530941..13530994
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   gene            13534961..13535735
FT                   /pseudo
FT                   /locus_tag="mCG_51415"
FT                   /note="gene_id=mCG51415.1"
FT   mRNA            13534961..13535735
FT                   /pseudo
FT                   /locus_tag="mCG_51415"
FT                   /note="gene_id=mCG51415.1 transcript_id=mCT51598.2 created
FT                   on 28-MAR-2003"
FT   assembly_gap    13555528..13555656
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    13571178..13571197
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13572414..13572433
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13587245..13587572
FT                   /estimated_length=328
FT                   /gap_type="unknown"
FT   assembly_gap    13625782..13625801
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13648310..13648329
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13662070..13668795
FT                   /estimated_length=6726
FT                   /gap_type="unknown"
FT   assembly_gap    13670651..13672018
FT                   /estimated_length=1368
FT                   /gap_type="unknown"
FT   assembly_gap    13682181..13682489
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    13693880..13693899
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13721766..13722427
FT                   /estimated_length=662
FT                   /gap_type="unknown"
FT   assembly_gap    13732299..13735281
FT                   /estimated_length=2983
FT                   /gap_type="unknown"
FT   assembly_gap    13737135..13737154
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13738807..13740440
FT                   /estimated_length=1634
FT                   /gap_type="unknown"
FT   assembly_gap    13746129..13746148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13750030..13750049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13751602..13751621
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13752762..13752781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13753807..13753826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13754914..13754933
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13759555..13760668
FT                   /estimated_length=1114
FT                   /gap_type="unknown"
FT   assembly_gap    13780017..13780036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13782356..13782375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13784368..13784387
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13795608..13795723
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    13810554..13810573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13823087..13823106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13842693..13842712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13878207..13878226
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13898877..13898896
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13906510..13906736
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    13910626..13910645
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13922519..13922538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13923641..13923996
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    13926459..13926602
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    13948197..13948216
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13976305..13976324
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14018836..14018855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14027965..14027984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14032921..14032940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14043358..14043377
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14044537..14044556
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14066044..14066063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14085366..14085385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14087556..14087575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14110709..14123156
FT                   /estimated_length=12448
FT                   /gap_type="unknown"
FT   assembly_gap    14124267..14124286
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14125423..14127501
FT                   /estimated_length=2079
FT                   /gap_type="unknown"
FT   assembly_gap    14133119..14134069
FT                   /estimated_length=951
FT                   /gap_type="unknown"
FT   assembly_gap    14140311..14140330
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14145817..14146024
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    14148336..14148355
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14158445..14159187
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    14181139..14181158
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14182607..14182626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14190620..14190756
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    14191812..14192046
FT                   /estimated_length=235
FT                   /gap_type="unknown"
FT   assembly_gap    14197802..14197821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14199050..14199069
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14207030..14207049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14208697..14208716
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14209772..14209791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14211845..14212342)
FT                   /pseudo
FT                   /locus_tag="mCG_1032226"
FT                   /note="gene_id=mCG1032226.1"
FT   mRNA            complement(14211845..14212342)
FT                   /pseudo
FT                   /locus_tag="mCG_1032226"
FT                   /note="gene_id=mCG1032226.1 transcript_id=mCT149930.1
FT                   created on 09-APR-2003"
FT   assembly_gap    14215343..14215362
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14216826..14216845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14220460..14220479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14221659..14225058
FT                   /estimated_length=3400
FT                   /gap_type="unknown"
FT   assembly_gap    14241585..14241645
FT                   /estimated_length=61
FT                   /gap_type="unknown"
FT   assembly_gap    14254616..14254758
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    14261864..14261883
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14263125..14263202
FT                   /estimated_length=78
FT                   /gap_type="unknown"
FT   assembly_gap    14269001..14269333
FT                   /estimated_length=333
FT                   /gap_type="unknown"
FT   gene            14270996..14272210
FT                   /pseudo
FT                   /locus_tag="mCG_18108"
FT                   /note="gene_id=mCG18108.1"
FT   mRNA            14270996..14272210
FT                   /pseudo
FT                   /locus_tag="mCG_18108"
FT                   /note="gene_id=mCG18108.1 transcript_id=mCT19815.1 created
FT                   on 28-MAR-2003"
FT   assembly_gap    14278583..14278602
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14295533..14295724
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   assembly_gap    14302544..14302563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14303815..14303834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14348495..14349021
FT                   /estimated_length=527
FT                   /gap_type="unknown"
FT   assembly_gap    14399036..14399510
FT                   /estimated_length=475
FT                   /gap_type="unknown"
FT   gene            complement(14410801..>14521688)
FT                   /locus_tag="mCG_18109"
FT                   /note="gene_id=mCG18109.1"
FT   mRNA            complement(join(14410801..14412843,14414841..14415140,
FT                   14417145..14417704,14418246..14418471,14422527..14422679,
FT                   14427200..14427406,14429254..14429477,14431393..14431516,
FT                   14431603..14431814,14433923..14434306,14436016..14436256,
FT                   14436816..14436973,14439983..14440229,14440668..14440776,
FT                   14440871..14441074,14441166..14441273,14442456..14442620,
FT                   14442980..14443114,14446363..14446521,14447245..14447381,
FT                   14452884..14453061,14461125..14461256,14521521..>14521688))
FT                   /locus_tag="mCG_18109"
FT                   /product="mCG18109"
FT                   /note="gene_id=mCG18109.1 transcript_id=mCT19889.1 created
FT                   on 09-APR-2003"
FT   CDS             complement(join(14412818..14412843,14414841..14415140,
FT                   14417145..14417704,14418246..14418471,14422527..14422679,
FT                   14427200..14427406,14429254..14429477,14431393..14431516,
FT                   14431603..14431814,14433923..14434306,14436016..14436256,
FT                   14436816..14436973,14439983..14440229,14440668..14440776,
FT                   14440871..14441074,14441166..14441273,14442456..14442620,
FT                   14442980..14443114,14446363..14446521,14447245..14447381,
FT                   14452884..14453061,14461125..14461256,14521521..>14521688))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18109"
FT                   /product="mCG18109"
FT                   /note="gene_id=mCG18109.1 transcript_id=mCT19889.1
FT                   protein_id=mCP17185.3"
FT                   /protein_id="EDL15466.1"
FT                   /translation="VDYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPV
FT                   GKPPLPRGYHTLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATES
FT                   EAGDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLL
FT                   EFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYP
FT                   DGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVDDCQQDYCRILNQVEKNMQKVEEEGEI
FT                   VMVKEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPM
FT                   EVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGH
FT                   LRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSCSKATEAGLK
FT                   RGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPH
FT                   LPKIGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILP
FT                   QKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQSHHRILDFSTTPDL
FT                   PDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTATPEQYSLCEVSVTPEGVIK
FT                   QRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVAT
FT                   QLSMRNFELFRNIEPTEYIDDLFKLKSKTSCANLKKFEEVINQETFWVASEILRETNQL
FT                   KRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDLQ
FT                   DLFDPSRNMAKYRNVLSGQNLQPPVIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMI
FT                   AKEIRHVGRMASVNMDPALMFRTRSLSQGSANATVLDVAQTGGHKKRVRRSSFLNAKKL
FT                   YEDAQMARKVKQYLSNLELEMDEESLQTLSLQCEPATSTLPKNPGDKKPVKSETSPVAP
FT                   RAGPQQKVQPQQPLAQPQPPHKVSQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKK
FT                   ILSLSEEGSLERHRKQAEDTISNASSQLSSPPTSPQSSPRKGYALALSGTVDNFSDSGH
FT                   SEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVESNLGVGRMERRTLMEPDQYSLGS
FT                   YAPVSESRGLYAAATVISSPSTEELSHDQGDRASLDAADSGRGSWTSCSSGSHDNIQTI
FT                   QHQRSWETLPFGHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQS
FT                   RASWASSTGYWGEDSEGDTGTIKRRGGKDVSAEAESSSMVPVTTEEAKPVPMPAHIAVT
FT                   PSTTKGLIARKEGRYREPPPTPPGYVGIPIADFPEGPCHPARKPPDYNVALQRSRMVAR
FT                   PTEAPAPGQTPPAAAASRPGSKPQWHKPSDADPRLAPFQPQGFAGAEEDEDEQVSAV"
FT   assembly_gap    14420188..14420207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14449031..14449050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14475234..14475253
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14476560..14476709
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    14481188..14481207
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14489638..14489803
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    14532306..14532388
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    14551156..14551175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <14561341..14603037
FT                   /locus_tag="mCG_1032401"
FT                   /note="gene_id=mCG1032401.1"
FT   mRNA            join(<14561341..14561978,14597287..14597671,
FT                   14602598..14603037)
FT                   /locus_tag="mCG_1032401"
FT                   /product="mCG1032401"
FT                   /note="gene_id=mCG1032401.1 transcript_id=mCT150105.1
FT                   created on 27-MAR-2003"
FT   assembly_gap    14573109..14573128
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             <14597365..14597577
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032401"
FT                   /product="mCG1032401"
FT                   /note="gene_id=mCG1032401.1 transcript_id=mCT150105.1
FT                   protein_id=mCP65841.0"
FT                   /protein_id="EDL15465.1"
FT                   /translation="ETCIQRTEAPVRACSERDVTSANSASSHGLHQQCEAGSGFFISVI
FT                   SGAPITTAHRGGKTSEKCQRMDIYH"
FT   assembly_gap    14621668..14621805
FT                   /estimated_length=138
FT                   /gap_type="unknown"
FT   assembly_gap    14624440..14624459
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14626356..14626375
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14627737..14627756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14632144..14632163
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14639372..14639714
FT                   /estimated_length=343
FT                   /gap_type="unknown"
FT   assembly_gap    14656192..14656211
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14684229..14684273
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    14693396..14693638
FT                   /estimated_length=243
FT                   /gap_type="unknown"
FT   assembly_gap    14697625..14697644
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14728071..14728390
FT                   /estimated_length=320
FT                   /gap_type="unknown"
FT   assembly_gap    14749014..14749583
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    14784875..14784983
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    14800312..14800370
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    14803176..14803459
FT                   /estimated_length=284
FT                   /gap_type="unknown"
FT   gene            complement(<14812819..14922206)
FT                   /locus_tag="mCG_20638"
FT                   /note="gene_id=mCG20638.2"
FT   mRNA            complement(join(<14812819..14812894,14815282..14815397,
FT                   14818701..14818901,14832622..14832778,14833714..14835034,
FT                   14842116..14842285,14842403..14842549,14845985..14846073,
FT                   14846429..14846630,14853494..14853623,14859367..14859438,
FT                   14861003..14861092,14861251..14861351,14865597..14865668,
FT                   14865764..14865864,14868372..14868521,14871334..14871460,
FT                   14921565..14921617,14921656..14921752,14922035..14922206))
FT                   /locus_tag="mCG_20638"
FT                   /product="mCG20638"
FT                   /note="gene_id=mCG20638.2 transcript_id=mCT22063.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(<14812819..14812894,14815282..14815397,
FT                   14818701..14818901,14832622..14832778,14833714..14835034,
FT                   14842116..14842285,14842403..14842549,14845985..14846073,
FT                   14846429..14846630,14853494..14853623,14859367..14859438,
FT                   14861003..14861092,14861251..14861351,14865597..14865668,
FT                   14865764..14865864,14868372..14868521,14871334..14871460,
FT                   14921565..14921617,14921656..14921752,14922035..14922129))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20638"
FT                   /product="mCG20638"
FT                   /note="gene_id=mCG20638.2 transcript_id=mCT22063.2
FT                   protein_id=mCP17206.2"
FT                   /protein_id="EDL15464.1"
FT                   /translation="MAPTLLQKLFNKRGGGAASAQARPPKEEPAFRVSEPRTALSLFYC
FT                   SFWVEPQRRPPSLLSRSPQVPHKISPYAPVSEHVWDRWSCSEFGLSDIRLLVYQDCERR
FT                   GRQVMFDSRAVQKMEEAAAQQKAEDVPIKMSARCCQESSSSSGSSSSGSSSSHGFGGSL
FT                   QHAKQQLPKYQYTRPASDVSMLGEMMFGSVAMSYKGSTLKIHYIRSPPQLMISKVFSAT
FT                   MGSFCGSTNNLQDSFEYINQDPQAGKLNTNQYNLGPFRTGSNLGLLQVCSGKLLQGLSE
FT                   GGPLRLTRSASFFAAHSTPVDMPSRGQNEDRDSGIARSASLSSLLITPFPSPSSSTSSS
FT                   SSYQRRWLRSQTTSLENGIFPRRSTDETFSLAEETCSSNPAMVRRKKIAISIIFSLCER
FT                   EAAQRDFQDFFFSHFPLFESHMNRLKGAIEKAMISCRKISESSLRVQFYVSRLMEALGE
FT                   FRGTIWNLYSVPRIAEPVWLTMMSNTLEKNQLCQRFLKEFILLIEQVNKNQFFAALLTA
FT                   VLTYHLAWVPTVMPVDHPPIKAFSEKRTSQSVNMLAKTHPYNPLWAQLGDLYGAIGSPV
FT                   RLTRTVVIGKQKDLVQRILYVLTYFLRCSELQENQLSWSGNPSEDDQVINGSKIITALE
FT                   KGEVEESEYVVVTVSSEPALVPPILPQGTAERRSPEPTVVAEISEGVNTSELGHKPEKN
FT                   RCKRPEQNSEASSMGFQEAEPDSSWIPQGIFCEDKQNDQEATQDCSSSPPSCEVPRVRR
FT                   RMDQQTLHSKLHGETLKKRAEQSAAWPCPDRHSQEDPPVEKVTFHIGSSISPESDFESR
FT                   TKRMEERLKACGHFHGASASASSSMDTGLTQEQQGSGCSFKADFEKDITPQDHSSGGEG
FT                   VSEDRGLRANMTHAVGQLSQVDGPLAHSLCAAESGRRLLEQTRDVQLKGYKGPSSEPVP
FT                   NRCRQQGGLLIAADVPYGDASGKGNYRSEGDIPRNESLDSALGDSDDEACVLALLELGH
FT                   SCDRTEESLEVELPLPRSQSTSKANVRNFGRSLLAGYCATYMPDLVLHGTSSDEKLKQC
FT                   LAADLVHTVHHPVLDEPIAEAVCIIADTDKWTVQVATSQRKVTDTMKLGQDVLVSSQVS
FT                   SLLQSILQLYKLHLPADFCIMHLEDRLQEMYLKSKMLSEYLRGHTRVHVKELSVVLGIE
FT                   SNDLPLLTAIASTHSPYVAQILL"
FT   assembly_gap    14858437..14858456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14862281..14862543
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    14875651..14875670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14898008..14898027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14900137..14900219
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    14901697..14901991
FT                   /estimated_length=295
FT                   /gap_type="unknown"
FT   assembly_gap    14903858..14903916
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    14904763..14906340
FT                   /estimated_length=1578
FT                   /gap_type="unknown"
FT   assembly_gap    14921506..14921525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            14922717..>14927346
FT                   /locus_tag="mCG_1032285"
FT                   /note="gene_id=mCG1032285.0"
FT   mRNA            join(14922717..14923721,14926777..>14927346)
FT                   /locus_tag="mCG_1032285"
FT                   /product="mCG1032285"
FT                   /note="gene_id=mCG1032285.0 transcript_id=mCT149989.0
FT                   created on 01-OCT-2002"
FT   CDS             join(14923569..14923721,14926777..14927346)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032285"
FT                   /product="mCG1032285"
FT                   /note="gene_id=mCG1032285.0 transcript_id=mCT149989.0
FT                   protein_id=mCP65595.1"
FT                   /protein_id="EDL15463.1"
FT                   /translation="MTHQDFLDLIKGKLRMEKHGSAVTNISCVCTGLEISSQQVDQKAH
FT                   NQVQLQKPTCILAWCWFERERDSCWIPRSFAAEDNLGLPMPQPLLLRLQCVPPFLAQNL
FT                   KAWQTRLNSELTLKEGREKKLHKLPNQHTYHTCIFCFIGYSLKVLPFPPPSPSYFGGVV
FT                   IKQCFCLLSYLMTLSSFLFRNRIFCVPHTGLKFKILLTSPPSYQGLQMCSIMPHHSFIL
FT                   VLCVHDFCVCVCGCVVEG"
FT   assembly_gap    14924650..14924913
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    14936035..14936242
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   gene            14937108..14937687
FT                   /pseudo
FT                   /locus_tag="mCG_1032223"
FT                   /note="gene_id=mCG1032223.1"
FT   mRNA            14937108..14937687
FT                   /pseudo
FT                   /locus_tag="mCG_1032223"
FT                   /note="gene_id=mCG1032223.1 transcript_id=mCT149927.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    14938610..14938700
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    14939652..14940033
FT                   /estimated_length=382
FT                   /gap_type="unknown"
FT   gene            14945634..14958114
FT                   /locus_tag="mCG_20642"
FT                   /note="gene_id=mCG20642.1"
FT   mRNA            join(14945634..14945759,14947843..14947982,
FT                   14951782..14951973,14952892..14953014,14953152..14953258,
FT                   14954724..14954865,14956738..14956824,14956909..14956951,
FT                   14957497..14958114)
FT                   /locus_tag="mCG_20642"
FT                   /product="mCG20642"
FT                   /note="gene_id=mCG20642.1 transcript_id=mCT22067.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(14945675..14945759,14947843..14947982,
FT                   14951782..14951973,14952892..14953014,14953152..14953258,
FT                   14954724..14954865,14956738..14956824,14956909..14956951,
FT                   14957497..14957585)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20642"
FT                   /product="mCG20642"
FT                   /note="gene_id=mCG20642.1 transcript_id=mCT22067.2
FT                   protein_id=mCP17194.2"
FT                   /protein_id="EDL15462.1"
FT                   /translation="MSHASPAAKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTA
FT                   ENFRALCTGEKGTGSTTGKPLHFKGCPFHRQHDREGLLSMANAGPNTNGSQFFITTVPT
FT                   PHLDGKHVVFGQVIKGLGVARTLENVEVNGEKPAKLCVIAECGELKEGDDWGIFPKDGS
FT                   GDSHPDFPEDADIDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYAKVLRYVDSSK
FT                   AVIEKADRSRLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALEMDPSNTKALYRKAQG
FT                   WQGLKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDKEKAVYAKMFA"
FT   assembly_gap    14945760..14945779
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14949233..14949464
FT                   /estimated_length=232
FT                   /gap_type="unknown"
FT   assembly_gap    14954174..14954193
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(14957819..14983356)
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /note="gene_id=mCG20640.1"
FT   mRNA            complement(join(14957819..14958631,14959371..14959592,
FT                   14960096..14960278,14964263..14964431,14966376..14966519,
FT                   14968085..14968225,14969463..14969609,14970386..14970463,
FT                   14972744..14972862,14973276..14973357,14977172..14977401,
FT                   14977975..14978112,14982953..14983356))
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /product="electron transferring flavoprotein,
FT                   dehydrogenase, transcript variant mCT22065"
FT                   /note="gene_id=mCG20640.1 transcript_id=mCT22065.2 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(14958278..14958631,14959371..14959592,
FT                   14960096..14960278,14964263..14964431,14966376..14966519,
FT                   14968085..14968225,14969463..14969609,14970386..14970463,
FT                   14972744..14972862,14973276..14973357,14977172..14977401,
FT                   14977975..14978112,14982916..>14983132))
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /product="electron transferring flavoprotein,
FT                   dehydrogenase, transcript variant mCT190975"
FT                   /note="gene_id=mCG20640.1 transcript_id=mCT190975.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(14958468..14958631,14959371..14959592,
FT                   14960096..14960278,14964263..14964431,14966376..14966519,
FT                   14968085..14968225,14969463..14969609,14970386..14970463,
FT                   14972744..14972862,14973276..14973357,14977172..14977401,
FT                   14977975..14978112,14982953..14982986))
FT                   /codon_start=1
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /product="electron transferring flavoprotein,
FT                   dehydrogenase, isoform CRA_b"
FT                   /note="gene_id=mCG20640.1 transcript_id=mCT22065.2
FT                   protein_id=mCP17187.2 isoform=CRA_b"
FT                   /protein_id="EDL15461.1"
FT                   /translation="MLVRLTKLSCPAYHWFHALKIKKCLPLCAPRCSSTSAVPQITTHY
FT                   TVHPREKDKRWEGVNMERFAEEADVVIVGAGPAGLSAAIRLKQLAAEQGKDIRVCLVEK
FT                   AAQIGAHTLSGACLDPAAFKELFPDWKEKGAPLNTPVTEDRFAILTEKHRIPVPILPGL
FT                   PMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLYHEDGSVKGIATNDVGIQK
FT                   DGAPKTTFERGLELHAKVTVFAEGCHGHLAKQLYKKFDLRASCDAQTYGIGLKELWIID
FT                   EKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYLSPFREFQ
FT                   RWKHHPSIQPTLEGGKRIAYGARALNEGGLQSIPKLTFPGGLLIGCSPGFMNVPKIKGT
FT                   HTAMKSGSLAAESIFKQLTSENLQSKTTGLHVTEYEDNLKQSWVWKELHAVRNIRPSCH
FT                   GILGVYGGMIYTGIFYWILRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDL
FT                   LSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGF
FT                   RLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM"
FT   CDS             complement(join(14958468..14958631,14959371..14959592,
FT                   14960096..14960278,14964263..14964431,14966376..14966519,
FT                   14968085..14968225,14969463..14969609,14970386..14970463,
FT                   14972744..14972862,14973276..14973357,14977172..14977401,
FT                   14977975..14978112,14982916..>14982970))
FT                   /codon_start=1
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /product="electron transferring flavoprotein,
FT                   dehydrogenase, isoform CRA_a"
FT                   /note="gene_id=mCG20640.1 transcript_id=mCT190975.0
FT                   protein_id=mCP111944.0 isoform=CRA_a"
FT                   /protein_id="EDL15460.1"
FT                   /translation="PSCPALVRRNSWWGQKEQAYHWFHALKIKKCLPLCAPRCSSTSAV
FT                   PQITTHYTVHPREKDKRWEGVNMERFAEEADVVIVGAGPAGLSAAIRLKQLAAEQGKDI
FT                   RVCLVEKAAQIGAHTLSGACLDPAAFKELFPDWKEKGAPLNTPVTEDRFAILTEKHRIP
FT                   VPILPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLYHEDGSVKGIAT
FT                   NDVGIQKDGAPKTTFERGLELHAKVTVFAEGCHGHLAKQLYKKFDLRASCDAQTYGIGL
FT                   KELWIIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYL
FT                   SPFREFQRWKHHPSIQPTLEGGKRIAYGARALNEGGLQSIPKLTFPGGLLIGCSPGFMN
FT                   VPKIKGTHTAMKSGSLAAESIFKQLTSENLQSKTTGLHVTEYEDNLKQSWVWKELHAVR
FT                   NIRPSCHGILGVYGGMIYTGIFYWILRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPD
FT                   GQISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLSIYDGPEQRFCPAGVYEFVP
FT                   LEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM"
FT   gene            14983534..14987253
FT                   /locus_tag="mCG_20639"
FT                   /note="gene_id=mCG20639.2"
FT   mRNA            join(14983534..14983791,14985564..14987253)
FT                   /locus_tag="mCG_20639"
FT                   /product="mCG20639"
FT                   /note="gene_id=mCG20639.2 transcript_id=mCT22064.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(14983612..14983791,14985564..14985719)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20639"
FT                   /product="mCG20639"
FT                   /note="gene_id=mCG20639.2 transcript_id=mCT22064.2
FT                   protein_id=mCP17207.1"
FT                   /protein_id="EDL15459.1"
FT                   /translation="MADSEEFRASSPPPPPPSSPSSGASSSSLSMPVSLGWRDPSRSPG
FT                   PTVDPLEQVELQIGDAAFSLTKLLEATSAVSAQVEELALKCTENARFLKTWRDLLKEGY
FT                   DSLKPDN"
FT   gene            complement(14989395..15086416)
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /note="gene_id=mCG20641.3"
FT   mRNA            complement(join(14989395..14992802,14996275..14996493,
FT                   14998616..14999026,15000868..15001097,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15035641..15035739,15054325..15054462,15086285..15086416))
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   transcript variant mCT22066"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT22066.3 created
FT                   on 17-APR-2003"
FT   mRNA            complement(join(<14992501..14992802,14996275..14996493,
FT                   14998616..14999026,15000868..15001097,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15031050..15031155,15035641..15035739,15054325..15054462,
FT                   15086285..>15086333))
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   transcript variant mCT190976"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT190976.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(14992501..14992802,14996275..14996493,
FT                   14998616..14999026,15000868..15001097,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15031050..15031155,15035641..15035739,15054325..15054462,
FT                   15086285..15086333))
FT                   /codon_start=1
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT190976.0
FT                   protein_id=mCP111945.0 isoform=CRA_b"
FT                   /protein_id="EDL15457.1"
FT                   /translation="MTSGPFFFCIFIIGKYFTLGSAQDVSCPLGSFPCGNMSRCLPQLL
FT                   HCNGVDDCGNRADEDHCGDNNGWSLQLDKYFANYYKLASTNSFEAETSECLVGSVPMHC
FT                   LCRDLELDCDEANLRAVPSVSSNVTVMSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIH
FT                   SVSVSAFRGLRSLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLN
FT                   SLILLVLMNNALTRLPDKPLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKN
FT                   KINYLNEHAFTHLQKLDELDLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFD
FT                   CLAKLKSLSLEGIEISNIQQRMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSL
FT                   ENLLASIIQRVFVWVVSAITCFGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGVYL
FT                   FVIGAFDLKFRGEYNKHAQPWMESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIVYP
FT                   FRCLRPRKCRTITVLIFIWIIGFIVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGA
FT                   QIYSVVIFLGINLVAFIIIVFSYGSMFYSVHQSSVTVTEIQKQVKKEVVLAKRFFFIVF
FT                   TDALCWIPIFILKFLSLLQVEIPDSITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQ
FT                   LWHNYRQRRSVDRKETQKAYAPSFIWVEMWPLQEMSSGFMKPGAFTDPCDLSLVSQSSR
FT                   LNSYS"
FT   CDS             complement(join(14992501..14992802,14996275..14996493,
FT                   14998616..14999026,15000868..15001097,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15035641..15035645))
FT                   /codon_start=1
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT22066.3
FT                   protein_id=mCP17193.3 isoform=CRA_c"
FT                   /protein_id="EDL15458.1"
FT                   /translation="MLSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIHSVSVSAFRGLR
FT                   SLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNA
FT                   LTRLPDKPLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINYLNEHAFT
FT                   HLQKLDELDLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDCLAKLKSLSLE
FT                   GIEISNIQQRMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRV
FT                   FVWVVSAITCFGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGVYLFVIGAFDLKFR
FT                   GEYNKHAQPWMESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRT
FT                   ITVLIFIWIIGFIVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGI
FT                   NLVAFIIIVFSYGSMFYSVHQSSVTVTEIQKQVKKEVVLAKRFFFIVFTDALCWIPIFI
FT                   LKFLSLLQVEIPDSITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWHNYRQRRSV
FT                   DRKETQKAYAPSFIWVEMWPLQEMSSGFMKPGAFTDPCDLSLVSQSSRLNSYS"
FT   assembly_gap    14993528..14993547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    14999597..14999616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(15003993..15004801,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15035641..15035739,15054325..15054462,15086285..15086416))
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   transcript variant mCT181988"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT181988.0 created
FT                   on 17-APR-2003"
FT   CDS             complement(join(15004795..15004801,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15035641..15035645))
FT                   /codon_start=1
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT181988.0
FT                   protein_id=mCP104910.0 isoform=CRA_a"
FT                   /protein_id="EDL15456.1"
FT                   /translation="MLSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIHSVSVSAFRGLR
FT                   SLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNA
FT                   LTRLPDKPLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINYLNEHAFT
FT                   HLQKLDELDLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDCLAKLKSLSLE
FT                   GIEISNIQQRMFRPLINLSHIL"
FT   assembly_gap    15018440..15018625
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    15033553..15033797
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    15108530..15108549
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15111984..15112003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15116098..15116117
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15128520..15128539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15132615..15132634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15151604..15151623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15152837..15152856
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15156956..15186564)
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /note="gene_id=mCG20643.2"
FT   mRNA            complement(join(15156956..15157954,15160825..15160878,
FT                   15165071..15165168,15166480..15166599,15169148..15169266,
FT                   15170692..15170768,15171484..15171565,15175892..15175972,
FT                   15177739..15177838,15180084..15180206,15182987..15183155,
FT                   15186271..15186564))
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /product="transmembrane protein 144, transcript variant
FT                   mCT22068"
FT                   /note="gene_id=mCG20643.2 transcript_id=mCT22068.2 created
FT                   on 28-OCT-2002"
FT   mRNA            complement(join(15156956..15157954,15160825..15160878,
FT                   15165071..15165168,15166480..15166599,15169148..15169266,
FT                   15170692..15170768,15171484..15171565,15175892..15175972,
FT                   15177739..15177838,15180084..15180206,15182987..15183155,
FT                   15185406..>15185588))
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /product="transmembrane protein 144, transcript variant
FT                   mCT190980"
FT                   /note="gene_id=mCG20643.2 transcript_id=mCT190980.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(15157871..15157954,15160825..15160878,
FT                   15165071..15165168,15166480..15166599,15169148..15169266,
FT                   15170692..15170768,15171484..15171565,15175892..15175972,
FT                   15177739..15177838,15180084..15180206,15182987..>15183143))
FT                   /codon_start=1
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /product="transmembrane protein 144, isoform CRA_a"
FT                   /note="gene_id=mCG20643.2 transcript_id=mCT190980.0
FT                   protein_id=mCP111946.0 isoform=CRA_a"
FT                   /protein_id="EDL15454.1"
FT                   /translation="KHRSKVRRAAVCYPATMSSNATDLTTGYLSSAAAILLFGSNFVPL
FT                   KKYDTGDGMFLQWVLCAAIWLVALVVNLILHCPKFWPFAMLGGCIWATGNIAVVPIIKT
FT                   IGLGLGILIWGSFNTLTGWASSRFGWFGMDAEEVSKPMLNYVGAGLSVVSALTFLFIKS
FT                   EIPNNPGSSDTTPLMTEPVINRTEDRSADSSWVDRLSTTYHRIVGCSLAVISGILYGST
FT                   FVPIIYIKDHSRRNDSMYAGASQYDLDYVFAHSSGIFLTSTVYFVAYCVAMKNRPKLYP
FT                   EAVLPGLLSGVLWAIATCCWFIANHSLSAVISFPIITAGPGLIAALWGILIFKEIQGLR
FT                   NYLLMMLAFCIILAGALCTAFSKV"
FT   CDS             complement(join(15157871..15157954,15160825..15160878,
FT                   15165071..15165168,15166480..15166599,15169148..15169266,
FT                   15170692..15170768,15171484..15171565,15175892..15175972,
FT                   15177739..15177838,15180084..15180206,15182987..15183095))
FT                   /codon_start=1
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /product="transmembrane protein 144, isoform CRA_b"
FT                   /note="gene_id=mCG20643.2 transcript_id=mCT22068.2
FT                   protein_id=mCP17200.2 isoform=CRA_b"
FT                   /protein_id="EDL15455.1"
FT                   /translation="MSSNATDLTTGYLSSAAAILLFGSNFVPLKKYDTGDGMFLQWVLC
FT                   AAIWLVALVVNLILHCPKFWPFAMLGGCIWATGNIAVVPIIKTIGLGLGILIWGSFNTL
FT                   TGWASSRFGWFGMDAEEVSKPMLNYVGAGLSVVSALTFLFIKSEIPNNPGSSDTTPLMT
FT                   EPVINRTEDRSADSSWVDRLSTTYHRIVGCSLAVISGILYGSTFVPIIYIKDHSRRNDS
FT                   MYAGASQYDLDYVFAHSSGIFLTSTVYFVAYCVAMKNRPKLYPEAVLPGLLSGVLWAIA
FT                   TCCWFIANHSLSAVISFPIITAGPGLIAALWGILIFKEIQGLRNYLLMMLAFCIILAGA
FT                   LCTAFSKV"
FT   assembly_gap    15194930..15195001
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    15201155..15201174
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15202661..15203692
FT                   /estimated_length=1032
FT                   /gap_type="unknown"
FT   assembly_gap    15212069..15212480
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   gene            15230169..15290267
FT                   /gene="1110032E23Rik"
FT                   /locus_tag="mCG_20644"
FT                   /note="gene_id=mCG20644.1"
FT   mRNA            join(15230169..15231350,15254591..15254805,
FT                   15283478..15283704,15288177..15290267)
FT                   /gene="1110032E23Rik"
FT                   /locus_tag="mCG_20644"
FT                   /product="RIKEN cDNA 1110032E23"
FT                   /note="gene_id=mCG20644.1 transcript_id=mCT22069.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(15230447..15231350,15254591..15254805,
FT                   15283478..15283704,15288177..15288384)
FT                   /codon_start=1
FT                   /gene="1110032E23Rik"
FT                   /locus_tag="mCG_20644"
FT                   /product="RIKEN cDNA 1110032E23"
FT                   /note="gene_id=mCG20644.1 transcript_id=mCT22069.2
FT                   protein_id=mCP17205.1"
FT                   /protein_id="EDL15453.1"
FT                   /translation="MTCPDKPGQLVNWFVCSLCAPRVCKLWSSRRPRTRRNLLLGTACA
FT                   IYLGFLVSQVGRGSFQHGQATDRGPPNGHDIFKVPFSEIPLDGTLAPPELQGNGSTLQP
FT                   NVVYITLRSKRSKPANIRGTVKPKRRKKYAVASAAPDQEVLVRPSLIQQEAARAADAEV
FT                   PGYVQGYLTKVGERPWRVLRGPGVRTRGSNLQQPRARESNIRIYSESAPSWLSKEDIRR
FT                   MRLLADSEVASILPISKSGTRLLVLEGSTSGSVPGCGPSPCGLLKQPLDMSEVFAFHLD
FT                   RILGLNRTLPSVSRKLEFIQDGRPRPIILWDSSLASASNDSHSSVKITWGTYQRLLKQK
FT                   CWLNGRVPRPEWDCTEIHHHEWSKMALFDFLLQIYNRLDTNCCGFRPRKEDACIQNGLR
FT                   SNCEDQTSVTLAHIIQRKNDPRHLVFINNKGFFDRSEDNLNFKLLEGIREFPESAVSVL
FT                   KSQHLRQKLLQSLFLDQVYWESQGGRQGIEKLIDVIERRARILITYINAHGARVLPMNE
FT                   "
FT   assembly_gap    15237229..15237485
FT                   /estimated_length=257
FT                   /gap_type="unknown"
FT   assembly_gap    15252972..15252991
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15254346..15254365
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15257242..15257261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15273242..15273261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15277659..15277678
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15305921..15305940
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15315528..15315547
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15329401..15329420
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15340009..15340159
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    15351180..15351199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15354083..15354880
FT                   /estimated_length=798
FT                   /gap_type="unknown"
FT   assembly_gap    15357275..15357613
FT                   /estimated_length=339
FT                   /gap_type="unknown"
FT   assembly_gap    15358835..15359978
FT                   /estimated_length=1144
FT                   /gap_type="unknown"
FT   assembly_gap    15368229..15368321
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    15385864..15387146
FT                   /estimated_length=1283
FT                   /gap_type="unknown"
FT   assembly_gap    15395804..15395823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15453042..15453061
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15484491..15484947
FT                   /estimated_length=457
FT                   /gap_type="unknown"
FT   assembly_gap    15485754..15485778
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    15530104..15530133
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    15531288..15531307
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15535390..15535409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            15544193..15545819
FT                   /locus_tag="mCG_147526"
FT                   /note="gene_id=mCG147526.0"
FT   mRNA            join(15544193..15544291,15545134..15545819)
FT                   /locus_tag="mCG_147526"
FT                   /product="mCG147526"
FT                   /note="gene_id=mCG147526.0 transcript_id=mCT187789.0
FT                   created on 13-JAN-2004"
FT   CDS             join(15544252..15544291,15545134..15545330)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147526"
FT                   /product="mCG147526"
FT                   /note="gene_id=mCG147526.0 transcript_id=mCT187789.0
FT                   protein_id=mCP109370.0"
FT                   /protein_id="EDL15452.1"
FT                   /translation="MEWEAGADHVNKSAQRQAATIAATTTATRTTATTGTTKTATTATR
FT                   TTKTTATTKTATTTRAPTFYEYLKPPFKTPYIA"
FT   assembly_gap    15548604..15548623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15549826..15549845
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15571015..15571153
FT                   /estimated_length=139
FT                   /gap_type="unknown"
FT   assembly_gap    15572009..15572028
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15575266..15575331
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    15576646..15577420
FT                   /estimated_length=775
FT                   /gap_type="unknown"
FT   assembly_gap    15578875..15578894
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15579377..15579595
FT                   /estimated_length=219
FT                   /gap_type="unknown"
FT   assembly_gap    15581134..15581153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(15619801..>15667317)
FT                   /locus_tag="mCG_145239"
FT                   /note="gene_id=mCG145239.0"
FT   mRNA            complement(join(15619801..15622884,15623945..15624048,
FT                   15667114..>15667317))
FT                   /locus_tag="mCG_145239"
FT                   /product="mCG145239"
FT                   /note="gene_id=mCG145239.0 transcript_id=mCT184663.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(15621051..>15621308)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145239"
FT                   /product="mCG145239"
FT                   /note="gene_id=mCG145239.0 transcript_id=mCT184663.0
FT                   protein_id=mCP105806.0"
FT                   /protein_id="EDL15451.1"
FT                   /translation="SCIILLHRNSILVSIFKRIPKRLRQFLTTKDTVHCIFLCPASLLY
FT                   NGCEILKASRSKLTVIPAQNRTINKTKQTKNSSYFDSQAE"
FT   assembly_gap    15650847..15650866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15652745..15652764
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15685041..15687044
FT                   /estimated_length=2004
FT                   /gap_type="unknown"
FT   assembly_gap    15727272..15727291
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15729129..15729148
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15731777..15731796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15739309..15739328
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15740532..15740551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15741685..15741704
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15743158..15743177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15773427..15779082
FT                   /estimated_length=5656
FT                   /gap_type="unknown"
FT   assembly_gap    15785604..15785769
FT                   /estimated_length=166
FT                   /gap_type="unknown"
FT   assembly_gap    15796895..15799517
FT                   /estimated_length=2623
FT                   /gap_type="unknown"
FT   assembly_gap    15816988..15817171
FT                   /estimated_length=184
FT                   /gap_type="unknown"
FT   assembly_gap    15828977..15828996
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15831187..15832281
FT                   /estimated_length=1095
FT                   /gap_type="unknown"
FT   assembly_gap    15843882..15843985
FT                   /estimated_length=104
FT                   /gap_type="unknown"
FT   assembly_gap    15850274..15850293
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15854735..15854754
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    15867122..15867210
FT                   /estimated_length=89
FT                   /gap_type="unknown"
FT   assembly_gap    15955031..15955056
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   gene            complement(16015619..>16123635)
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /note="gene_id=mCG21475.2"
FT   mRNA            complement(join(16015619..16015886,16016275..16016523,
FT                   16019035..16019149,16020001..16020248,16030174..16030372,
FT                   16034599..16034969,16035410..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..16123385))
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   transcript variant mCT21979"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT21979.1 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(16016278..16016523,16019035..16019149,
FT                   16020001..16020248,16030174..16030372,16034599..16034969,
FT                   16035410..16035616,16037089..16037199,16038001..16038105,
FT                   16038388..16038555,16049742..16049903,16054542..16054595,
FT                   16059743..16059939,16068664..16068903,16122444..16122584,
FT                   16123096..16123183))
FT                   /codon_start=1
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT21979.1
FT                   protein_id=mCP11548.2 isoform=CRA_d"
FT                   /db_xref="GOA:G5E8H1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95809"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8H1"
FT                   /protein_id="EDL15450.1"
FT                   /translation="MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFR
FT                   VGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFC
FT                   GTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQA
FT                   VLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQ
FT                   VITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLE
FT                   EKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQ
FT                   GVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTL
FT                   TELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCG
FT                   FKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFM
FT                   SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEE
FT                   FEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIIS
FT                   SYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTY
FT                   MRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGY
FT                   GIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSN
FT                   VAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNINPSSSQNSQNFATYKE
FT                   GYNVYGIESVKI"
FT   assembly_gap    16018158..16018177
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(16019237..16020248,16030174..16030372,
FT                   16034599..16034969,16035410..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..>16123635))
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   transcript variant mCT190947"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190947.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16019988..16020248,16030174..16030372,
FT                   16034599..16034969,16035410..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..>16123258))
FT                   /codon_start=1
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190947.0
FT                   protein_id=mCP111895.0 isoform=CRA_b"
FT                   /protein_id="EDL15448.1"
FT                   /translation="GKRSKKEKEERETRGYFVDALLFLEMQKIMHISVLLSPVLWGLIF
FT                   GVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCS
FT                   QFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLS
FT                   LIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQ
FT                   DLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAN
FT                   VSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLR
FT                   KQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTIN
FT                   IMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNH
FT                   EMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGK
FT                   ADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV
FT                   FAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGC
FT                   DISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYG
FT                   TLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
FT                   MNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRWVE"
FT   mRNA            complement(join(16032402..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..>16123449))
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   transcript variant mCT190946"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190946.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(16034064..16034969,16035410..16035616,
FT                   16037089..16037199,16038001..16038105,16038388..16038555,
FT                   16049742..16049903,16054542..16054595,16059743..16059939,
FT                   16068664..16068903,16122444..16122584,16123096..>16123523))
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   transcript variant mCT190948"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190948.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16034562..16034969,16035410..16035616,
FT                   16037089..16037199,16038001..16038105,16038388..16038555,
FT                   16049742..16049903,16054542..16054595,16059743..16059939,
FT                   16068664..16068903,16122444..16122584,16123096..>16123258))
FT                   /codon_start=1
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190948.0
FT                   protein_id=mCP111896.0 isoform=CRA_c"
FT                   /protein_id="EDL15449.1"
FT                   /translation="GKRSKKEKEERETRGYFVDALLFLEMQKIMHISVLLSPVLWGLIF
FT                   GVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCS
FT                   QFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLS
FT                   LIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQ
FT                   DLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAN
FT                   VSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLR
FT                   KQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTIN
FT                   IMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNH
FT                   EMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGK
FT                   ADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV
FT                   FAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGC
FT                   DISPRLVTHLLQLCAF"
FT   CDS             complement(join(16035398..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..>16123258))
FT                   /codon_start=1
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190946.0
FT                   protein_id=mCP111894.0 isoform=CRA_a"
FT                   /protein_id="EDL15447.1"
FT                   /translation="GKRSKKEKEERETRGYFVDALLFLEMQKIMHISVLLSPVLWGLIF
FT                   GVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCS
FT                   QFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLS
FT                   LIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQ
FT                   DLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAN
FT                   VSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLR
FT                   KQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTIN
FT                   IMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNH
FT                   EMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGV
FT                   SF"
FT   assembly_gap    16078218..16078237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16110180..16110214
FT                   /estimated_length=35
FT                   /gap_type="unknown"
FT   assembly_gap    16121144..16121276
FT                   /estimated_length=133
FT                   /gap_type="unknown"
FT   assembly_gap    16147789..16147808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16155500..16155587
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            complement(16164296..>16234561)
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /note="gene_id=mCG114236.1"
FT   mRNA            complement(join(16164296..16165946,16171508..16171800,
FT                   16176380..16176532,16180756..16180896,16182298..16182380,
FT                   16182487..16182716,16198985..16199052,16200602..16200704,
FT                   16232914..16233064,16234460..>16234561))
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /product="glycine receptor, beta subunit, transcript
FT                   variant mCT190979"
FT                   /note="gene_id=mCG114236.1 transcript_id=mCT190979.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(16164820..16165946,16171508..16171800,
FT                   16176380..16176532,16180756..16180896,16182298..16182380,
FT                   16182487..16182716,16198985..16199052,16200602..16200708,
FT                   16232914..16233064,16234460..16234480))
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /product="glycine receptor, beta subunit, transcript
FT                   variant mCT115327"
FT                   /note="gene_id=mCG114236.1 transcript_id=mCT115327.0
FT                   created on 03-SEP-2002"
FT   CDS             complement(join(16165653..16165946,16171508..16171800,
FT                   16176380..16176532,16180756..16180896,16182298..16182380,
FT                   16182487..16182716,16198985..16199052,16200602..16200708,
FT                   16232914..16233035))
FT                   /codon_start=1
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /product="glycine receptor, beta subunit, isoform CRA_a"
FT                   /note="gene_id=mCG114236.1 transcript_id=mCT115327.0
FT                   protein_id=mCP65858.1 isoform=CRA_a"
FT                   /db_xref="GOA:P48168"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008060"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95751"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48168"
FT                   /protein_id="EDL15445.1"
FT                   /translation="MKFSLAISFFILMSLLFEDACAKEKSSKKGKGKKKQYLCPSQQSP
FT                   EDLARVPPNSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVN
FT                   IFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILL
FT                   FIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQ
FT                   LEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIV
FT                   VLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFG
FT                   FASLVEYAVVQVMLNNPKRVEAEKARIAKAEQADGKGGNAAKKNTVNGTGTPVHISTLQ
FT                   VGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKPQAKNKKP
FT                   PPAKPVIPTAAKRIDLYARALFPFCFLFFNVIYWSIYL"
FT   CDS             complement(join(16165653..16165946,16171508..16171800,
FT                   16176380..16176532,16180756..16180896,16182298..16182380,
FT                   16182487..16182716,16198985..16199052,16200602..16200704,
FT                   16232914..>16232967))
FT                   /codon_start=1
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /product="glycine receptor, beta subunit, isoform CRA_b"
FT                   /note="gene_id=mCG114236.1 transcript_id=mCT190979.0
FT                   protein_id=mCP111934.0 isoform=CRA_b"
FT                   /protein_id="EDL15446.1"
FT                   /translation="RKVFQEREGEKEAVLVPIQSPEDLARVPPNSTSNILNRLLVSYDP
FT                   RIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDAL
FT                   TVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDL
FT                   TLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKY
FT                   YKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFS
FT                   VLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPKRVEAEK
FT                   ARIAKAEQADGKGGNAAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIV
FT                   GSLPRDFELSNYDCYGKPIEVNNGLGKPQAKNKKPPPAKPVIPTAAKRIDLYARALFPF
FT                   CFLFFNVIYWSIYL"
FT   assembly_gap    16219169..16219279
FT                   /estimated_length=111
FT                   /gap_type="unknown"
FT   assembly_gap    16229483..16229575
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    16245732..16246746
FT                   /estimated_length=1015
FT                   /gap_type="unknown"
FT   assembly_gap    16248176..16248195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16250186..16254347
FT                   /estimated_length=4162
FT                   /gap_type="unknown"
FT   assembly_gap    16255418..16255437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16264331..16264350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16265820..16265839
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16274614..16274633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16275835..16278022
FT                   /estimated_length=2188
FT                   /gap_type="unknown"
FT   assembly_gap    16306212..16307555
FT                   /estimated_length=1344
FT                   /gap_type="unknown"
FT   assembly_gap    16308438..16309697
FT                   /estimated_length=1260
FT                   /gap_type="unknown"
FT   assembly_gap    16314114..16314133
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16315176..16315195
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16322653..16323696
FT                   /estimated_length=1044
FT                   /gap_type="unknown"
FT   assembly_gap    16333171..16333190
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16334479..16334498
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16335726..16335745
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16340324..16340343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16342558..16342577
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16343660..16343679
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            16347783..16348312
FT                   /pseudo
FT                   /locus_tag="mCG_49849"
FT                   /note="gene_id=mCG49849.2"
FT   mRNA            16347783..16348312
FT                   /pseudo
FT                   /locus_tag="mCG_49849"
FT                   /note="gene_id=mCG49849.2 transcript_id=mCT50032.2 created
FT                   on 28-MAR-2003"
FT   gene            <16383936..16558723
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /note="gene_id=mCG21610.3"
FT   mRNA            join(<16383936..16384318,16475819..16475877,
FT                   16486212..16486407,16519641..16519821,16548922..16549129,
FT                   16553729..16553946,16557151..16558719)
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   transcript variant mCT190931"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT190931.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(16384004..16384318,16486212..16486407,
FT                   16519641..16519821,16548922..16549129,16553729..16553946,
FT                   16557151..16558723)
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   transcript variant mCT19557"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT19557.2 created
FT                   on 28-AUG-2002"
FT   mRNA            join(<16384186..16384318,16475819..16475877,
FT                   16486212..16486407,16519641..16519821,16548922..16549129,
FT                   16553729..16555459)
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   transcript variant mCT190930"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT190930.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(16384201..16384318,16486212..16486407,
FT                   16519641..16519821,16548922..16549129,16553729..16553946,
FT                   16557151..16557267)
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT19557.2
FT                   protein_id=mCP11555.2 isoform=CRA_c"
FT                   /protein_id="EDL15444.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDIC
FT                   KYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
FT   assembly_gap    16395383..16395402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16400008..16400027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16401969..16402034
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    16415565..16415584
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16417521..16417540
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16429506..16429553
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    16434056..16434075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16460535..16460701
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    16461605..16461624
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16462865..16463124
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   CDS             join(<16475853..16475877,16486212..16486407,
FT                   16519641..16519821,16548922..16549129,16553729..16553946,
FT                   16557151..16557267)
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT190931.0
FT                   protein_id=mCP111898.0 isoform=CRA_b"
FT                   /protein_id="EDL15443.1"
FT                   /translation="KRGERTLKGVQDPRHERVVTISGNGSIHSPKFPHTYPRNMVLVWR
FT                   LVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVLGRWCGSGTVPGKQTS
FT                   KGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSSLSLDLLNNAVTAFS
FT                   TLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNLLKEEVKLYSCTPR
FT                   NFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLR
FT                   PKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG"
FT   CDS             join(<16475853..16475877,16486212..16486407,
FT                   16519641..16519821,16548922..16549129,16553729..16554135)
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT190930.0
FT                   protein_id=mCP111897.0 isoform=CRA_a"
FT                   /protein_id="EDL15442.1"
FT                   /translation="KRGERTLKGVQDPRHERVVTISGNGSIHSPKFPHTYPRNMVLVWR
FT                   LVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVLGRWCGSGTVPGKQTS
FT                   KGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSSLSLDLLNNAVTAFS
FT                   TLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNLLKEEVKLYSCTPR
FT                   NFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVRTSF
FT                   STQFLWDVFFPNNKRMNLKYSGDYNPVPVLEIQASHLEGVPMFLFSLLRAFHLRHKH"
FT   assembly_gap    16534429..16534844
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    16541061..16541369
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    16561202..16561221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16578840..16578859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16579928..16579947
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16583762..16583781
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16585470..16591715
FT                   /estimated_length=6246
FT                   /gap_type="unknown"
FT   assembly_gap    16595606..16595802
FT                   /estimated_length=197
FT                   /gap_type="unknown"
FT   assembly_gap    16598312..16598331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16604522..16607541
FT                   /estimated_length=3020
FT                   /gap_type="unknown"
FT   assembly_gap    16624976..16625009
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    16641125..16641144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16658243..16658262
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16668150..16668169
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16682461..16682700
FT                   /estimated_length=240
FT                   /gap_type="unknown"
FT   assembly_gap    16759018..16759148
FT                   /estimated_length=131
FT                   /gap_type="unknown"
FT   assembly_gap    16801014..16801033
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16810467..16810506
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    16840949..16841219
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    16843330..16844089
FT                   /estimated_length=760
FT                   /gap_type="unknown"
FT   assembly_gap    16845785..16845804
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16846835..16846854
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16848191..16848670
FT                   /estimated_length=480
FT                   /gap_type="unknown"
FT   assembly_gap    16850290..16850309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16852088..16852107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16855578..16857106
FT                   /estimated_length=1529
FT                   /gap_type="unknown"
FT   assembly_gap    16858328..16859052
FT                   /estimated_length=725
FT                   /gap_type="unknown"
FT   assembly_gap    16860165..16860758
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    16864036..16864851
FT                   /estimated_length=816
FT                   /gap_type="unknown"
FT   assembly_gap    16943496..16943515
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    16968631..16971922
FT                   /estimated_length=3292
FT                   /gap_type="unknown"
FT   assembly_gap    16985874..16989718
FT                   /estimated_length=3845
FT                   /gap_type="unknown"
FT   assembly_gap    17005012..17005170
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    17045924..17046141
FT                   /estimated_length=218
FT                   /gap_type="unknown"
FT   assembly_gap    17049086..17049105
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17057265..17057433
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    17060851..17060870
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17062122..17062141
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17067235..17068291
FT                   /estimated_length=1057
FT                   /gap_type="unknown"
FT   assembly_gap    17069640..17069659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17070943..17070962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17081906..17081925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17106084..17106166
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    17117306..17121372
FT                   /estimated_length=4067
FT                   /gap_type="unknown"
FT   assembly_gap    17122150..17122321
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   gene            17143996..17147090
FT                   /locus_tag="mCG_147522"
FT                   /note="gene_id=mCG147522.0"
FT   mRNA            join(17143996..17144375,17146319..17147090)
FT                   /locus_tag="mCG_147522"
FT                   /product="mCG147522"
FT                   /note="gene_id=mCG147522.0 transcript_id=mCT187785.0
FT                   created on 13-JAN-2004"
FT   CDS             17144080..17144292
FT                   /codon_start=1
FT                   /locus_tag="mCG_147522"
FT                   /product="mCG147522"
FT                   /note="gene_id=mCG147522.0 transcript_id=mCT187785.0
FT                   protein_id=mCP109366.0"
FT                   /protein_id="EDL15441.1"
FT                   /translation="MTGIHHGENVSHREEAFSMFEHGHEIVITTSVMHIKQNVAVLLWM
FT                   CSLILDWIITWKACASLSLENDLHQ"
FT   assembly_gap    17184662..17185077
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    17212496..17212732
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   gene            17274155..17297145
FT                   /gene="Ctso"
FT                   /locus_tag="mCG_21957"
FT                   /note="gene_id=mCG21957.2"
FT   mRNA            join(17274155..17274337,17283098..17283203,
FT                   17283759..17283898,17286424..17286591,17287874..17287995,
FT                   17292946..17293109,17293770..17293862,17295797..17297145)
FT                   /gene="Ctso"
FT                   /locus_tag="mCG_21957"
FT                   /product="cathepsin O"
FT                   /note="gene_id=mCG21957.2 transcript_id=mCT22155.2 created
FT                   on 25-OCT-2002"
FT   CDS             join(17274227..17274337,17283098..17283203,
FT                   17283759..17283898,17286424..17286591,17287874..17287995,
FT                   17292946..17293109,17293770..17293862,17295797..17295831)
FT                   /codon_start=1
FT                   /gene="Ctso"
FT                   /locus_tag="mCG_21957"
FT                   /product="cathepsin O"
FT                   /note="gene_id=mCG21957.2 transcript_id=mCT22155.2
FT                   protein_id=mCP11550.2"
FT                   /protein_id="EDL15440.1"
FT                   /translation="MKPQLVNLLLLCCCCLGRRGVAGTWSWSHQREAAALRESLHRHRY
FT                   LNSFPHENSTAFYGVNQFSYLFPEEFKALYLGSKYAWAPRYPAEGQRPIPNVSLPLRFD
FT                   WRDKHVVNPVRNQEMCGGCWAFSVVSAIESARAIQGKSLDYLSVQQVIDCSFNNSGCLG
FT                   GSPLCALRWLNETQLKLVADSQYPFKAVNGQCRHFPQSQAGVSVKDFSAYNFRGQEDEM
FT                   ARALLSFGPLVVIVDAMSWQDYLGGIIQHHCSSGEANHAVLITGFDRTGNTPYWMVRNS
FT                   WGSSWGVEGYAHVKMGGNVCGIADSVAAVFV"
FT   gene            complement(17299959..17317356)
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /note="gene_id=mCG21956.2"
FT   mRNA            complement(join(17299959..17300538,17302060..17302150,
FT                   17303030..17303109,17304322..17304379,17305518..17305629,
FT                   17308582..17308689,17309683..17309869,17311082..17311209,
FT                   17313253..17313323,17315925..17316015,17316929..17317034,
FT                   17317264..17317356))
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /product="tryptophan 2,3-dioxygenase, transcript variant
FT                   mCT22151"
FT                   /note="gene_id=mCG21956.2 transcript_id=mCT22151.1 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(17300385..17300538,17302060..17302150,
FT                   17303030..17303109,17304322..17304379,17305518..17305629,
FT                   17308582..17308689,17309683..17309869,17311082..17311209,
FT                   17313253..17313323,17315925..17316015,17316929..17317034,
FT                   17317264..17317298))
FT                   /codon_start=1
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /product="tryptophan 2,3-dioxygenase, isoform CRA_b"
FT                   /note="gene_id=mCG21956.2 transcript_id=mCT22151.1
FT                   protein_id=mCP11540.1 isoform=CRA_b"
FT                   /protein_id="EDL15439.1"
FT                   /translation="MSGCPFAGNSVGYTLKNLSMEDNEEDRAQTGVNRASKGGLIYGNY
FT                   LQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRD
FT                   ERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLEN
FT                   KIGVLQSLRVPYNRKHYRDNFGGDYNELLLKSEQEQTLLQLVEAWLERTPGLEPNGFNF
FT                   WGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAEFRKQKEVLLCLFDEKRHDYLLSKGE
FT                   RRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGTKA
FT                   GTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPIIHKFLYTAEYSDSSY
FT                   FSSDESD"
FT   mRNA            complement(join(17302091..17302150,17303030..17303078,
FT                   17311078..17311209,17313253..17313323,17315925..17316015,
FT                   17316929..17317034,17317264..17317355))
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /product="tryptophan 2,3-dioxygenase, transcript variant
FT                   mCT181548"
FT                   /note="gene_id=mCG21956.2 transcript_id=mCT181548.0 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(17311078..17311209,17313253..17313323,
FT                   17315925..17316015,17316929..17317034,17317264..17317298))
FT                   /codon_start=1
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /product="tryptophan 2,3-dioxygenase, isoform CRA_a"
FT                   /note="gene_id=mCG21956.2 transcript_id=mCT181548.0
FT                   protein_id=mCP104470.0 isoform=CRA_a"
FT                   /protein_id="EDL15438.1"
FT                   /translation="MSGCPFAGNSVGYTLKNLSMEDNEEDRAQTGVNRASKGGLIYGNY
FT                   LQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRD
FT                   ERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFR"
FT   assembly_gap    17312383..17312673
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   gene            17323908..17362423
FT                   /gene="Accn5"
FT                   /locus_tag="mCG_21955"
FT                   /note="gene_id=mCG21955.2"
FT   mRNA            join(17323908..17324051,17332075..17332169,
FT                   17338595..17338794,17341385..17341691,17346224..17346461,
FT                   17348259..17348384,17350236..17350385,17351246..17351393,
FT                   17353157..17353213,17355468..17355636,17360605..17360696,
FT                   17362123..17362423)
FT                   /gene="Accn5"
FT                   /locus_tag="mCG_21955"
FT                   /product="amiloride-sensitive cation channel 5, intestinal"
FT                   /note="gene_id=mCG21955.2 transcript_id=mCT22154.1 created
FT                   on 22-AUG-2002"
FT   assembly_gap    17335734..17335891
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   CDS             join(17338755..17338794,17341385..17341691,
FT                   17346224..17346461,17348259..17348384,17350236..17350385,
FT                   17351246..17351393,17353157..17353213,17355468..17355636,
FT                   17360605..17360696,17362123..17362283)
FT                   /codon_start=1
FT                   /gene="Accn5"
FT                   /locus_tag="mCG_21955"
FT                   /product="amiloride-sensitive cation channel 5, intestinal"
FT                   /note="gene_id=mCG21955.2 transcript_id=mCT22154.1
FT                   protein_id=mCP11538.1"
FT                   /protein_id="EDL15437.1"
FT                   /translation="MEHTEKSQVHAEKGLLGKIKRYLSKRPLPSPTDRKKFDQDFAMST
FT                   SFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKI
FT                   EFPAVTLCNLNRFQTEAVSRFGIIFFLWDIVSKVLRLQEISANNTGSPETLDFVTNHQN
FT                   FSITEFVKNNGFYLNNDTLVHCEFFGKTCSPKDFKHVFTEYGNCFTFNYGENIQNKNKV
FT                   SVSGRGLKLLLDVHQEEFTDNPVPGFADAGVIFVIHSPKKEPQFDGLGLSSPVGMHARV
FT                   TIRQLKTVHQEYPWGECNPNIKLRNFITYSTYGCLKECKARHIQRLCGCLPFLLPGNGV
FT                   ECDLLEYYNCVSPILDHIERKGLCTMGTHNSSCPVSCEETEYPATVSYSTFPSQRATRF
FT                   LAKKLNQSQEYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLI
FT                   TIIEIIEYFFTNFYWVLIFFLLKILETIQRTSPPQAV"
FT   assembly_gap    17360994..17361013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17373212..>17415838)
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /note="gene_id=mCG21954.2"
FT   mRNA            complement(join(17373212..17374448,17375479..17375588,
FT                   17375909..17376063,17376447..17376587,17379082..17379319,
FT                   17380891..17381088,17384284..17384417,17385293..17385409,
FT                   17386555..17386785,17387669..17387866,17399369..17399487,
FT                   17402147..17402247,17415148..17415221,17415721..>17415838))
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /product="guanylate cyclase 1, soluble, beta 3, transcript
FT                   variant mCT190996"
FT                   /note="gene_id=mCG21954.2 transcript_id=mCT190996.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(17374094..17374448,17375479..17375605,
FT                   17375909..17376063,17376447..17376587,17379082..17379319,
FT                   17380891..17381088,17384284..17384417,17385293..17385409,
FT                   17386555..17386785,17387669..17387866,17399369..17399487,
FT                   17402147..17402247,17415148..17415221,17415721..17415834))
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /product="guanylate cyclase 1, soluble, beta 3, transcript
FT                   variant mCT22153"
FT                   /note="gene_id=mCG21954.2 transcript_id=mCT22153.2 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(17374422..17374448,17375479..17375605,
FT                   17375909..17376063,17376447..17376587,17379082..17379319,
FT                   17380891..17381088,17384284..17384417,17385293..17385409,
FT                   17386555..17386785,17387669..17387866,17399369..17399487,
FT                   17402147..17402247,17415148..17415221,17415721..17415723))
FT                   /codon_start=1
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /product="guanylate cyclase 1, soluble, beta 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21954.2 transcript_id=mCT22153.2
FT                   protein_id=mCP11566.2 isoform=CRA_b"
FT                   /protein_id="EDL15436.1"
FT                   /translation="MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDD
FT                   SKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDAL
FT                   HDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEID
FT                   MKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHII
FT                   FDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSK
FT                   EGLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYL
FT                   SDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLP
FT                   PSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFD
FT                   TLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESV
FT                   QITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPE
FT                   NSDPLFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETNEEDEN"
FT   CDS             complement(join(17374438..17374448,17375479..17375588,
FT                   17375909..17376063,17376447..17376587,17379082..17379319,
FT                   17380891..17381088,17384284..17384417,17385293..17385409,
FT                   17386555..17386785,17387669..17387866,17399369..17399487,
FT                   17402147..17402247,17415148..17415221,17415721..>17415741))
FT                   /codon_start=1
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /product="guanylate cyclase 1, soluble, beta 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21954.2 transcript_id=mCT190996.0
FT                   protein_id=mCP111947.0 isoform=CRA_a"
FT                   /protein_id="EDL15435.1"
FT                   /translation="APGADTMYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLV
FT                   RIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFL
FT                   QNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQI
FT                   HGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKA
FT                   FPFHIIFDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTV
FT                   FVLRSKEGLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLT
FT                   RRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTL
FT                   LYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLND
FT                   LYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ
FT                   VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYR
FT                   KLGSTVPFGAQRPSVYEGQEGTNASLVPIQEKYRHGGNK"
FT   assembly_gap    17411513..17411532
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(17435788..17487103)
FT                   /gene="Gucy1a3"
FT                   /locus_tag="mCG_21953"
FT                   /note="gene_id=mCG21953.1"
FT   mRNA            complement(join(17435788..17436061,17438771..17438925,
FT                   17443113..17443256,17446891..17447376,17449737..17450446,
FT                   17452296..17452354,17454417..17454478,17460036..17460394,
FT                   17486923..17487103))
FT                   /gene="Gucy1a3"
FT                   /locus_tag="mCG_21953"
FT                   /product="guanylate cyclase 1, soluble, alpha 3"
FT                   /note="gene_id=mCG21953.1 transcript_id=mCT22152.1 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(17435857..17436061,17438771..17438925,
FT                   17443113..17443256,17446891..17447376,17449737..17450446,
FT                   17452296..17452354,17454417..17454478,17460036..17460290))
FT                   /codon_start=1
FT                   /gene="Gucy1a3"
FT                   /locus_tag="mCG_21953"
FT                   /product="guanylate cyclase 1, soluble, alpha 3"
FT                   /note="gene_id=mCG21953.1 transcript_id=mCT22152.1
FT                   protein_id=mCP11557.2"
FT                   /protein_id="EDL15434.1"
FT                   /translation="MFCRKFKDLKITGECPFSLLAPGQVPKEPTEEVAGGSEGCQATLP
FT                   ICQYFPEKNAEGSLPQRKTSRNRVYLHTLAESICKLIFPECERLNLALQRTLAKHKIEE
FT                   NRKSSEKEDLEKIIAEEAIAAGAPVEALKDSLGEELFKICYEEDEHILGVVGGTLKDFL
FT                   NSFSTLLKQSSHCQEAERRGRLEDASILCLDKDQDFLNVYYFFPKRTTALLLPGIIKAA
FT                   ARILYESHVEVSLMPPCFRSDCTEFVNQPYLLYSVHVKSTKPSLSPGKPQSSLVIPASL
FT                   FCKTFPFHFMLDRDLAILQLGNGIRRLVNKRDFQGKPSFEEFFEILTPKINQTFSGIMT
FT                   MLNMQFVIRVRRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLY
FT                   LSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEHAHQALEEEKKRTVDLLCSIF
FT                   PSEVAQQLWQGQIVQAKKFSEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQC
FT                   GELDVYKVETIGDAYCVAGGLHRESDTHAVQIALMALKMMELSNEVMSPHGEPIKMRIG
FT                   LHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFT
FT                   PRSREELPPNFPSDIPGICHFLDAYHHQGPNSKPWFQDKDVEDGNANFLGKASGVD"
FT   assembly_gap    17478653..17478672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17491042..17491176
FT                   /estimated_length=135
FT                   /gap_type="unknown"
FT   assembly_gap    17507327..17507346
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17508532..17508551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17509636..17509655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17535631..17535729
FT                   /estimated_length=99
FT                   /gap_type="unknown"
FT   assembly_gap    17544444..17544463
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17546950..17547061
FT                   /estimated_length=112
FT                   /gap_type="unknown"
FT   assembly_gap    17552418..17552437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17553824..17553843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17599496..17599636
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    17617232..17617251
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17627092..17627313
FT                   /estimated_length=222
FT                   /gap_type="unknown"
FT   assembly_gap    17633389..17633483
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    17646325..17646571
FT                   /estimated_length=247
FT                   /gap_type="unknown"
FT   assembly_gap    17657031..17657050
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17665885..17665932
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    17691747..17691947
FT                   /estimated_length=201
FT                   /gap_type="unknown"
FT   gene            17698467..17723961
FT                   /locus_tag="mCG_113722"
FT                   /note="gene_id=mCG113722.1"
FT   mRNA            join(17698467..17698526,17699246..17699395,
FT                   17700161..17700245,17703562..17703885,17711450..17711673,
FT                   17714412..17714505,17717225..17717469,17719239..17719309,
FT                   17720380..17720555,17721978..17722067,17723292..17723453,
FT                   17723600..17723745,17723929..17723961)
FT                   /locus_tag="mCG_113722"
FT                   /product="mCG113722, transcript variant mCT114808"
FT                   /note="gene_id=mCG113722.1 transcript_id=mCT114808.1
FT                   created on 14-NOV-2002"
FT   mRNA            join(<17698487..17698526,17699246..17699395,
FT                   17700161..17700245,17703562..17703885,17711450..17711673,
FT                   17714412..17714505,17717225..17717469,17719239..17719309,
FT                   17720380..17720548,17721978..17722067,17723292..>17723394)
FT                   /locus_tag="mCG_113722"
FT                   /product="mCG113722, transcript variant mCT190987"
FT                   /note="gene_id=mCG113722.1 transcript_id=mCT190987.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<17699288..17699395,17700161..17700245,
FT                   17703562..17703885,17711450..17711673,17714412..17714505,
FT                   17717225..17717469,17719239..17719309,17720380..17720548,
FT                   17721978..17722067,17723292..>17723394)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113722"
FT                   /product="mCG113722, isoform CRA_b"
FT                   /note="gene_id=mCG113722.1 transcript_id=mCT190987.0
FT                   protein_id=mCP111932.0 isoform=CRA_b"
FT                   /protein_id="EDL15433.1"
FT                   /translation="LLYKSREKGHTMSDEIFSTTLAYTKSPKATKRTSFQDELIRAITA
FT                   RSARQRSSEYSDDFDSDEIVSLGEFSDTSTDESLVRKKMNDFHISDDEEKNSPRLSFLK
FT                   TKKVNRAISNDALDSSTPGSEGSSPDAQEDVTGDSLPKSQNDDREVGREIITVKPTPRM
FT                   HPVKRSTSSGETSSGLDADGHFKPSPQPRSMLKKSSHTEEGVRPGVDKEHSISEASAPT
FT                   PSLPRQNGTELQTEEKIYSENLDLEDSLLQSLTSSSFKESPGGCTSPGSQEKAPMKDHD
FT                   GEPTEIWDSLLSNENEGSSVLVNCVTPELEQPKDGQVAADDLEEEREKGGFTEDDLTTD
FT                   PLLSTSPSVITPTEPAEPAKKANEDRNTKNKKTTNNRVSSASGRLMTSEFLKRSGPTKR
FT                   SPSAATSSHYLGSLKVLDQKQPRKQSLEPDKADHIRAAVYQEWLEKKNVYLHEMHRIKR
FT                   IESENLRIQNEQKKAAKREEALASFEAWKAMKEKEAKRIAAKKRLE"
FT   CDS             join(17699321..17699395,17700161..17700245,
FT                   17703562..17703885,17711450..17711673,17714412..17714505,
FT                   17717225..17717469,17719239..17719309,17720380..17720555,
FT                   17721978..17722012)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113722"
FT                   /product="mCG113722, isoform CRA_a"
FT                   /note="gene_id=mCG113722.1 transcript_id=mCT114808.1
FT                   protein_id=mCP65888.1 isoform=CRA_a"
FT                   /protein_id="EDL15432.1"
FT                   /translation="MSDEIFSTTLAYTKSPKATKRTSFQDELIRAITARSARQRSSEYS
FT                   DDFDSDEIVSLGEFSDTSTDESLVRKKMNDFHISDDEEKNSPRLSFLKTKKVNRAISND
FT                   ALDSSTPGSEGSSPDAQEDVTGDSLPKSQNDDREVGREIITVKPTPRMHPVKRSTSSGE
FT                   TSSGLDADGHFKPSPQPRSMLKKSSHTEEGVRPGVDKEHSISEASAPTPSLPRQNGTEL
FT                   QTEEKIYSENLDLEDSLLQSLTSSSFKESPGGCTSPGSQEKAPMKDHDGEPTEIWDSLL
FT                   SNENEGSSVLVNCVTPELEQPKDGQVAADDLEEEREKGGFTEDDLTTDPLLSTSPSVIT
FT                   PTEPAEPAKKANEDRNTKNKKTTNNRVSSASGRLMTSEFLKRSGPTKRSPSAATSSHYL
FT                   GSLKVLDQKQPRKQSLEPDKADHIRAAVYQVKGVVRKEKCVFT"
FT   assembly_gap    17739175..17739437
FT                   /estimated_length=263
FT                   /gap_type="unknown"
FT   assembly_gap    17754446..17754465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17759554..17759573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17760968..17760987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17781622..17781641
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17791839..17791858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17795511..17795530
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17802750..17805631
FT                   /estimated_length=2882
FT                   /gap_type="unknown"
FT   assembly_gap    17837716..17837807
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   gene            complement(17873745..17883404)
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /note="gene_id=mCG21952.1"
FT   mRNA            complement(join(17873745..17876856,17883150..17883404))
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /product="neuropeptide Y receptor Y2, transcript variant
FT                   mCT22150"
FT                   /note="gene_id=mCG21952.1 transcript_id=mCT22150.1 created
FT                   on 26-MAR-2003"
FT   mRNA            complement(join(17873748..17876856,17883154..17883369))
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /product="neuropeptide Y receptor Y2, transcript variant
FT                   mCT181547"
FT                   /note="gene_id=mCG21952.1 transcript_id=mCT181547.0 created
FT                   on 26-MAR-2003"
FT   CDS             complement(17875683..17876828)
FT                   /codon_start=1
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /product="neuropeptide Y receptor Y2, isoform CRA_a"
FT                   /note="gene_id=mCG21952.1 transcript_id=mCT181547.0
FT                   protein_id=mCP104469.0 isoform=CRA_a"
FT                   /db_xref="GOA:P97295"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR001358"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:108418"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97295"
FT                   /protein_id="EDL15430.1"
FT                   /translation="MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTK
FT                   LVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCL
FT                   PFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKR
FT                   ISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLS
FT                   TLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSW
FT                   LPLHAFQLAVDIDSHVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAF
FT                   RCEQRLDAIHSEVSMTFKAKKNLEVKKNNGPTDSFSEATNV"
FT   CDS             complement(17875683..17876828)
FT                   /codon_start=1
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /product="neuropeptide Y receptor Y2, isoform CRA_a"
FT                   /note="gene_id=mCG21952.1 transcript_id=mCT22150.1
FT                   protein_id=mCP11556.2 isoform=CRA_a"
FT                   /db_xref="GOA:P97295"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR001358"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:108418"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97295"
FT                   /protein_id="EDL15431.1"
FT                   /translation="MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTK
FT                   LVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCL
FT                   PFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKR
FT                   ISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLS
FT                   TLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSW
FT                   LPLHAFQLAVDIDSHVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAF
FT                   RCEQRLDAIHSEVSMTFKAKKNLEVKKNNGPTDSFSEATNV"
FT   gene            complement(17879375..17932926)
FT                   /locus_tag="mCG_147523"
FT                   /note="gene_id=mCG147523.0"
FT   mRNA            complement(join(17879375..17881527,17932909..17932926))
FT                   /locus_tag="mCG_147523"
FT                   /product="mCG147523"
FT                   /note="gene_id=mCG147523.0 transcript_id=mCT187786.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17880750..17880929)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147523"
FT                   /product="mCG147523"
FT                   /note="gene_id=mCG147523.0 transcript_id=mCT187786.0
FT                   protein_id=mCP109368.0"
FT                   /protein_id="EDL15429.1"
FT                   /translation="MSASLECHSKELRFTLVRKQIKMCFEHIMNQKIPFRAVDAKESTN
FT                   RDGYIRGGGMKTES"
FT   assembly_gap    17898570..17898589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17924106..17924125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17932132..17932389
FT                   /estimated_length=258
FT                   /gap_type="unknown"
FT   assembly_gap    17951907..17951926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17962483..17962502
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    17973638..17974458
FT                   /estimated_length=821
FT                   /gap_type="unknown"
FT   assembly_gap    17990010..17990029
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18050393..18052059
FT                   /estimated_length=1667
FT                   /gap_type="unknown"
FT   assembly_gap    18054134..18054187
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    18085675..18085818
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   gene            complement(<18190971..18193716)
FT                   /locus_tag="mCG_21951"
FT                   /note="gene_id=mCG21951.1"
FT   mRNA            complement(join(<18190971..18191755,18192273..18192740,
FT                   18193554..18193716))
FT                   /locus_tag="mCG_21951"
FT                   /product="mCG21951"
FT                   /note="gene_id=mCG21951.1 transcript_id=mCT22149.1 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(<18190971..18191755,18192273..18192740,
FT                   18193554..18193704))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21951"
FT                   /product="mCG21951"
FT                   /note="gene_id=mCG21951.1 transcript_id=mCT22149.1
FT                   protein_id=mCP11545.1"
FT                   /protein_id="EDL15428.1"
FT                   /translation="MNEENTDGTNGCSKVRTGTQNEAALLALMEKTGYNMVQENGQRKF
FT                   GGPPPGWEGPPPPRGCEVFVGKIPRDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYA
FT                   FVMYTTKEEAQLAIRILNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKK
FT                   VTEGVVDVIVYPSATDKTKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWAD
FT                   PEKEVDEETMQRVKVLYVRNLMISTTEETIKAEFSKFKPGAVERVKKLRDYAFVHFFHR
FT                   EDAVAAMSVMNGKCIDGASIEVTLAKPVNKENTWRQHLNGQISPNSENLLVYANKEESH
FT                   SKSLGKPPTLPTRLNGQHSPSPPEIERCTYPFFPGTKLTPISMYSLKSNHFNSAVMHLD
FT                   YYCNKNNWAPPEYYLYSTTSQDGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKEL
FT                   AAQFTLLHLG"
FT   gene            <18203761..18270685
FT                   /locus_tag="mCG_1032384"
FT                   /note="gene_id=mCG1032384.1"
FT   mRNA            join(<18203761..18203817,18205755..18205884,
FT                   18267780..18268027,18269723..18270685)
FT                   /locus_tag="mCG_1032384"
FT                   /product="mCG1032384"
FT                   /note="gene_id=mCG1032384.1 transcript_id=mCT150088.1
FT                   created on 28-MAR-2003"
FT   gene            complement(18222334..18230892)
FT                   /gene="Lrat"
FT                   /locus_tag="mCG_113718"
FT                   /note="gene_id=mCG113718.0"
FT   mRNA            complement(join(18222334..18224064,18230086..18230892))
FT                   /gene="Lrat"
FT                   /locus_tag="mCG_113718"
FT                   /product="lecithin-retinol acyltransferase
FT                   (phosphatidylcholine-retinol-O-acyltransferase)"
FT                   /note="gene_id=mCG113718.0 transcript_id=mCT114804.0
FT                   created on 03-SEP-2002"
FT   CDS             complement(join(18223909..18224064,18230086..18230625))
FT                   /codon_start=1
FT                   /gene="Lrat"
FT                   /locus_tag="mCG_113718"
FT                   /product="lecithin-retinol acyltransferase
FT                   (phosphatidylcholine-retinol-O-acyltransferase)"
FT                   /note="gene_id=mCG113718.0 transcript_id=mCT114804.0
FT                   protein_id=mCP65865.1"
FT                   /db_xref="GOA:B2RUR5"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="MGI:MGI:1891259"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUR5"
FT                   /protein_id="EDL15427.1"
FT                   /translation="MKNPMLEAASLLLEKLLLISNFKLFSVSVPGGGTGKNRPYEISSF
FT                   VRGDVLEVSRTHFIHYGIYLGENRVAHLMPDILLALTNDKERTQKVVSNKRLLLGVICK
FT                   VASIRVDTVEDFAYGADILVNHLDGTLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEH
FT                   FVTYCRYGSRISPQAEKFYDTVKIIIRDQRSSLASAVLGLASIVYTGLASYMTLPAICI
FT                   PFCLWMMSG"
FT   assembly_gap    18231861..18232153
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    18237961..18240211
FT                   /estimated_length=2251
FT                   /gap_type="unknown"
FT   assembly_gap    18256746..18257080
FT                   /estimated_length=335
FT                   /gap_type="unknown"
FT   CDS             join(<18267847..18268027,18269723..18270036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032384"
FT                   /product="mCG1032384"
FT                   /note="gene_id=mCG1032384.1 transcript_id=mCT150088.1
FT                   protein_id=mCP65869.1"
FT                   /protein_id="EDL15426.1"
FT                   /translation="KMIIEHWVWQLCRKTWKQLKVFLPLLVCFWKPSEAIRQTNLACLL
FT                   CCHTGLEHVGRINVPEIQLLEKRRLDLFSENFVENLPGIGEMAQQFKALTALPEDVSSI
FT                   PSTHMRFTTVCDSSSKGFYALIILQAFTWYINIHEGKPPIHINNKSVHLSSSQTAHPDR
FT                   F"
FT   assembly_gap    18291388..18291615
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   gene            18328159..18335415
FT                   /gene="Fgg"
FT                   /locus_tag="mCG_141536"
FT                   /note="gene_id=mCG141536.0"
FT   mRNA            join(18328159..18328400,18328535..18328579,
FT                   18328756..18328939,18329030..18329123,18330445..18330575,
FT                   18330837..18330970,18331714..18331898,18333133..18333410,
FT                   18334507..18334676,18335204..18335415)
FT                   /gene="Fgg"
FT                   /locus_tag="mCG_141536"
FT                   /product="fibrinogen, gamma polypeptide"
FT                   /note="gene_id=mCG141536.0 transcript_id=mCT175884.0
FT                   created on 15-NOV-2002"
FT   CDS             join(18328326..18328400,18328535..18328579,
FT                   18328756..18328939,18329030..18329123,18330445..18330575,
FT                   18330837..18330970,18331714..18331898,18333133..18333410,
FT                   18334507..18334676,18335204..18335218)
FT                   /codon_start=1
FT                   /gene="Fgg"
FT                   /locus_tag="mCG_141536"
FT                   /product="fibrinogen, gamma polypeptide"
FT                   /note="gene_id=mCG141536.0 transcript_id=mCT175884.0
FT                   protein_id=mCP98805.0"
FT                   /protein_id="EDL15425.1"
FT                   /translation="MSWSLQPPSFLLCCVLLLFSPTGLAYVATRDNCCILDERFGSFCP
FT                   TTCGIADFLSSYQTDVDNDLRTLEDILFRAENRTTEAKELIKAIQVYYNPDQPPKPGMI
FT                   DSATQKSKKMVEEIVKYEALLLTHETSIRYLQEIYNSNNQKITNLKQKVAQLEAQCQEP
FT                   CKDSVQIHDTTGKDCQEIANKGAKESGLYFIRPLKAKQQFLVYCEIDGSGNGWTVLQKR
FT                   IDGSLDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWNGR
FT                   TSTADYAMFRVGPESDKYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTW
FT                   DNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYHQGGTYSKSSTTNGFDDGIIWATWKS
FT                   RWYSMKETTMKIIPFNRLSIGEGQQHHMGGSKQAGDV"
FT   assembly_gap    18344211..18344336
FT                   /estimated_length=126
FT                   /gap_type="unknown"
FT   gene            18346595..18354052
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /note="gene_id=mCG141537.0"
FT   mRNA            join(18346595..18346709,18348968..18349096,
FT                   18349528..18349711,18350631..18350776,18351279..18352425,
FT                   18353137..18354052)
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /product="fibrinogen, alpha polypeptide, transcript variant
FT                   mCT175883"
FT                   /note="gene_id=mCG141537.0 transcript_id=mCT175883.0
FT                   created on 15-NOV-2002"
FT   mRNA            join(<18346604..18346709,18348968..18349096,
FT                   18349528..18349711,18350631..18350776,18351279..18352706)
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /product="fibrinogen, alpha polypeptide, transcript variant
FT                   mCT190950"
FT                   /note="gene_id=mCG141537.0 transcript_id=mCT190950.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<18346605..18346709,18348968..18349096,
FT                   18349528..18349711,18350631..18350776,18351279..18352439)
FT                   /codon_start=1
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /product="fibrinogen, alpha polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG141537.0 transcript_id=mCT190950.0
FT                   protein_id=mCP111877.0 isoform=CRA_b"
FT                   /protein_id="EDL15424.1"
FT                   /translation="LRFSSSSPHEPSLSADTMLSLRVACLILSVASTVWTTDTEDKGEF
FT                   LSEGGGVRGPRVVERHQSQCKDSDWPFCSDDDWNHKCPSGCRMKGLIDEANQDFTNRIN
FT                   KLKNSLFDFQRNNKDSNSLTRNIMEYLRGDFANANNFDNTYGQVSEDLRRRIEILRRKV
FT                   IEKAQQIQALQSNVRAQLIDMKRLEVDIDIKIRSCKGSCSRAVNREINLQDYEGHQKQL
FT                   QQVIAKELLPTKDRQYLPALKMSPVPDLVPGSFKSQLQEAPPEWKALTEMRQMRMELER
FT                   PGKDGGSRGDSPGDSRGDSRGDFATRGPGSKAENPTNPGPGGSGYWRPGNSGSGSDGNR
FT                   NPGTTGSDGTGDWGTGSPRPGSDSGNFRPANPNWGVFSEFGDSSSPATRKEYHTGKAVT
FT                   SKGDKELLIGKEKVTSSGTSTTHRSCSKTITKTVTGPDGRREVVKEVITSDDGSDCGDA
FT                   TELDISHSFSGSLDELSERHPDLSGFFDNHFGLISPNFKEFGSKTHSDSDILTNIEDPS
FT                   SHVPEFSSSSKTSTVKKQVTKTYKMADEAGSEAHREGETRNTKRGRARARPTRGIDT"
FT   CDS             join(18346656..18346709,18348968..18349096,
FT                   18349528..18349711,18350631..18350776,18351279..18352425,
FT                   18353137..18353846)
FT                   /codon_start=1
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /product="fibrinogen, alpha polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG141537.0 transcript_id=mCT175883.0
FT                   protein_id=mCP98806.0 isoform=CRA_a"
FT                   /protein_id="EDL15423.1"
FT                   /translation="MLSLRVACLILSVASTVWTTDTEDKGEFLSEGGGVRGPRVVERHQ
FT                   SQCKDSDWPFCSDDDWNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQRNNKDSN
FT                   SLTRNIMEYLRGDFANANNFDNTYGQVSEDLRRRIEILRRKVIEKAQQIQALQSNVRAQ
FT                   LIDMKRLEVDIDIKIRSCKGSCSRAVNREINLQDYEGHQKQLQQVIAKELLPTKDRQYL
FT                   PALKMSPVPDLVPGSFKSQLQEAPPEWKALTEMRQMRMELERPGKDGGSRGDSPGDSRG
FT                   DSRGDFATRGPGSKAENPTNPGPGGSGYWRPGNSGSGSDGNRNPGTTGSDGTGDWGTGS
FT                   PRPGSDSGNFRPANPNWGVFSEFGDSSSPATRKEYHTGKAVTSKGDKELLIGKEKVTSS
FT                   GTSTTHRSCSKTITKTVTGPDGRREVVKEVITSDDGSDCGDATELDISHSFSGSLDELS
FT                   ERHPDLSGFFDNHFGLISPNFKEFGSKTHSDSDILTNIEDPSSHVPEFSSSSKTSTVKK
FT                   QVTKTYKMADEAGSEAHREGETRNTKRGRARARPTRDCDDVLQTQTSGAQNGIFSIKPP
FT                   GSSKVFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGND
FT                   YLHLLTLRGSVLRVELEDWAGKEAYAEYHFRVGSEAEGYALQVSSYRGTAGDALVQGSV
FT                   EEGTEYTSHSNMQFSTFDRDADQWEENCAEVYGGGWWYNSCQAANLNGIYYPGGTYDPR
FT                   NNSPYEIENGVVWVPFRGADYSLRAVRMKIRPLVGQ"
FT   gene            complement(18362285..18370275)
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /note="gene_id=mCG17068.1"
FT   mRNA            complement(join(18362285..18363058,18363656..18363941,
FT                   18364201..18364326,18364643..18364756,18365339..18365566,
FT                   18366466..18366649,18367118..18367312,18370145..18370275))
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /product="fibrinogen, B beta polypeptide, transcript
FT                   variant mCT16021"
FT                   /note="gene_id=mCG17068.1 transcript_id=mCT16021.1 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(18362827..18363058,18363656..18363941,
FT                   18364201..18364326,18364643..18364756,18365339..18365566,
FT                   18366466..18366649,18367118..18367312,18370145..18370225))
FT                   /codon_start=1
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /product="fibrinogen, B beta polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG17068.1 transcript_id=mCT16021.1
FT                   protein_id=mCP11543.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TGR2"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR012290"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="InterPro:IPR020837"
FT                   /db_xref="MGI:MGI:99501"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TGR2"
FT                   /protein_id="EDL15421.1"
FT                   /translation="MRHLWLLLLLCVFSVQTQAADDDYDEPTDSLDARGHRPVDRRKEE
FT                   PPSLRPAPPPISGGGYRARPAKATANQKKVERRPPDAGGCLHADTDMGVLCPTGCTLQQ
FT                   TLLNQERPIKSSIAELNNNIQSVSDTSSVTFQYLTLLKDMWKKKQAQVKENENVINEYS
FT                   SILEDQRLYIDETVNDNIPLNLRVLRSILEDLRSKIQKLESDISAQMEYCRTPCTVSCN
FT                   IPVVSGKECEEIIRKGGETSEMYLIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVD
FT                   FGRKWDPYKKGFGNIATNEDAKKYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGD
FT                   KVKAHYGGFTVQNEASKYQVSVNKYKGTAGNALMDGASQLVGENRTMTIHNGMFFSTYD
FT                   RDNDGWVTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGLYSWDMSKHGTDDGVVWM
FT                   NWKGSWYSMRRMSMKIRPFFPQQ"
FT   mRNA            complement(join(18363770..18363941,18364201..18364326,
FT                   18364643..18364756,18367172..18367312,18370145..18370272))
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /product="fibrinogen, B beta polypeptide, transcript
FT                   variant mCT181522"
FT                   /note="gene_id=mCG17068.1 transcript_id=mCT181522.0 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(18364658..18364756,18367172..18367312,
FT                   18370145..18370225))
FT                   /codon_start=1
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /product="fibrinogen, B beta polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG17068.1 transcript_id=mCT181522.0
FT                   protein_id=mCP104444.0 isoform=CRA_b"
FT                   /protein_id="EDL15422.1"
FT                   /translation="MRHLWLLLLLCVFSVQTQAADDDYDEPTDSLDARGHRPVDRRKEE
FT                   PPSLRPAPPPISGGGYRARPAKATANQKKSVRRSLGREVRHPKCISSSLTPPSSRTEYT
FT                   VT"
FT   gene            <18376015..18392737
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /note="gene_id=mCG17066.3"
FT   mRNA            join(<18376015..18376138,18377255..18377361,
FT                   18379092..18379234,18379766..18379819,18380276..18380366,
FT                   18381474..18381561,18386323..18386421,18387120..18387212,
FT                   18388440..18388589,18388701..18388802,18389404..18389506,
FT                   18390130..18390238,18391059..18391172,18391638..18391831,
FT                   18392559..18392737)
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /product="pleiotropic regulator 1, PRL1 homolog
FT                   (Arabidopsis), transcript variant mCT190990"
FT                   /note="gene_id=mCG17066.3 transcript_id=mCT190990.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(18376052..18376138,18377255..18377361,
FT                   18379092..18379234,18379766..18379819,18380276..18380366,
FT                   18381474..18381561,18386323..18386421,18387120..18387212,
FT                   18388440..18388589,18388701..18388802,18389404..18389506,
FT                   18390130..18390238,18391033..18391172,18391638..18391831,
FT                   18392559..>18392618)
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /product="pleiotropic regulator 1, PRL1 homolog
FT                   (Arabidopsis), transcript variant mCT16019"
FT                   /note="gene_id=mCG17066.3 transcript_id=mCT16019.1 created
FT                   on 20-AUG-2002"
FT   CDS             join(<18376061..18376138,18377255..18377361,
FT                   18379092..18379234,18379766..18379819,18380276..18380366,
FT                   18381474..18381561,18386323..18386421,18387120..18387212,
FT                   18388440..18388589,18388701..18388802,18389404..18389506,
FT                   18390130..18390238,18391059..18391062)
FT                   /codon_start=1
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /product="pleiotropic regulator 1, PRL1 homolog
FT                   (Arabidopsis), isoform CRA_a"
FT                   /note="gene_id=mCG17066.3 transcript_id=mCT190990.0
FT                   protein_id=mCP111943.0 isoform=CRA_a"
FT                   /protein_id="EDL15419.1"
FT                   /translation="WRRFLRRLFEFLRCWRGRLNGGDMVEEVQKHSVHTLVFRSLKRTH
FT                   DMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYPHKQ
FT                   YPANQGQDVEYLVTGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPSQTRVDANR
FT                   TGPAGSEYRHPGASDRSQPTAMNSIMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVI
FT                   SGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSP
FT                   YLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVR
FT                   TKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRA
FT                   VVLHPLL"
FT   CDS             join(18376130..18376138,18377255..18377361,
FT                   18379092..18379234,18379766..18379819,18380276..18380366,
FT                   18381474..18381561,18386323..18386421,18387120..18387212,
FT                   18388440..18388589,18388701..18388802,18389404..18389506,
FT                   18390130..18390238,18391033..18391172,18391638..18391831,
FT                   18392559..18392618)
FT                   /codon_start=1
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /product="pleiotropic regulator 1, PRL1 homolog
FT                   (Arabidopsis), isoform CRA_b"
FT                   /note="gene_id=mCG17066.3 transcript_id=mCT16019.1
FT                   protein_id=mCP11565.1 isoform=CRA_b"
FT                   /protein_id="EDL15420.1"
FT                   /translation="MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMA
FT                   IKLRNEYGPVLHMPTSKENLKEKGPQNATDSYPHKQYPANQGQDVEYLVTGTHPYPPGP
FT                   GVALTADTKIQRMPSESAAQSLAVALPSQTRVDANRTGPAGSEYRHPGASDRSQPTAMN
FT                   SIMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGS
FT                   ADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIR
FT                   HYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAA
FT                   EPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPLLYTFASGSPDNIKQWKF
FT                   PDGGFIQNLSGHNAIINTLAVNADGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSL
FT                   DSESGIFACAFDRSESRLLTAEADKTIKVYREDETATEETHPVSWKPEIIKRKRF"
FT   assembly_gap    18378589..18378613
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    18420849..18420868
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18424416..18424435
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18436441..18436460
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18448861..18448880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18473797..18474152
FT                   /estimated_length=356
FT                   /gap_type="unknown"
FT   assembly_gap    18477778..18480717
FT                   /estimated_length=2940
FT                   /gap_type="unknown"
FT   assembly_gap    18482181..18482200
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18497230..18497315
FT                   /estimated_length=86
FT                   /gap_type="unknown"
FT   assembly_gap    18537033..18537127
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    18538060..18538211
FT                   /estimated_length=152
FT                   /gap_type="unknown"
FT   assembly_gap    18550884..18551335
FT                   /estimated_length=452
FT                   /gap_type="unknown"
FT   assembly_gap    18552774..18553852
FT                   /estimated_length=1079
FT                   /gap_type="unknown"
FT   assembly_gap    18561965..18561984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            18591401..>18678586
FT                   /locus_tag="mCG_114390"
FT                   /note="gene_id=mCG114390.1"
FT   mRNA            join(18591401..18592411,18594836..18595023,
FT                   18602514..18603357,18605652..18606476,18609382..18609621,
FT                   18624786..18624920,18625339..18625548,18628807..18629664,
FT                   18655631..18655842,18657540..18657691,18668280..18668410,
FT                   18670126..18670412,18673812..18673944,18675978..>18678586)
FT                   /locus_tag="mCG_114390"
FT                   /product="mCG114390"
FT                   /note="gene_id=mCG114390.1 transcript_id=mCT115482.1
FT                   created on 14-NOV-2002"
FT   CDS             join(18591520..18592411,18594836..18595023,
FT                   18602514..18603357,18605652..18606476,18609382..18609621,
FT                   18624786..18624920,18625339..18625548,18628807..18629664,
FT                   18655631..18655842,18657540..18657691,18668280..18668410,
FT                   18670126..18670412,18673812..18673944,18675978..>18678586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114390"
FT                   /product="mCG114390"
FT                   /note="gene_id=mCG114390.1 transcript_id=mCT115482.1
FT                   protein_id=mCP65567.1"
FT                   /protein_id="EDL15418.1"
FT                   /translation="MVVLTVQAQLGSSPACSSTEVNITVMDVNDNRPEFPTASDEIRIS
FT                   QTTPPGTALYLAHAQDRDSGLNGLVRYSIASPQPSEFSMDQGRGVLYLRESLGSKADFR
FT                   LILVAKDQGVPPQVSQLVLTVVIESQERIPAVAFENLVYQVEVSESLPLTTQILQVQAY
FT                   PLYPWRPTSKTFYSLDVSVDSAVFGIHPHTGWIYLRRQLDYESTQTYKFRVYVHTSEDR
FT                   LLQNVSTSVIVHVLDENDHSPAFLQNRVFLNVEESPIPLGVIGKMTAIDADSGKNGQLS
FT                   YFLLTDGKFFKMNPNTGELINWLALDREHQGHHQITVLVTDHGSPPRNATMLVYVTITD
FT                   INDNWPFFPQCLPGKEFHFKVIPLSKGRVLMSQNIRHLVIPENTKPSKIMSLMKSPDPL
FT                   QQDHGGKLHFSIAAEDKDDHFEIDSSTGDLFLTKELDYEMTSHYLIRVISKDHSQSPAW
FT                   NSTVFLSIDVEDQNEHSPSFQDEFIVISIEENVPVGTLVYVFNAKDGDGSFLNSRIQYF
FT                   AESSSVGVNPFLIHPSSGALVTASPLDRENVPTFILTVTASDQAVNVTDRRWRTLVAEV
FT                   VILDVNDHSPTFVSYPITYVREDAEVGAVVHRITAQDPDAEMNGEVAYSILSGNEDMVF
FT                   VLDSSSGRVLMSQNIRHLVIPENTKPSKIMSLMKSPDPLQQDHGGKLHFSIAAEDKDDH
FT                   FEIDSSTGDLFLTKELDYEMTSHYLIRVISKDHSQSPAWNSTVFLSIDVEDQNEHSPSF
FT                   QDEFIVISIEENVPVGTLVYVFNAKDGDGSFLNSRIQYFAESSSVGVNPFLIHPSSGAL
FT                   VTASPLDRENVPTFILTVTASDQAVNVTDRRWRTLVAEVVILDVNDHSPTFVSYPITYV
FT                   REDAEVGAVVHRITAQDPDAEMNGEVAYSILSGNEDMVFVLDSSSGLLRIACPLDYEVK
FT                   TQHILTLVAHDGGMPARSSSQTLTITVLDVNDETPAFKQLLYETSVKENQSPGVFVTRV
FT                   EAEDTDSGVNSKHQFEIMPGPAFGLFEINPDTGEVVTAVTFDREAQGIFRLRVLVRDGG
FT                   VPSLSSTADIICTIEDENDHAPEFIVLHHDIEILENRDPEVVYTVLAFDMDAGNNGAVT
FT                   YHIAEGNTDEYFAIHTTSGELSTTRALDREQISNFTLTILCSDLGNPPRSSAMQLHVRV
FT                   LDDNDHSPAFPMLHYQSSIREDAEVGTVVLVLSAVDRDEGLNGQVEYFLMEEVSGAFTI
FT                   DHVTGILRTSHALDREARSQHTFQAVARDCSTQGAKSSVLSILISVTDANDNDPVWEEN
FT                   PVDAFISPMLALNQTVVHLRASDPDAGPNGTVTFSFADRQSVFSIDGYTGEVKLQQNLS
FT                   SEHFPIWLQLLATDQGTPARTTMGLLVVHKEGEGMKLSFSRYLYTGLVTENCEPGQLIV
FT                   EEPGLLDFEVRSEVRLIILAESNGHQAFTQVTVAIQDWNDNPPRFAQSVYQASVSEGQF
FT                   YSVHVIQVSATDLDQGLNSQIEYSIVSGNQAGAFRIDELNGVILTNSILDYESSGSYSL
FT                   IVQATDRGVPRLSGTALVKIQVTDINDNAPVFLPSEAVEIAENSLPGVIVARVSVHDAD
FT                   LNPAFTFSLVKESSSAAKFAISQDTGVVVLAQTLDFEEVTEYELIVRVSDSVHHTEGSV
FT                   IIRVLDVNDNPPVFTQDFYQAAVPELTPGGYLVLTLSATDLESSGDISYRILSPPEGFT
FT                   IDPRNGTIFTTNSVSVLEKIPTLRFLVEANDGGIPSLTALTLVEIEIQDVNNYAPEFPA
FT                   GCYNLSLSEDTPIGSTLMTFSTIDGDYSFENTHTEYSIISGNLHNYFHIETSLLGSEHP
FT                   HQQRGALVLLHALDREASASHKLVILASDHSCPPLSSTSVIAIDILDINDNAPTFSSRR
FT                   YQAHVKESTPVGSHITMVSADDPDKGSHAEIIYGIISGNEKEHFYLEDRTGVLYLVKPL
FT                   DYEETVAFTLTIQATDEEEKHVSFAAVHISVLDDNDHSPQFLSSTLACITPENLPPLSI
FT                   ICSVHALDFDTGPYGEVTYSIVSPCLVTHGMHPYQDLFAIDPLTGDIHTEQMLDYESVR
FT                   EYCLLVQAKDRGDASASLEVWVEVEGIDEFEPIFTQDQYFFSLREKGQGQQLIGRVEAS
FT                   DADAGVDGEVLYSLRTPSTVFSVNKTNGNIYWVRAPLLGSSQLVKEDTLEVKIIAHSPK
FT                   PGSKSTSCSVFVNVSLPAEGHHRTVLVHSFSISLVVSLLVFLSLVCTLIVLILRHKQKD
FT                   PLHSYEEKKTPSSPDADPKLTGAASELKAGQETAEYRGVTGPGEVMPAEWLNLMSVMEK
FT                   DIIHLFRHSNYSGHCSVDGETAEDKEIQRINENPYRKDSDYALSDQGSRVPDSGIPRDS
FT                   DQLSCLSGETDVMTSSEVMEASHMFEEGVGGEGCDIIYVQNNALSLRREATAGVLAESR
FT                   RESFTSGSQEGRCVAPSTQMTSSDDVRGSYAWDYFLSWEPKFQHLASVFNDIARLKDEH
FT                   MQVPGIPKDTSFVFPPPLITAVAQPGIKAVPPRMPAITLGQVLPKFPRSPLPYHGGSLP
FT                   EVMTPNFSPSLSLLTMQTPARSPMLPDGESRGTHMLGPWHDRKAEDEVQ"
FT   assembly_gap    18604211..18604230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18611670..18611689
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18612709..18612728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18619690..18621708
FT                   /estimated_length=2019
FT                   /gap_type="unknown"
FT   assembly_gap    18631835..18632189
FT                   /estimated_length=355
FT                   /gap_type="unknown"
FT   assembly_gap    18639569..18639588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18640789..18645962
FT                   /estimated_length=5174
FT                   /gap_type="unknown"
FT   assembly_gap    18647019..18647038
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18648437..18648456
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18650030..18652265
FT                   /estimated_length=2236
FT                   /gap_type="unknown"
FT   assembly_gap    18660377..18660396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18664488..18664507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18702301..18702320
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18722812..18723884
FT                   /estimated_length=1073
FT                   /gap_type="unknown"
FT   assembly_gap    18746984..18747152
FT                   /estimated_length=169
FT                   /gap_type="unknown"
FT   assembly_gap    18752210..18752642
FT                   /estimated_length=433
FT                   /gap_type="unknown"
FT   assembly_gap    18753144..18753303
FT                   /estimated_length=160
FT                   /gap_type="unknown"
FT   assembly_gap    18777448..18777467
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18778771..18778790
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18779992..18780011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18784280..18784299
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18785360..18785379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18786642..18786661
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18799017..18799153
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    18856599..18856963
FT                   /estimated_length=365
FT                   /gap_type="unknown"
FT   assembly_gap    18866917..18867087
FT                   /estimated_length=171
FT                   /gap_type="unknown"
FT   assembly_gap    18874223..18874414
FT                   /estimated_length=192
FT                   /gap_type="unknown"
FT   gene            complement(18883090..18902130)
FT                   /locus_tag="mCG_1032281"
FT                   /note="gene_id=mCG1032281.0"
FT   mRNA            complement(join(18883090..18883165,18883885..18883927,
FT                   18888257..18888518,18902098..18902130))
FT                   /locus_tag="mCG_1032281"
FT                   /product="mCG1032281"
FT                   /note="gene_id=mCG1032281.0 transcript_id=mCT149985.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(18883145..18883165,18883885..18883927,
FT                   18888257..18888387))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032281"
FT                   /product="mCG1032281"
FT                   /note="gene_id=mCG1032281.0 transcript_id=mCT149985.0
FT                   protein_id=mCP65568.1"
FT                   /protein_id="EDL15417.1"
FT                   /translation="MNTPLASSLQVDGLGSNTELFAPLTLHELPCEWLLEGSPEHVHSS
FT                   RESFALLWSSCLQNLLWNT"
FT   assembly_gap    18889151..18889562
FT                   /estimated_length=412
FT                   /gap_type="unknown"
FT   assembly_gap    18891884..18892055
FT                   /estimated_length=172
FT                   /gap_type="unknown"
FT   assembly_gap    18899159..18900416
FT                   /estimated_length=1258
FT                   /gap_type="unknown"
FT   assembly_gap    18920288..18920326
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    18922932..18922951
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    18944556..18944605
FT                   /estimated_length=50
FT                   /gap_type="unknown"
FT   assembly_gap    18980676..18980943
FT                   /estimated_length=268
FT                   /gap_type="unknown"
FT   assembly_gap    18990640..18990659
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19000429..19000448
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19015850..19016543
FT                   /pseudo
FT                   /locus_tag="mCG_49333"
FT                   /note="gene_id=mCG49333.2"
FT   mRNA            19015850..19016543
FT                   /pseudo
FT                   /locus_tag="mCG_49333"
FT                   /note="gene_id=mCG49333.2 transcript_id=mCT49516.1 created
FT                   on 28-MAR-2003"
FT   assembly_gap    19017020..19017039
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19033398..19033417
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19045503..19045602
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    19047178..19048676
FT                   /estimated_length=1499
FT                   /gap_type="unknown"
FT   assembly_gap    19054493..19056407
FT                   /estimated_length=1915
FT                   /gap_type="unknown"
FT   assembly_gap    19094094..19094169
FT                   /estimated_length=76
FT                   /gap_type="unknown"
FT   gene            19095239..19103243
FT                   /gene="Sfrp2"
FT                   /locus_tag="mCG_17072"
FT                   /note="gene_id=mCG17072.1"
FT   mRNA            join(19095239..19095967,19098250..19098330,
FT                   19102046..19103243)
FT                   /gene="Sfrp2"
FT                   /locus_tag="mCG_17072"
FT                   /product="secreted frizzled-related protein 2"
FT                   /note="gene_id=mCG17072.1 transcript_id=mCT16025.1 created
FT                   on 19-AUG-2002"
FT   CDS             join(19095466..19095967,19098250..19098330,
FT                   19102046..19102350)
FT                   /codon_start=1
FT                   /gene="Sfrp2"
FT                   /locus_tag="mCG_17072"
FT                   /product="secreted frizzled-related protein 2"
FT                   /note="gene_id=mCG17072.1 transcript_id=mCT16025.1
FT                   protein_id=mCP11563.1"
FT                   /db_xref="GOA:Q3UI35"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026558"
FT                   /db_xref="MGI:MGI:108078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UI35"
FT                   /protein_id="EDL15416.1"
FT                   /translation="MPRGPASLLLLVLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPA
FT                   NLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCL
FT                   DDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLP
FT                   ATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIY
FT                   KLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQR
FT                   EFKRISRSIRKLQC"
FT   assembly_gap    19115978..19115997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19118820..19118884
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    19127250..19127629
FT                   /estimated_length=380
FT                   /gap_type="unknown"
FT   assembly_gap    19139509..19139546
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    19155748..19155974
FT                   /estimated_length=227
FT                   /gap_type="unknown"
FT   assembly_gap    19159056..19159075
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19160366..19160385
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19161941..19161960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19168382..19173672)
FT                   /gene="Tlr2"
FT                   /locus_tag="mCG_17071"
FT                   /note="gene_id=mCG17071.1"
FT   mRNA            complement(join(19168382..19170900,19173000..19173247,
FT                   19173631..19173672))
FT                   /gene="Tlr2"
FT                   /locus_tag="mCG_17071"
FT                   /product="toll-like receptor 2"
FT                   /note="gene_id=mCG17071.1 transcript_id=mCT16024.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(19168531..19170885)
FT                   /codon_start=1
FT                   /gene="Tlr2"
FT                   /locus_tag="mCG_17071"
FT                   /product="toll-like receptor 2"
FT                   /note="gene_id=mCG17071.1 transcript_id=mCT16024.0
FT                   protein_id=mCP11558.1"
FT                   /db_xref="GOA:G3X8Y8"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR027185"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1346060"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Y8"
FT                   /protein_id="EDL15415.1"
FT                   /translation="MLRALWLFWILVAITVLFSKRCSAQESLSCDASGVCDGRSRSFTS
FT                   IPSGLTAAMKSLDLSFNKITYIGHGDLRACANLQVLMLKSSRINTIEGDAFYSLGSLEH
FT                   LDLSDNHLSSLSSSWFGPLSSLKYLNLMGNPYQTLGVTSLFPNLTNLQTLRIGNVETFS
FT                   EIRRIDFAGLTSLNELEIKALSLRNYQSQSLKSIRDIHHLTLHLSESAFLLEIFADILS
FT                   SVRYLELRDTNLARFQFSPLPVDEVSSPMKKLAFRGSVLTDESFNELLKLLRYILELSE
FT                   VEFDDCTLNGLGDFNPSESDVVSELGKVETVTIRRLHIPQFYLFYDLSTVYSLLEKVKR
FT                   ITVENSKVFLVPCSFSQHLKSLEFLDLSENLMVEEYLKNSACKGAWPSLQTLVLSQNHL
FT                   RSMQKTGEILLTLKNLTSLDISRNTFHPMPDSCQWPEKMRFLNLSSTGIRVVKTCIPQT
FT                   LEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPDASLFPVLLVMKIRENAVSTFSKD
FT                   QLGSFPKLETLEAGDNHFVCSCELLSFTMETPALAQILVDWPDSYLCDSPPRLHGHRLQ
FT                   DARPSVLECHQAALVSGVCCALLLLILLVGALCHHFHGLWYLRMMWAWLQAKRKPKKAP
FT                   CRDVCYDAFVSYSEQDSHWVENLMVQQLENSDPPFKLCLHKRDFVPGKWIIDNIIDSIE
FT                   KSHKTVFVLSENFVRSEWCKYELDFSHFRLFDENNDAAILVLLEPIERKAIPQRFCKLR
FT                   KIMNTKTYLEWPLDEGQQEVFWVNLRTAIKS"
FT   assembly_gap    19176200..19177130
FT                   /estimated_length=931
FT                   /gap_type="unknown"
FT   assembly_gap    19206027..19206046
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19214546..19214565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19216773..19216792
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19218866..19218885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19225724..19225743
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19226818..19226837
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19228097..19228116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19229434..19229492
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   gene            complement(19233867..19274153)
FT                   /locus_tag="mCG_18092"
FT                   /note="gene_id=mCG18092.1"
FT   mRNA            complement(join(19233867..19234824,19235388..19235527,
FT                   19236538..19236629,19237558..19237678,19241244..19241326,
FT                   19242558..19242636,19245355..19245537,19246576..19246715,
FT                   19249471..19249595,19255658..19255806,19258146..19258768,
FT                   19259154..19259303,19260194..19260379,19262311..19262497,
FT                   19263218..19263360,19264887..19265014,19266842..19266914,
FT                   19267930..19268039,19268930..19269071,19270805..19270922,
FT                   19273454..19273577,19273999..19274153))
FT                   /locus_tag="mCG_18092"
FT                   /product="mCG18092"
FT                   /note="gene_id=mCG18092.1 transcript_id=mCT19784.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(19234552..19234824,19235388..19235527,
FT                   19236538..19236629,19237558..19237678,19241244..19241326,
FT                   19242558..19242636,19245355..19245537,19246576..19246715,
FT                   19249471..19249595,19255658..19255806,19258146..19258768,
FT                   19259154..19259303,19260194..19260379,19262311..19262497,
FT                   19263218..19263360,19264887..19265014,19266842..19266914,
FT                   19267930..19268039,19268930..19269071,19270805..19270872))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18092"
FT                   /product="mCG18092"
FT                   /note="gene_id=mCG18092.1 transcript_id=mCT19784.2
FT                   protein_id=mCP11546.2"
FT                   /protein_id="EDL15414.1"
FT                   /translation="MDSELANKLYERWKKYKSGDACRRNVLGMAQFAFTKKSKETEPFV
FT                   SFLPRVVPEPNLVLNFSATALRNSAVKYFVVRNPTPQPVSLQLLPLSLYPRPEAAVRLL
FT                   HKWFGTDMQMVNLSTGEFQLTQACPYQGEPSEESSLGALHVHLQALETRRVGVVFTPAD
FT                   YGKVTSLILIRNNLTVVDMVGVEGFGAQELLKVGGRLPGAGGSLRFKVPESTLMDCHRQ
FT                   LKDSKQILSITKNFKVENIGPLPITVTSLKINGYNCQGYGFEVLDCHPFSLSPNTSRDI
FT                   SIVFTPDFTSSWVIRELTLVTAADLEFHFTLNVTLPHHMLPLCAEVVPGPSWEESFWRL
FT                   TVFFVSLSLLGVILIAFQQAQYILMEFMKTRQRQNGSSSSQQNGDPVAMISSHPHKSTC
FT                   KNFLDTYSPSDKGRGKSCLPVGPSLSRLQNAAKRSPATYGHSQKKHKCSFYYSKQKPSA
FT                   SAASSANVTTEEKQTVTLASSLSVAKEDICTNVLSENWVSLRYASGINGSLQKNLTLPK
FT                   NVLHKEESSLKNTVVTNTPSECSMKEGVHTYMFPKETDSKISENVAELKEQEPCPQKTS
FT                   KKPPESTLPKTPPQYLQSDLPEVSRKHGNKQQAPVRSEVDSFEPVRAADAEPSSVRKTQ
FT                   GASPEDTCSEKQDTPSAEQEDPSRKRKLQERREGSTQALNWNKTRPCRRNKKRASAQAS
FT                   SSPRPSEQSEQRLVCSDVRSWCAQDGAGETCKAGTEVSGSSPERREEDSYYQKSEKKCA
FT                   DKFCSDSSSDCGSSSGSVRASRGSWGSWSSSSSDCDRRPVVDIQHFLPPGDGVSPQNFP
FT                   SEASVPLSLPQHVCSSTDVSVLPEFTESPCPGLPATPAGAGEEKGLYPPGGLWPSQPVC
FT                   LTSSFNCPVENGAPGVSQEPTSIPDSSFIDWSASCEGQFPSVYCPLELNDYNAFPEENM
FT                   NYTNGFPCSSKVQTDFIGHSTPSTWNTPASMPAAWGHASLVNSPSYLTSTRSLSPMSGL
FT                   FGSIWAPQSEVYETCCPISPATEHATHMENQVMCKEYYLGFNPFRAYMNLDIWTSTANR
FT                   NANFPLSRDSSYCGNM"
FT   gene            complement(19276483..19376627)
FT                   /locus_tag="mCG_18095"
FT                   /note="gene_id=mCG18095.1"
FT   mRNA            complement(join(19276483..19276591,19278416..19278569,
FT                   19278781..19278858,19296720..19296830,19297549..19297665,
FT                   19298330..19298453,19304185..19304253,19367908..19367951,
FT                   19375778..19375848,19376440..19376627))
FT                   /locus_tag="mCG_18095"
FT                   /product="mCG18095"
FT                   /note="gene_id=mCG18095.1 transcript_id=mCT19786.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(19276545..19276591,19278416..19278569,
FT                   19278781..19278858,19296720..19296830,19297549..19297665,
FT                   19298330..19298453,19304185..19304253,19367908..19367951,
FT                   19375778..19375848,19376440..19376563))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18095"
FT                   /product="mCG18095"
FT                   /note="gene_id=mCG18095.1 transcript_id=mCT19786.2
FT                   protein_id=mCP11569.2"
FT                   /protein_id="EDL15413.1"
FT                   /translation="MAGLRRPQSGAYRRTAAAVNLLLGVFQVLLSCCRPGGAQGQAFEP
FT                   LPNVVELWQAEEGELLLPTQGDSEEDMEEPSQEQSFSDKLFIGKGLHFQPSVLDFGIQF
FT                   LGHPAAKLLYAYNPSRESEVVVNSVFTAARHFHVPPVHCRVIPAMGKASFRVIFLPTEE
FT                   GSIESSLFINTSSHGVFSYHVSGVGTRRVSTEGSAEQLPNAYFLLPQVQSIQLSQTQAE
FT                   TTNTSLLRVQLECSLHNKVCQQLKSCSLGSDDALHLEMNIIVAVENSSKQPEENTQALL
FT                   DHLSIVYVATDESDTSGYTSFLTEKCPVSAV"
FT   assembly_gap    19312040..19312095
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    19315574..19315653
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    19329460..19329479
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19353040..19353059
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19356329..19356425
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    19366081..19366100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19372056..19372202
FT                   /estimated_length=147
FT                   /gap_type="unknown"
FT   assembly_gap    19394750..19394769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19409198..19409285
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   gene            complement(19424909..19487805)
FT                   /locus_tag="mCG_18091"
FT                   /note="gene_id=mCG18091.2"
FT   mRNA            complement(join(19424909..19425148,19430519..19430563,
FT                   19441803..19441917,19452747..19452821,19473387..19473535,
FT                   19477549..19477606,19481074..19481140,19487752..19487805))
FT                   /locus_tag="mCG_18091"
FT                   /product="mCG18091"
FT                   /note="gene_id=mCG18091.2 transcript_id=mCT19783.2 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(19425042..19425148,19430519..19430563,
FT                   19441803..19441917,19452747..19452821,19473387..19473535,
FT                   19477549..19477606,19481074..19481097))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18091"
FT                   /product="mCG18091"
FT                   /note="gene_id=mCG18091.2 transcript_id=mCT19783.2
FT                   protein_id=mCP11544.2"
FT                   /protein_id="EDL15412.1"
FT                   /translation="MMEIFFETKDVFQLKDLEKLAPKEKGITAMSVKEVLQSLVDDGMV
FT                   DCERIGTSNYYWAFPSKALHARKRKLEALNSQLSEGSQKHADLQKSIEKARVGRQETEE
FT                   RAMLAKELSSFRDQRQQLKAEVEKYRECDPQVVEEIREANKVAKEAANRWTDNIFAIKS
FT                   WAKRKFGFEESKIDKNFGIPEDFDYID"
FT   assembly_gap    19440971..19440990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19463337..19463356
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19487128..19487751
FT                   /estimated_length=624
FT                   /gap_type="unknown"
FT   assembly_gap    19488891..19489181
FT                   /estimated_length=291
FT                   /gap_type="unknown"
FT   gene            complement(19492580..19553444)
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /note="gene_id=mCG18088.1"
FT   mRNA            complement(join(19492580..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19523860,19524710..19524890,
FT                   19525850..19526001,19540753..19540990,19542752..19542933,
FT                   19553212..19553444))
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, transcript variant
FT                   mCT19780"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT19780.1 created
FT                   on 20-AUG-2002"
FT   mRNA            complement(join(19495477..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19523860,19524710..19524890,
FT                   19525850..19526001,19540753..19540990,19542752..19542933,
FT                   19545165..>19545417))
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, transcript variant
FT                   mCT190926"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT190926.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(19495858..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19524890,19525850..19526001,
FT                   19540753..19540990,19542752..19542933,19553212..>19553428))
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, transcript variant
FT                   mCT190925"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT190925.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(19497228..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19523860,19524710..19524890,
FT                   19525850..19526001,19540753..19540990,19542752..19542933,
FT                   19545165..>19545167))
FT                   /codon_start=1
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT190926.0
FT                   protein_id=mCP111893.0 isoform=CRA_b"
FT                   /protein_id="EDL15409.1"
FT                   /translation="QQRAGSRTAGPPCQWSRMASEGASIPSPVVRQIDKQFLICSICLE
FT                   RYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLM
FT                   DVLQRTPGSNGEDSSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEH
FT                   AEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIH
FT                   STFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNH
FT                   GTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNA
FT                   VASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEIL
FT                   DNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSP
FT                   GSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKI
FT                   LIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSI
FT                   FSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNG
FT                   DRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAV
FT                   DSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHC
FT                   FKVYRYLQ"
FT   CDS             complement(join(19497228..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19523860,19524710..19524890,
FT                   19525850..19526001,19540753..19540990,19542752..19542885))
FT                   /codon_start=1
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT19780.1
FT                   protein_id=mCP11539.2 isoform=CRA_c"
FT                   /protein_id="EDL15410.1"
FT                   /translation="MASEGASIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCER
FT                   CLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNGEDSSIL
FT                   ETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKA
FT                   SLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVL
FT                   LMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKL
FT                   NELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTII
FT                   GQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEG
FT                   DFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMY
FT                   STGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDG
FT                   QFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLM
FT                   GPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNE
FT                   IIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQ
FT                   VFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ"
FT   CDS             complement(join(19497228..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..>19524037))
FT                   /codon_start=1
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT190925.0
FT                   protein_id=mCP111892.0 isoform=CRA_a"
FT                   /protein_id="EDL15408.1"
FT                   /translation="RSAWVHWVKWNADGSEPPEWAGVEVGSFGRRALPQLLAKCPAGCT
FT                   VSCRKRSLPLCPRQVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEK
FT                   LNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI
FT                   IGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKE
FT                   GDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASM
FT                   YSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSND
FT                   GQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKL
FT                   MGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNN
FT                   EIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRI
FT                   QVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ"
FT   gene            19506899..19507286
FT                   /locus_tag="mCG_18090"
FT                   /note="gene_id=mCG18090.0"
FT   mRNA            19506899..19507286
FT                   /locus_tag="mCG_18090"
FT                   /product="mCG18090"
FT                   /note="gene_id=mCG18090.0 transcript_id=mCT19782.0 created
FT                   on 08-NOV-2002"
FT   CDS             19506933..19507253
FT                   /codon_start=1
FT                   /locus_tag="mCG_18090"
FT                   /product="mCG18090"
FT                   /note="gene_id=mCG18090.0 transcript_id=mCT19782.0
FT                   protein_id=mCP11542.1"
FT                   /db_xref="GOA:A0A0A6YW33"
FT                   /db_xref="InterPro:IPR000552"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="MGI:MGI:3648757"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0A6YW33"
FT                   /protein_id="EDL15411.1"
FT                   /translation="MVNVPKTRQTFCKKCGKHQSHKVTQYKKGKDSLYAQGKRRYDRKQ
FT                   SGYGGQTKPIFRKKAKTTKKIVLRLESVEPNCRSKRMLARKRCEHFELGGDKKRKGQVI
FT                   QF"
FT   assembly_gap    19514950..19515543
FT                   /estimated_length=594
FT                   /gap_type="unknown"
FT   assembly_gap    19536327..19536455
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    19560558..19560621
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    19571804..19571823
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19592545..19592846
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    19602504..19602599
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    19605740..19605912
FT                   /estimated_length=173
FT                   /gap_type="unknown"
FT   assembly_gap    19617172..19617241
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            complement(19632616..19637397)
FT                   /locus_tag="mCG_147527"
FT                   /note="gene_id=mCG147527.0"
FT   mRNA            complement(join(19632616..19634566,19637245..19637397))
FT                   /locus_tag="mCG_147527"
FT                   /product="mCG147527"
FT                   /note="gene_id=mCG147527.0 transcript_id=mCT187790.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(19633734..19633991)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147527"
FT                   /product="mCG147527"
FT                   /note="gene_id=mCG147527.0 transcript_id=mCT187790.0
FT                   protein_id=mCP109371.0"
FT                   /protein_id="EDL15407.1"
FT                   /translation="MQYILLTVVILWEHQDLFLPSTYFLPVTNLTLFSFPSSLAVFEDQ
FT                   SLLSPSGTSGLRFCVSEVMQSFLFVLSLFPEGLPGPTCYE"
FT   assembly_gap    19646950..19646969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19656774..19656793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19665853..19665885
FT                   /estimated_length=33
FT                   /gap_type="unknown"
FT   assembly_gap    19670536..19670555
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19682062..19706263)
FT                   /locus_tag="mCG_60260"
FT                   /note="gene_id=mCG60260.1"
FT   mRNA            complement(join(19682062..19682793,19704511..19704668,
FT                   19705125..19705152,19706069..19706263))
FT                   /locus_tag="mCG_60260"
FT                   /product="mCG60260"
FT                   /note="gene_id=mCG60260.1 transcript_id=mCT60443.1 created
FT                   on 30-SEP-2002"
FT   CDS             complement(join(19682389..19682793,19704511..19704522))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60260"
FT                   /product="mCG60260"
FT                   /note="gene_id=mCG60260.1 transcript_id=mCT60443.1
FT                   protein_id=mCP33320.2"
FT                   /protein_id="EDL15406.1"
FT                   /translation="MGRENTQGLQKEKTQHSYVKVPSRVHRPSPACSHEANHDLHPGHT
FT                   PPTPPPPTSLHLQGKHAQSSPATRTFPCKPNKIDGRNCGKEAGRETVVSKVGSEAWASS
FT                   SLRSNNNTKEKHSLNLKLSSSGGRSRVRSEGRIS"
FT   assembly_gap    19689202..19689722
FT                   /estimated_length=521
FT                   /gap_type="unknown"
FT   assembly_gap    19690863..19690882
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19719986..19720139
FT                   /estimated_length=154
FT                   /gap_type="unknown"
FT   assembly_gap    19725015..19727661
FT                   /estimated_length=2647
FT                   /gap_type="unknown"
FT   assembly_gap    19729133..19729398
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    19733765..19734127
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    19735228..19738315
FT                   /estimated_length=3088
FT                   /gap_type="unknown"
FT   assembly_gap    19744700..19744826
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    19751377..19751396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19770785..19805807)
FT                   /gene="6330505N24Rik"
FT                   /locus_tag="mCG_18093"
FT                   /note="gene_id=mCG18093.2"
FT   mRNA            complement(join(19770785..19773262,19775484..19775648,
FT                   19778104..19778221,19780242..19780312,19781517..19781624,
FT                   19781718..19781788,19783704..19783804,19783895..19783980,
FT                   19790917..19791019,19791848..19791909,19800460..19801097,
FT                   19805685..19805807))
FT                   /gene="6330505N24Rik"
FT                   /locus_tag="mCG_18093"
FT                   /product="RIKEN cDNA 6330505N24"
FT                   /note="gene_id=mCG18093.2 transcript_id=mCT19785.2 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(19771199..19773262,19775484..19775648,
FT                   19778104..19778221,19780242..19780312,19781517..19781624,
FT                   19781718..19781788,19783704..19783804,19783895..19783980,
FT                   19790917..19791019,19791848..19791909,19800460..19800960))
FT                   /codon_start=1
FT                   /gene="6330505N24Rik"
FT                   /locus_tag="mCG_18093"
FT                   /product="RIKEN cDNA 6330505N24"
FT                   /note="gene_id=mCG18093.2 transcript_id=mCT19785.2
FT                   protein_id=mCP11551.2"
FT                   /protein_id="EDL15405.1"
FT                   /translation="MHVMNCVSLASDKENGTLATAAAFMTGQTSPSASPPPPPPPPPPP
FT                   PCPHSGEGFSPSPPPPLPPPLPGGPPIPPPPPPGLPSVSYLNGYSSLGKKKRMRSFFWK
FT                   TIPEEQVRGKTNIWTLAAKQQHQYQIDKKTIEELFGQQEDTSKASLPKRGGALNSSFRD
FT                   AREEVTVLDAKRSMNIGIFLKQFKKSPQSIVEDIYQGKSEHYGSETLREILKLLPESEE
FT                   VKKLKAFNGDVSKLSLADSFLHCLIQVPNYSLRIEAMVLKKEFLPSCSSLFKDIRTLRA
FT                   ATKELMLCEELHSILHLVLQAGNIMNAGGYAGNAVGFKLSSLLKLADTKANKPGMNLLH
FT                   FVAQEAQKQDAILLNFSEKLQHVQETSRLSLDITEAELHSLFVRTKSLQENIQLDQELC
FT                   QQMEDFLQFAVEKLAELELWKRELQGEAHTLIDFFCEDKETMKLDECFQIFRDFCTRFN
FT                   KAVKDNHDREEQERKQLQRQKEMEQKRYSWSTGELGSFGRSSSENDVQMLAKTGTEDLP
FT                   SFLKPRPNSPSYRPPNTRRSRLSLGISADRELLTFLESATSSPEDPNKFNSLPRSSPRQ
FT                   ARPTIAWMEPREQQSHGPNFTHEPQASKIQEKAPPPAWQNQLPTTWREEPASPLPLAGR
FT                   SRPSLRKRNSEPVGLGPTQSPPLLPLDLGVREHELVTGLTQFDLQSPKSLEEGSQLTLN
FT                   DFCPTKLPSPGDRSSQSFAAGGDSLPPKNTDTQEVLSPAGEDDRTISDEPSSEALVSVV
FT                   VTDTEDKDAGPLLYVSDTTDCSLTLDCSEGMDSRAGGDKQEEEKEGDGSVSSGAGEAGS
FT                   SQVSSNSVSSPPGEVPAPKSSKSELSCQGGLPKDRPSRGKDAIAPKRNSFKEASVGASK
FT                   PVSARRSQGVTTKPVRTLNSSENEHMRKVVPISKSSRGAGPWKRPEPTPKATPRETPSS
FT                   TDTPLSRRSSVRGTSDTSPRRPQVSGSGAEEPRLPRSSGSISGRPGKDAPLQPRASFRK
FT                   PSAKPLRNIPRQKPEENKVSSPNSPDPESPKEEPKAPQATGVSRALPPIPSFARNTVAS
FT                   SSRSLRTDAPPAARTTGLTRTVSQRQLRVKGGSEDSASKDIGTLKRASSARASKKCPES
FT                   AGGSSANVETSLKGRGTTERSSLRLKDSGQATLGRILRPLQK"
FT   assembly_gap    19788725..19788744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19798560..19798661
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   gene            complement(19822399..>19874362)
FT                   /locus_tag="mCG_18094"
FT                   /note="gene_id=mCG18094.1"
FT   mRNA            complement(join(19822399..19824194,19836072..19836246,
FT                   19841906..19842063,19845712..19845933,19853899..19854011,
FT                   19855377..19855472,19860818..19860926,19874270..>19874362))
FT                   /locus_tag="mCG_18094"
FT                   /product="mCG18094"
FT                   /note="gene_id=mCG18094.1 transcript_id=mCT19787.2 created
FT                   on 30-SEP-2002"
FT   CDS             complement(join(19824039..19824194,19836072..19836246,
FT                   19841906..19842063,19845712..19845933,19853899..19854011,
FT                   19855377..19855472,19860818..19860926,19874270..19874362))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18094"
FT                   /product="mCG18094"
FT                   /note="gene_id=mCG18094.1 transcript_id=mCT19787.2
FT                   protein_id=mCP11561.1"
FT                   /db_xref="GOA:G5E8V9"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="InterPro:IPR030793"
FT                   /db_xref="InterPro:IPR030798"
FT                   /db_xref="MGI:MGI:1277120"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8V9"
FT                   /protein_id="EDL15404.1"
FT                   /translation="MAQESPKNSAAEIPVTSNGEVDDAHEHGYNRDLKHSLPSGLGLSE
FT                   TQITSHGFDSTKEGVTEAGAPQGSSAPPLPCVLSPSRVAASKLTQQAGDLTVPAGGQRT
FT                   HTKGGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQID
FT                   ILRDNKKKYENILKLAQTLSTQLFQMVHTQKQLGDAFADLSLKSLELHEEFGYNADTQK
FT                   LLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYENARVEYDAYRTDLEELNLGP
FT                   RDANTLPKIEQSQHLFQIHKEKYDKMRSDVSVKLKFLEENKVKVLRNQLVLFHSAVAAY
FT                   FAGNQKQLELTLKQFHVRLKTPGVDAPSWLEEQ"
FT   assembly_gap    19833975..19834010
FT                   /estimated_length=36
FT                   /gap_type="unknown"
FT   assembly_gap    19853696..19853715
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19862810..19862829
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19870083..19870102
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(19879221..19879819)
FT                   /pseudo
FT                   /locus_tag="mCG_1032201"
FT                   /note="gene_id=mCG1032201.1"
FT   mRNA            complement(19879221..19879819)
FT                   /pseudo
FT                   /locus_tag="mCG_1032201"
FT                   /note="gene_id=mCG1032201.1 transcript_id=mCT149905.1
FT                   created on 28-MAR-2003"
FT   gene            complement(19883303..19884146)
FT                   /pseudo
FT                   /locus_tag="mCG_1032221"
FT                   /note="gene_id=mCG1032221.1"
FT   mRNA            complement(19883303..19884146)
FT                   /pseudo
FT                   /locus_tag="mCG_1032221"
FT                   /note="gene_id=mCG1032221.1 transcript_id=mCT149925.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    19893311..19893353
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    19898542..19898561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19915874..19915893
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            19920227..19923687
FT                   /gene="Tigd4"
FT                   /locus_tag="mCG_147529"
FT                   /note="gene_id=mCG147529.0"
FT   mRNA            19920227..19923687
FT                   /gene="Tigd4"
FT                   /locus_tag="mCG_147529"
FT                   /product="tigger transposable element derived 4"
FT                   /note="gene_id=mCG147529.0 transcript_id=mCT187792.0
FT                   created on 13-JAN-2004"
FT   CDS             19920433..19921974
FT                   /codon_start=1
FT                   /gene="Tigd4"
FT                   /locus_tag="mCG_147529"
FT                   /product="tigger transposable element derived 4"
FT                   /note="gene_id=mCG147529.0 transcript_id=mCT187792.0
FT                   protein_id=mCP109373.0"
FT                   /protein_id="EDL15403.1"
FT                   /translation="MAEASVDIGTQPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAE
FT                   YGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVP
FT                   VNGPMLRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPSTVWY
FT                   QNVLPYYLNDYHPKNVFNVKETGLLYRMLPTNTFAFKGETCSVGKLCKDRITLALGTNM
FT                   DGSEKLPLLIIGKNRAPRCFKGIKSLPVYYEANRTAWMTAAIFEQWMQKLDEKFQAQKR
FT                   RVVIFVDSCPAHPEVKNLKSIELAFFPSCLSSGFAAMNQGVIKSLKIKYRHCLIKKFLS
FT                   SVESSKEFTFSLLDAVDTLHLCWRAVTPETIVKSYEEAGFRSPKGENDTANADAAVALD
FT                   LTAHAVGAGVEFLEGLSIEEYAALDEDLETCEATQKDDAEWAGESKQDETGLYTSDEEE
FT                   EDSGALEVDLPSPSKKDALSAVGTLKRFLRSHDLNDELHGSLADLENFINALSPK"
FT   assembly_gap    19929734..19930096
FT                   /estimated_length=363
FT                   /gap_type="unknown"
FT   assembly_gap    19934867..19935068
FT                   /estimated_length=202
FT                   /gap_type="unknown"
FT   assembly_gap    19937410..19937730
FT                   /estimated_length=321
FT                   /gap_type="unknown"
FT   assembly_gap    19944510..19944529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19948050..19948509
FT                   /estimated_length=460
FT                   /gap_type="unknown"
FT   assembly_gap    19957992..19958011
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    19987016..19987515
FT                   /estimated_length=500
FT                   /gap_type="unknown"
FT   gene            19993196..20028999
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /note="gene_id=mCG18089.1"
FT   mRNA            join(19993196..19993354,20011103..20011357,
FT                   20016474..20016501,20017442..20017527,20019392..20019449,
FT                   20028939..20028999)
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /product="transmembrane protein 154, transcript variant
FT                   mCT19781"
FT                   /note="gene_id=mCG18089.1 transcript_id=mCT19781.1 created
FT                   on 27-MAR-2003"
FT   mRNA            join(19993249..19993354,20011103..20011357,
FT                   20011446..20011484,20016474..20016501,20017442..20017527,
FT                   20019392..20019449,20028939..20028998)
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /product="transmembrane protein 154, transcript variant
FT                   mCT181532"
FT                   /note="gene_id=mCG18089.1 transcript_id=mCT181532.0 created
FT                   on 27-MAR-2003"
FT   CDS             join(19993291..19993354,20011103..20011357,
FT                   20011446..20011484,20016474..20016501,20017442..20017527,
FT                   20019392..20019449,20028939..20028954)
FT                   /codon_start=1
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /product="transmembrane protein 154, isoform CRA_a"
FT                   /note="gene_id=mCG18089.1 transcript_id=mCT181532.0
FT                   protein_id=mCP104454.0 isoform=CRA_a"
FT                   /protein_id="EDL15401.1"
FT                   /translation="MTVPCAALVLALGLAFGQSSQGNDEESEYSGQSITEEENSEDETT
FT                   RSALATVTTEALAENVNSTHTNDTSNQVEFILMVAIPLAALLILLFMVLIATYFKSKRP
FT                   KQEPSSQGSQSALQTHELGGETLKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADYECL
FT                   PTLKEEKEPNPSPSDNES"
FT   CDS             join(19993291..19993354,20011103..20011357,
FT                   20016474..20016501,20017442..20017527,20019392..20019449,
FT                   20028939..20028954)
FT                   /codon_start=1
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /product="transmembrane protein 154, isoform CRA_b"
FT                   /note="gene_id=mCG18089.1 transcript_id=mCT19781.1
FT                   protein_id=mCP11541.2 isoform=CRA_b"
FT                   /protein_id="EDL15402.1"
FT                   /translation="MTVPCAALVLALGLAFGQSSQGNDEESEYSGQSITEEENSEDETT
FT                   RSALATVTTEALAENVNSTHTNDTSNQVEFILMVAIPLAALLILLFMVLIATYFKSKRP
FT                   KQDELGGETLKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADYECLPTLKEEKEPNPSP
FT                   SDNES"
FT   assembly_gap    20000633..20000652
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20001877..20002515
FT                   /estimated_length=639
FT                   /gap_type="unknown"
FT   assembly_gap    20026846..20026873
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    20039674..20039693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20063238..20064833
FT                   /estimated_length=1596
FT                   /gap_type="unknown"
FT   assembly_gap    20079101..20079120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20080700..20080719
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20093398..20094957
FT                   /estimated_length=1560
FT                   /gap_type="unknown"
FT   assembly_gap    20121367..20121386
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20142543..20143585
FT                   /estimated_length=1043
FT                   /gap_type="unknown"
FT   gene            <20143666..20314314
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /note="gene_id=mCG114058.1"
FT   mRNA            join(<20143666..20143858,20199163..20199210,
FT                   20199336..20199399,20238730..20239308,20289992..20290074,
FT                   20293620..20293761,20300364..20300498,20302557..20302680,
FT                   20304282..20304418,20305913..20306026,20307492..20307673,
FT                   20309520..20309745,20311291..20311501,20312390..20314314)
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /product="F-box and WD-40 domain protein 7, archipelago
FT                   homolog (Drosophila), transcript variant mCT190977"
FT                   /note="gene_id=mCG114058.1 transcript_id=mCT190977.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(20143813..20143858,20199163..20199210,
FT                   20238730..20238975,20287497..20287772,20289992..20290074,
FT                   20293620..20293761,20300364..20300498,20302557..20302680,
FT                   20304282..20304418,20305913..20306026,20307492..20307673,
FT                   20309520..20309745,20311291..20311501,20312390..20314314)
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /product="F-box and WD-40 domain protein 7, archipelago
FT                   homolog (Drosophila), transcript variant mCT115149"
FT                   /note="gene_id=mCG114058.1 transcript_id=mCT115149.1
FT                   created on 30-SEP-2002"
FT   assembly_gap    20159231..20160748
FT                   /estimated_length=1518
FT                   /gap_type="unknown"
FT   assembly_gap    20161707..20163843
FT                   /estimated_length=2137
FT                   /gap_type="unknown"
FT   assembly_gap    20176240..20176259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20177389..20177408
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20179001..20179020
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20194531..20194550
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<20199370..20199399,20238730..20239308,
FT                   20289992..20290074,20293620..20293761,20300364..20300498,
FT                   20302557..20302680,20304282..20304418,20305913..20306026,
FT                   20307492..20307673,20309520..20309745,20311291..20311501,
FT                   20312390..20312658)
FT                   /codon_start=1
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /product="F-box and WD-40 domain protein 7, archipelago
FT                   homolog (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG114058.1 transcript_id=mCT190977.0
FT                   protein_id=mCP111933.0 isoform=CRA_b"
FT                   /protein_id="EDL15400.1"
FT                   /translation="SLYTLCLDNQNVKTFASSDSLAKVQEVASWLLEMNQELLSVGSKR
FT                   RRTGGSLRGNASSSQVDEGQMNRVVEEDPQQQARHQEEEHTARNGELVGANPRPGDQND
FT                   TQQGQVEENNNRFISVDEDSSGNQEEQEEDEEHAGEQEEEEEEEEEEEEMDQESDDFDP
FT                   SDDSSREDEHTHNSNVTNCSSVSDLPAHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKK
FT                   PCKVSDYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWS
FT                   GPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQA
FT                   AQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDT
FT                   NWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTG
FT                   GVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDA
FT                   TLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGH
FT                   TNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNA
FT                   DSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIR
FT                   NLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK"
FT   CDS             join(20238799..20238975,20287497..20287772,
FT                   20289992..20290074,20293620..20293761,20300364..20300498,
FT                   20302557..20302680,20304282..20304418,20305913..20306026,
FT                   20307492..20307673,20309520..20309745,20311291..20311501,
FT                   20312390..20312658)
FT                   /codon_start=1
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /product="F-box and WD-40 domain protein 7, archipelago
FT                   homolog (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG114058.1 transcript_id=mCT115149.1
FT                   protein_id=mCP65815.1 isoform=CRA_a"
FT                   /protein_id="EDL15399.1"
FT                   /translation="MNQELLSVGSKRRRTGGSLRGNASSSQVDEGQMNRVVEEDPQQQA
FT                   RHQEEEHTARNGELWSCMRVCVPSSVLVLSCVCWCWGVLLPVPLPNLPFLACLSMSTLE
FT                   SVTYLPEKGLYCQRLPSSRTHGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVR
FT                   SFSLGKKPCKVSDYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWL
FT                   KMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLE
FT                   PKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYI
FT                   RQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLR
FT                   TLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRV
FT                   VSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETC
FT                   LHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDN
FT                   ILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDL
FT                   KTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK"
FT   gene            complement(20248135..20248790)
FT                   /pseudo
FT                   /locus_tag="mCG_50137"
FT                   /note="gene_id=mCG50137.2"
FT   mRNA            complement(20248135..20248790)
FT                   /pseudo
FT                   /locus_tag="mCG_50137"
FT                   /note="gene_id=mCG50137.2 transcript_id=mCT50320.2 created
FT                   on 28-MAR-2003"
FT   assembly_gap    20272984..20273103
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    20279630..20283272
FT                   /estimated_length=3643
FT                   /gap_type="unknown"
FT   assembly_gap    20375470..20375755
FT                   /estimated_length=286
FT                   /gap_type="unknown"
FT   assembly_gap    20405200..20405492
FT                   /estimated_length=293
FT                   /gap_type="unknown"
FT   assembly_gap    20417192..20417232
FT                   /estimated_length=41
FT                   /gap_type="unknown"
FT   assembly_gap    20420336..20420382
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    20425978..20425997
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20430070..20430089
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20443300..20443422
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    20460501..20460520
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20462998..20463881
FT                   /estimated_length=884
FT                   /gap_type="unknown"
FT   assembly_gap    20465313..20465332
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20474921..20475101
FT                   /estimated_length=181
FT                   /gap_type="unknown"
FT   assembly_gap    20506284..20506303
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20537035..20537054
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20541117..20541188
FT                   /estimated_length=72
FT                   /gap_type="unknown"
FT   assembly_gap    20563281..20563305
FT                   /estimated_length=25
FT                   /gap_type="unknown"
FT   assembly_gap    20582836..20582855
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20586134..20586907
FT                   /estimated_length=774
FT                   /gap_type="unknown"
FT   assembly_gap    20588848..20588867
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20590443..20590462
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20597170..20597189
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20598547..20598566
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20600562..20600581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20602101..20602120
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20603199..20603218
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20604360..20604379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20605713..20605732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20617581..20617767
FT                   /estimated_length=187
FT                   /gap_type="unknown"
FT   assembly_gap    20620880..20621004
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   assembly_gap    20622462..20622481
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20623623..20623642
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20643158..20643195
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    20646810..20647062
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   gene            <20659946..20672893
FT                   /locus_tag="mCG_146183"
FT                   /note="gene_id=mCG146183.0"
FT   mRNA            join(<20659946..20659988,20671828..20672163,
FT                   20672736..20672893)
FT                   /locus_tag="mCG_146183"
FT                   /product="mCG146183"
FT                   /note="gene_id=mCG146183.0 transcript_id=mCT186286.0
FT                   created on 14-JUL-2003"
FT   CDS             <20671832..20672011
FT                   /codon_start=1
FT                   /locus_tag="mCG_146183"
FT                   /product="mCG146183"
FT                   /note="gene_id=mCG146183.0 transcript_id=mCT186286.0
FT                   protein_id=mCP107587.0"
FT                   /protein_id="EDL15398.1"
FT                   /translation="AITTVLRRQERQPRTTEPHACQHLAPAATGAMRVLRTRQEDRIDT
FT                   WPIDGGRAKPMVLN"
FT   assembly_gap    20675484..20675532
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    20678470..20678489
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20699901..20701087
FT                   /estimated_length=1187
FT                   /gap_type="unknown"
FT   assembly_gap    20730793..20731107
FT                   /estimated_length=315
FT                   /gap_type="unknown"
FT   gene            complement(20733220..>20769751)
FT                   /locus_tag="mCG_145241"
FT                   /note="gene_id=mCG145241.0"
FT   mRNA            complement(join(20733220..20733935,20736525..20736647,
FT                   20739220..20739446,20740352..20740624,20769640..>20769751))
FT                   /locus_tag="mCG_145241"
FT                   /product="mCG145241"
FT                   /note="gene_id=mCG145241.0 transcript_id=mCT184665.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(20739352..20739446,20740352..>20740511))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145241"
FT                   /product="mCG145241"
FT                   /note="gene_id=mCG145241.0 transcript_id=mCT184665.0
FT                   protein_id=mCP105808.0"
FT                   /protein_id="EDL15397.1"
FT                   /translation="KWLLIDHKSCCASGHYKREEIAAFYIPQGINSKTVSCPYVGTKHI
FT                   LWHLLLGTAFLSGTQWALVATGFVEGSMSLWAWVMRPCF"
FT   assembly_gap    20740941..20741010
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    20742909..20743455
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    20755312..20755408
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    20772099..20772118
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20779832..20780354
FT                   /estimated_length=523
FT                   /gap_type="unknown"
FT   assembly_gap    20781625..20782318
FT                   /estimated_length=694
FT                   /gap_type="unknown"
FT   assembly_gap    20787370..20787671
FT                   /estimated_length=302
FT                   /gap_type="unknown"
FT   assembly_gap    20796582..20796601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20803777..20803796
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20815515..20815594
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    20817845..20818149
FT                   /estimated_length=305
FT                   /gap_type="unknown"
FT   assembly_gap    20842494..20843445
FT                   /estimated_length=952
FT                   /gap_type="unknown"
FT   assembly_gap    20857058..20857145
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    20860841..20860860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20886246..20895321)
FT                   /locus_tag="mCG_147521"
FT                   /note="gene_id=mCG147521.0"
FT   mRNA            complement(join(20886246..20886485,20895224..20895321))
FT                   /locus_tag="mCG_147521"
FT                   /product="mCG147521"
FT                   /note="gene_id=mCG147521.0 transcript_id=mCT187784.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(20886379..20886485,20895224..20895266))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147521"
FT                   /product="mCG147521"
FT                   /note="gene_id=mCG147521.0 transcript_id=mCT187784.0
FT                   protein_id=mCP109365.0"
FT                   /protein_id="EDL15396.1"
FT                   /translation="MGLQEYPSQSLPCDCPSETTVDQGLLSLSLQVTCSSRLCTGMTSF
FT                   LSHP"
FT   assembly_gap    20908546..20908565
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <20915998..20991715
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /note="gene_id=mCG6516.4"
FT   mRNA            join(<20915998..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20990222)
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), transcript variant
FT                   mCT190942"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT190942.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<20915998..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989920)
FT                   /codon_start=1
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT190942.0
FT                   protein_id=mCP111924.0 isoform=CRA_b"
FT                   /protein_id="EDL15394.1"
FT                   /translation="RDFGDAMAAPMLRLGFPGRRWALTWLDGGSRHRSGSQTGPTSNWA
FT                   RRQSSVAQPSLHTAQKPRKGEHKWAAVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVS
FT                   YFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYSDLPAGYQITQQRL
FT                   PIAANGHLTYCIYLGKKPSQVTTKTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIG
FT                   LLEVVLEPDLCCGEEAALAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGV
FT                   RTEVKNLNSLRFLAKAIDYEIQRQITELENGGEILNETRSFDYKLGCTMPMRDKEGKQD
FT                   YRFMPEPNLPPLVLYDDTSLPRGADSQQVINIDQLRDMLPELPSATRERLVQQYGMLPE
FT                   HSFALLNEVGLLEFFQNVIKETRTEPKKVTNWVLNTFLCYLKQQNLAVSESPVTPSALA
FT                   ELLNLLDRKAISSSAAKQVFEELWKGEGKTAAQIVSEQQLELMQDQEALEKLCQTTIDG
FT                   HPQVVTICNRSKSFVCNRSEGQLDICPQTLPSPINPYLCVSG"
FT   mRNA            join(20915999..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989803,20991113..20991552)
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), transcript variant
FT                   mCT181557"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT181557.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(20916001..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989846,20991113..20991715)
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), transcript variant mCT5946"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT5946.2 created on
FT                   26-MAR-2003"
FT   CDS             join(20916016..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989803,20991113..20991241)
FT                   /codon_start=1
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT181557.0
FT                   protein_id=mCP104479.0 isoform=CRA_a"
FT                   /protein_id="EDL15393.1"
FT                   /translation="MAAPMLRLGFPGRRWALTWLDGGSRHRSGSQTGPTSNWARRQSSV
FT                   AQPSLHTAQKPRKGEHKWAAVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVSYFDASL
FT                   PGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYSDLPAGYQITQQRLPIAANG
FT                   HLTYCIYLGKKPSQVTTKTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIGLLEVVL
FT                   EPDLCCGEEAALAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKN
FT                   LNSLRFLAKAIDYEIQRQITELENGGEILNETRSFDYKLGCTMPMRDKEGKQDYRFMPE
FT                   PNLPPLVLYDDTSLPRGADSQQVINIDQLRDMLPELPSATRERLVQQYGMLPEHSFALL
FT                   NEVGLLEFFQNVIKETRTEPKKVTNWVLNTFLCYLKQQNLAVSESPVTPSALAELLNLL
FT                   DRKAISSSAAKQVFEELWKGEGKTAAQIVSEQQLELMQDQEALEKLCQTTIDGHPQVVM
FT                   DVKKRNPKAINKLIGLVRKASHSRADPALIKKILERKLSL"
FT   CDS             join(20916016..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989846,20991113..20991153)
FT                   /codon_start=1
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), isoform CRA_c"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT5946.2
FT                   protein_id=mCP11559.3 isoform=CRA_c"
FT                   /protein_id="EDL15395.1"
FT                   /translation="MAAPMLRLGFPGRRWALTWLDGGSRHRSGSQTGPTSNWARRQSSV
FT                   AQPSLHTAQKPRKGEHKWAAVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVSYFDASL
FT                   PGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYSDLPAGYQITQQRLPIAANG
FT                   HLTYCIYLGKKPSQVTTKTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIGLLEVVL
FT                   EPDLCCGEEAALAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKN
FT                   LNSLRFLAKAIDYEIQRQITELENGGEILNETRSFDYKLGCTMPMRDKEGKQDYRFMPE
FT                   PNLPPLVLYDDTSLPRGADSQQVINIDQLRDMLPELPSATRERLVQQYGMLPEHSFALL
FT                   NEVGLLEFFQNVIKETRTEPKKVTNWVLNTFLCYLKQQNLAVSESPVTPSALAELLNLL
FT                   DRKAISSSAAKQVFEELWKGEGKTAAQIVSEQQLELMQDQEALEKLCQTTIDGHPQVVT
FT                   ICNRSKSFVCNRSDGCEEKKPQSYK"
FT   assembly_gap    20957996..20958329
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    20964281..20964300
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20965888..20965907
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    20968805..20968824
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(20997449..21229943)
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /note="gene_id=mCG51579.2"
FT   mRNA            complement(join(20997449..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21021001..21021080,21025851..21026018,21057818..21057904,
FT                   21060104..21060262,21067974..21068285))
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, transcript variant
FT                   mCT185450"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT185450.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(20997450..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21021001..21021080,21025851..21026018,21057818..21057904,
FT                   21060104..21060262,21124845..21124951,21156725..21156844,
FT                   21229551..21229883))
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, transcript variant
FT                   mCT5950"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT5950.2 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(20997455..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21018315..21018407,21021001..21021080,21025851..21026018,
FT                   21057818..21057904,21060104..21060262,21124845..21124951,
FT                   21156725..21156844,21159399..21159565,21229551..21229943))
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, transcript variant
FT                   mCT185449"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT185449.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(20998356..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21021001..21021080,21025851..21026018,21057818..21057904,
FT                   21060104..21060262,21124845..21124913))
FT                   /codon_start=1
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, isoform CRA_c"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT5950.2
FT                   protein_id=mCP11552.3 isoform=CRA_c"
FT                   /protein_id="EDL15391.1"
FT                   /translation="MFNSLNPIVRASNSGITTPVVKQVLATGLSGLYSSLPTKLEEKGE
FT                   DWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQLVSYIYNGFLVPVLAPALH
FT                   KVTVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHENVHILDTLTSRINTPFRLC
FT                   VVSLALFRTLIGLHCEDVMLQLVLRYLVPCNHMMLSQRWAVKERDCYSVSAAKLLALTP
FT                   VCCASGITLTLGNQERDYILWSKCMHDGSGSEEQLLPETPCSPSSPSPPPPPAPAACIV
FT                   EYGKALDISYLQYLWEAHTNILHCMRDCRVWSALYDGDSPDPETFLQSLSEESRENSGH
FT                   PEARLPQQSVRTSGQTKDKSQSELEWDDSYDTGISSGADVGSPGPDDEVETPAPPAPID
FT                   PPKHIQEMKKNAILLFKGSYIEESDFQDDVMVYRLCAEKDTEDTTEPQKDTSEPQGDTL
FT                   EPLEDTSEQQEDTSEQLEDTSELQEDTAEPQGDTADPTAEAQPKLQPEAQSLPTSNGPL
FT                   SSPDPETESQPSRESSDLCQNTFSEAKPENEPGVALALDSELIATTFEAEPQSELAVVS
FT                   TESEDFIAQYDQIIQELDSGTEGLTEQSIPISEPSLLTQQEERREECKEEEDDDFDSLM
FT                   AATPAVEAGSSPFGVGEDTAFSSRHPVRTQSTPFTGPFISVVLSKLENMLENSLHVNLL
FT                   LIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLASVKNKIEQFASVERDFPGLL
FT                   IQAQQYLLFRVDMSDMAPAALTKDPIQEISRPESDKTLLDGPPRVLQPFLGNRAKVTRA
FT                   PPNLPLPVKNTMLAAALFPEFLKELAALAQEHSILCYKILGDFEDSCC"
FT   CDS             complement(join(20998356..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21018315..21018407,21021001..21021080,21025851..21026018,
FT                   21057818..21057904,21060104..21060262,21124845..21124913))
FT                   /codon_start=1
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, isoform CRA_a"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT185449.0
FT                   protein_id=mCP106706.0 isoform=CRA_a"
FT                   /protein_id="EDL15389.1"
FT                   /translation="MFNSLNPIVRASNSGITTPVVKQVLATGLSGLYSSLPTKLEEKGE
FT                   DWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQLVSYIYNGFLVPVLAPALH
FT                   KVTVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHENVHILDTLTSRINTPFRLC
FT                   VVSLALFRTLIGLHCEDVMLQLVLSLTGSEVHCFLPVGHQGQAKPELWQACLLDIWYLV
FT                   PCNHMMLSQRWAVKERDCYSVSAAKLLALTPVCCASGITLTLGNQERDYILWSKCMHDG
FT                   SGSEEQLLPETPCSPSSPSPPPPPAPAACIVEYGKALDISYLQYLWEAHTNILHCMRDC
FT                   RVWSALYDGDSPDPETFLQSLSEESRENSGHPEARLPQQSVRTSGQTKDKSQSELEWDD
FT                   SYDTGISSGADVGSPGPDDEVETPAPPAPIDPPKHIQEMKKNAILLFKGSYIEESDFQD
FT                   DVMVYRLCAEKDTEDTTEPQKDTSEPQGDTLEPLEDTSEQQEDTSEQLEDTSELQEDTA
FT                   EPQGDTADPTAEAQPKLQPEAQSLPTSNGPLSSPDPETESQPSRESSDLCQNTFSEAKP
FT                   ENEPGVALALDSELIATTFEAEPQSELAVVSTESEDFIAQYDQIIQELDSGTEGLTEQS
FT                   IPISEPSLLTQQEERREECKEEEDDDFDSLMAATPAVEAGSSPFGVGEDTAFSSRHPVR
FT                   TQSTPFTGPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQ
FT                   PSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLLFRVDMSDMAPAALTKDPIQE
FT                   ISRPESDKTLLDGPPRVLQPFLGNRAKVTRAPPNLPLPVKNTMLAAALFPEFLKELAAL
FT                   AQEHSILCYKILGDFEDSCC"
FT   CDS             complement(join(20998356..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21021001..21021080,21025851..21026018,21057818..21057904,
FT                   21060104..21060262,21067974..21068276))
FT                   /codon_start=1
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, isoform CRA_b"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT185450.0
FT                   protein_id=mCP106707.0 isoform=CRA_b"
FT                   /protein_id="EDL15390.1"
FT                   /translation="MMLLSSCSGTATPAVEGKLVVLLNQLCSILAKDPSILELFFHTSE
FT                   DQGAANFLIFSLLIPFIHREGTVGQQARDALLFIMSLSAENSMVANHIVENTYFCPVLA
FT                   TGLSGLYSSLPTKLEEKGEDWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQ
FT                   LVSYIYNGFLVPVLAPALHKVTVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHE
FT                   NVHILDTLTSRINTPFRLCVVSLALFRTLIGLHCEDVMLQLVLRYLVPCNHMMLSQRWA
FT                   VKERDCYSVSAAKLLALTPVCCASGITLTLGNQERDYILWSKCMHDGSGSEEQLLPETP
FT                   CSPSSPSPPPPPAPAACIVEYGKALDISYLQYLWEAHTNILHCMRDCRVWSALYDGDSP
FT                   DPETFLQSLSEESRENSGHPEARLPQQSVRTSGQTKDKSQSELEWDDSYDTGISSGADV
FT                   GSPGPDDEVETPAPPAPIDPPKHIQEMKKNAILLFKGSYIEESDFQDDVMVYRLCAEKD
FT                   TEDTTEPQKDTSEPQGDTLEPLEDTSEQQEDTSEQLEDTSELQEDTAEPQGDTADPTAE
FT                   AQPKLQPEAQSLPTSNGPLSSPDPETESQPSRESSDLCQNTFSEAKPENEPGVALALDS
FT                   ELIATTFEAEPQSELAVVSTESEDFIAQYDQIIQELDSGTEGLTEQSIPISEPSLLTQQ
FT                   EERREECKEEEDDDFDSLMAATPAVEAGSSPFGVGEDTAFSSRHPVRTQSTPFTGPFIS
FT                   VVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLAS
FT                   VKNKIEQFASVERDFPGLLIQAQQYLLFRVDMSDMAPAALTKDPIQEISRPESDKTLLD
FT                   GPPRVLQPFLGNRAKVTRAPPNLPLPVKNTMLAAALFPEFLKELAALAQEHSILCYKIL
FT                   GDFEDSCC"
FT   assembly_gap    21020336..21020417
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    21047544..21047563
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21058709..21058728
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21082580..21082599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21083757..21083776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21084881..21084900
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21096740..21096853
FT                   /estimated_length=114
FT                   /gap_type="unknown"
FT   assembly_gap    21100728..21100747
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21118842..21118880
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    21120323..21120832
FT                   /estimated_length=510
FT                   /gap_type="unknown"
FT   assembly_gap    21122203..21122990
FT                   /estimated_length=788
FT                   /gap_type="unknown"
FT   assembly_gap    21145699..21145718
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21191942..21191961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21198359..21198378
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21201184..21201251
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   gene            complement(21211663..21214003)
FT                   /locus_tag="mCG_145726"
FT                   /note="gene_id=mCG145726.0"
FT   mRNA            complement(21211663..21214003)
FT                   /locus_tag="mCG_145726"
FT                   /product="mCG145726"
FT                   /note="gene_id=mCG145726.0 transcript_id=mCT51762.2 created
FT                   on 23-JUN-2003"
FT   CDS             complement(21213480..21213977)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145726"
FT                   /product="mCG145726"
FT                   /note="gene_id=mCG145726.0 transcript_id=mCT51762.2
FT                   protein_id=mCP33353.2"
FT                   /db_xref="GOA:Q8BML3"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="MGI:MGI:2443773"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BML3"
FT                   /protein_id="EDL15392.1"
FT                   /translation="MKRVFVTVGTTSFDDLIARVVAHDSVQILKNLGYNQLVLQIGRGT
FT                   VVPEPFSTESFTLDVYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKL
FT                   MNNHQFELAKQLHKEGHLFYCTCSMLPELLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL
FT                   QK"
FT   assembly_gap    21225958..21226615
FT                   /estimated_length=658
FT                   /gap_type="unknown"
FT   assembly_gap    21242786..21242805
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21258094..21258517
FT                   /locus_tag="mCG_1125"
FT                   /note="gene_id=mCG1125.0"
FT   mRNA            21258094..21258517
FT                   /locus_tag="mCG_1125"
FT                   /product="mCG1125"
FT                   /note="gene_id=mCG1125.0 transcript_id=mCT8790.1 created on
FT                   07-NOV-2002"
FT   CDS             21258136..21258423
FT                   /codon_start=1
FT                   /locus_tag="mCG_1125"
FT                   /product="mCG1125"
FT                   /note="gene_id=mCG1125.0 transcript_id=mCT8790.1
FT                   protein_id=mCP22866.1"
FT                   /protein_id="EDL15388.1"
FT                   /translation="MSTNTDLSLSSYDEGQGSKFIRKAKETLFVPIGMAGFAAIVAYGL
FT                   YKLKSRGNTKMSIHLIHMRVAAQGFVVGAMTLGMGYSMYQEFWANPKPKP"
FT   assembly_gap    21285997..21286386
FT                   /estimated_length=390
FT                   /gap_type="unknown"
FT   assembly_gap    21290092..21290819
FT                   /estimated_length=728
FT                   /gap_type="unknown"
FT   assembly_gap    21297950..21297969
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21309005..21309434
FT                   /estimated_length=430
FT                   /gap_type="unknown"
FT   assembly_gap    21312790..21313295
FT                   /estimated_length=506
FT                   /gap_type="unknown"
FT   assembly_gap    21318975..21318994
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21326370..21326389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(<21337041..>21343651)
FT                   /gene="Gm1019"
FT                   /locus_tag="mCG_1126"
FT                   /note="gene_id=mCG1126.2"
FT   mRNA            complement(join(<21337041..21337187,21340319..21340485,
FT                   21341161..21341420,21343489..>21343651))
FT                   /gene="Gm1019"
FT                   /locus_tag="mCG_1126"
FT                   /product="gene model 1019, (NCBI)"
FT                   /note="gene_id=mCG1126.2 transcript_id=mCT8791.2 created on
FT                   07-NOV-2002"
FT   CDS             complement(join(<21337041..21337187,21340319..21340485,
FT                   21341161..21341420,21343489..>21343649))
FT                   /codon_start=1
FT                   /gene="Gm1019"
FT                   /locus_tag="mCG_1126"
FT                   /product="gene model 1019, (NCBI)"
FT                   /note="gene_id=mCG1126.2 transcript_id=mCT8791.2
FT                   protein_id=mCP22871.2"
FT                   /protein_id="EDL15387.1"
FT                   /translation="CGRPVHTGRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWV
FT                   LTAAHCIKKTWYSFLYSVWLGSIDREYSSTGKEYYVSRIAIPDKHRHTEADIALLKLSS
FT                   RVTFSSVILPICLPNISKQLTVPASCWVTGWGQNQEGHYPSTLQELEVPVISSEACEQL
FT                   YNPIGIFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSWGLE
FT                   CGKDLPGVYTNVTYYQKWISAII"
FT   assembly_gap    21352187..21352520
FT                   /estimated_length=334
FT                   /gap_type="unknown"
FT   assembly_gap    21367822..21367841
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21375011..21375030
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21377477..21377496
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            <21382959..21470210
FT                   /locus_tag="mCG_1127"
FT                   /note="gene_id=mCG1127.2"
FT   mRNA            join(<21382959..21383103,21417366..21417406,
FT                   21421175..21421214,21422625..21422667,21425479..21425617,
FT                   21425754..>21425823)
FT                   /locus_tag="mCG_1127"
FT                   /product="mCG1127, transcript variant mCT181716"
FT                   /note="gene_id=mCG1127.2 transcript_id=mCT181716.0 created
FT                   on 01-APR-2003"
FT   mRNA            join(21383083..21383103,21417366..21417406,
FT                   21422625..21422667,21425479..21425617,21425754..21425907,
FT                   21426620..21427609,21435714..21435821,21440168..21440280,
FT                   21444928..21444989,21446107..21446371,21448612..21448680,
FT                   21448855..21448995,21454758..21454830,21456439..21456569,
FT                   21458471..21458529,21462176..21462378,21462780..21462832,
FT                   21464846..21465032,21465386..21465483,21468301..21470210)
FT                   /locus_tag="mCG_1127"
FT                   /product="mCG1127, transcript variant mCT8795"
FT                   /note="gene_id=mCG1127.2 transcript_id=mCT8795.2 created on
FT                   01-APR-2003"
FT   assembly_gap    21384432..21384451
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(<21421184..21421214,21422625..21422667,
FT                   21425479..21425617,21425754..>21425823)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1127"
FT                   /product="mCG1127, isoform CRA_b"
FT                   /note="gene_id=mCG1127.2 transcript_id=mCT181716.0
FT                   protein_id=mCP104638.0 isoform=CRA_b"
FT                   /protein_id="EDL15386.1"
FT                   /translation="LVYSTMPRGRASRTCIQSELHRDRRRPEITIVAAEPLRPASWFPG
FT                   APPPGLGFPSTPGAGPWRPNDLVPAELPPSYEQVIKEINQVQVNATNNN"
FT   CDS             join(21426916..21427609,21435714..21435821,
FT                   21440168..21440280,21444928..21444989,21446107..21446371,
FT                   21448612..21448680,21448855..21448995,21454758..21454830,
FT                   21456439..21456569,21458471..21458529,21462176..21462378,
FT                   21462780..21462832,21464846..21465032,21465386..21465483,
FT                   21468301..21468417)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1127"
FT                   /product="mCG1127, isoform CRA_a"
FT                   /note="gene_id=mCG1127.2 transcript_id=mCT8795.2
FT                   protein_id=mCP22867.2 isoform=CRA_a"
FT                   /protein_id="EDL15385.1"
FT                   /translation="MMNIMNTEQSQNTIVSRIKAFEGQTNTEIPGLPKKPEIIPRTIPP
FT                   KPAVSSGKPLVAPKPAANRASGEWDTWAENRLKVTSREGLTPYSSPQEAGITPVTKPEL
FT                   PKKPTPGLTRSVNHETSGGRPMAESPDTGKKIPTPAPRPLLPKKSASTDAPPYPSIPPK
FT                   LVSAPPRLSVASQAKAFRSLGEGLPSNPPVPAPQSKALGDIDLISFDDDVLPTSGSPAE
FT                   EPTGSETVLDPFQLPTKTEATKERAVQPAPTRKPTVIRIPAKPGKCLHEEPQSPPPLPA
FT                   EKPVGNTHSAVSGRPSHSDRTRNPELEQASESGGLVQGPPRLPPRPVHGKVIPVWRPPP
FT                   KGAPERPPPPKLPASKSSNKNLPFNRSSSDMDLQKKQSHFVSGLSKAKSQIFKNQDPVL
FT                   PPRPKPGHPLYRKYMLSVPHGIANEDIVSRNPTELSCKRGDVLVILKQAENNYLECQRG
FT                   EGTGRVHPSQMKIVTPLDERPRGRPNDSGHSQKPVDSGAPHAVALHDFPAEQADDLSLT
FT                   SGEIVYLLEKIDAEWYRGKCRNQTGVFPANYVKVIVDIPEGRSGKRESFSSHCAKGPRC
FT                   VARFEYIGDQKDELSFSEGEVIILTEYVNEEWGRGEIRDRSGIFPLNFVELVGDHPTSG
FT                   ANILSTKVPPKTKNEDPGSNSQDSSPPGEWCKALHSFTAETSEDLPFKRGDRILILERL
FT                   DSDWYRGRLHDREGIFPAVFVQPCPAEAKGVASAIPKGRKVKALYDFLGENEDELSFKA
FT                   GDVITELEPIDDAWMRGELMGRAGMFPKNYVQFLQVS"
FT   assembly_gap    21432468..21432649
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    21464031..21464296
FT                   /estimated_length=266
FT                   /gap_type="unknown"
FT   assembly_gap    21479628..21479647
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(21480291..21484929)
FT                   /locus_tag="mCG_1128"
FT                   /note="gene_id=mCG1128.2"
FT   mRNA            complement(join(21480291..21480456,21480794..21480903,
FT                   21481349..21481557,21483500..21483687,21483959..21484062,
FT                   21484769..21484929))
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, transcript variant mCT8792"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT8792.2 created on
FT                   28-MAR-2003"
FT   mRNA            complement(join(21480293..21480456,21480794..21480903,
FT                   21481349..21481557,21483500..21483687,21483959..21484062,
FT                   21484771..21484847))
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, transcript variant mCT181563"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT181563.0 created
FT                   on 28-MAR-2003"
FT   CDS             complement(join(21480335..21480456,21480794..21480903,
FT                   21481349..21481557,21483500..21483687,21483959..21484062,
FT                   21484769..21484830))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, isoform CRA_c"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT8792.2
FT                   protein_id=mCP22810.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q564F3"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="MGI:MGI:1202063"
FT                   /db_xref="UniProtKB/TrEMBL:Q564F3"
FT                   /protein_id="EDL15384.1"
FT                   /translation="MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIG
FT                   KTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMD
FT                   LTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQ
FT                   IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPK
FT                   FELGKLMELHGEGGSSGKAAGDETGAKVERADGYEPPVQESV"
FT   CDS             complement(join(21480335..21480456,21480794..21480903,
FT                   21481349..21481557,21483500..21483687,21483959..21484013))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, isoform CRA_a"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT181563.0
FT                   protein_id=mCP104486.0 isoform=CRA_a"
FT                   /protein_id="EDL15382.1"
FT                   /translation="MFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFR
FT                   KFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVG
FT                   FTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKA
FT                   CQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGGSSGKAAGDETGAKVERADGYEPP
FT                   VQESV"
FT   mRNA            complement(join(<21480830..21480903,21481349..21481557,
FT                   21483500..21483687,21483959..21484021,21484797..21484842))
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, transcript variant mCT181564"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT181564.0 created
FT                   on 28-MAR-2003"
FT   CDS             complement(join(<21480830..21480903,21481349..21481557,
FT                   21483500..21483687,21483959..21484021,21484797..21484830))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, isoform CRA_b"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT181564.0
FT                   protein_id=mCP104485.0 isoform=CRA_b"
FT                   /protein_id="EDL15383.1"
FT                   /translation="MAVGKNKRLTKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFE
FT                   VSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDV
FT                   KTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVN
FT                   KLIPDSIGKDIEKACQSIYPLHDVFV"
FT   gene            21485016..21487790
FT                   /locus_tag="mCG_147525"
FT                   /note="gene_id=mCG147525.0"
FT   mRNA            join(21485016..21485466,21487259..21487790)
FT                   /locus_tag="mCG_147525"
FT                   /product="mCG147525"
FT                   /note="gene_id=mCG147525.0 transcript_id=mCT187788.0
FT                   created on 13-JAN-2004"
FT   CDS             join(21485464..21485466,21487259..21487504)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147525"
FT                   /product="mCG147525"
FT                   /note="gene_id=mCG147525.0 transcript_id=mCT187788.0
FT                   protein_id=mCP109367.0"
FT                   /protein_id="EDL15381.1"
FT                   /translation="MVPFSAAHPPCPINGSLTPFLLLHRVTPLKGTKLRNGSCLTSQKT
FT                   LSEFDGTRSLTNHSISQDAHQLDFFSNKEAYDETFLC"
FT   assembly_gap    21488717..21488736
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            21498002..21515539
FT                   /locus_tag="mCG_114520"
FT                   /note="gene_id=mCG114520.0"
FT   mRNA            join(21498002..21498244,21515311..21515539)
FT                   /locus_tag="mCG_114520"
FT                   /product="mCG114520"
FT                   /note="gene_id=mCG114520.0 transcript_id=mCT115611.0
FT                   created on 07-NOV-2002"
FT   CDS             join(21498157..21498244,21515311..21515408)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114520"
FT                   /product="mCG114520"
FT                   /note="gene_id=mCG114520.0 transcript_id=mCT115611.0
FT                   protein_id=mCP65541.1"
FT                   /protein_id="EDL15380.1"
FT                   /translation="MKEQQLERRCIQAAMTKRNSGNSPEPKLRGQGTEPGTEEPEDTEQ
FT                   DDFRSRSNQARPGDTG"
FT   assembly_gap    21514145..21514460
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    21517750..21517769
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21531143..21531162
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21535638..21535753
FT                   /estimated_length=116
FT                   /gap_type="unknown"
FT   assembly_gap    21564126..21564145
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21574171..21576566
FT                   /estimated_length=2396
FT                   /gap_type="unknown"
FT   assembly_gap    21589174..21591235
FT                   /estimated_length=2062
FT                   /gap_type="unknown"
FT   assembly_gap    21603265..21603284
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21619687..21619777
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   gene            <21620026..22109992
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /note="gene_id=mCG1129.1"
FT   mRNA            join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073198,22078862..22079017,
FT                   22084717..22084884,22100435..22100536,22103306..22103502,
FT                   22107420..22107571,22108879..22109992)
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, transcript
FT                   variant mCT8793"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT8793.1 created on
FT                   16-AUG-2002"
FT   CDS             join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073198,22078862..22079017,
FT                   22084717..22084884,22100435..22100536,22103306..22103502,
FT                   22107420..22107571,22108879..22108969)
FT                   /codon_start=1
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, isoform CRA_c"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT8793.1
FT                   protein_id=mCP22811.1 isoform=CRA_c"
FT                   /protein_id="EDL15377.1"
FT                   /translation="KLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTA
FT                   ILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSK
FT                   LQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFH
FT                   TWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFD
FT                   FKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETAD
FT                   ANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDG
FT                   KLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSI
FT                   GGVQVLFPLFAQLDYKQYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIG
FT                   YSLEKSSKSHVSRAVLELCLAFSKYLSNLQNGMPLLKQLCDHILLNPAVWIHTPAKVQL
FT                   MLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPN
FT                   QKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAE
FT                   HPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLF
FT                   SLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIAT
FT                   LLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDE
FT                   QKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRK
FT                   GDEETGPCSSSLVPEGTGATRGVDVSVGSQHEDRKDSPISPHFTRNSDENSSIGRASSI
FT                   DSASNTELQTHDMSSDEKKVERENQELLDQATVEETATNGAKDDLETSSDAAEPVTINS
FT                   NSLEPGKDTVTISEVSASISSPSEEDAAEMPELLEKSGVEEEEDDDYVELKVEGSPTEE
FT                   AGLPTELQGEGLSVAASEGREEPDMCGHGCEVQVEAPITKIHNDPETTDSEDSRFPTVA
FT                   TAGSLATSSEVPVPQATVQSDSHEMLDGGMKATNLAGETESVSDCADNVSEAPATSEQK
FT                   ITKLDVSSVASDTERFELKASTSTEAPQPQRHGLEISRQQEQTAQGTAPDAVDQQRRDS
FT                   RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTI
FT                   HLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVL
FT                   IFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKARGDTAKSSKT
FT                   IHSLIPMGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLA
FT                   LAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGNASLPDAENTPAEFSSLTLSS
FT                   VEESLEGTSCTRRRDSGLGEETASGLGSGLSVASPAAPLGVSAGPDAISEVLCTLSLEV
FT                   NKSQETRIDGGNELDRKVTPSVPVSKNVNVKDILRSLVNMPADGVTVDPALLPPACLGA
FT                   LGDLSVDPPMQFRSFDRSVIIATKKSSVLPSALTTSAPSSAVSVVSSVDPTHASDTGGE
FT                   SPGSRSPNAKLPSVAAVGSVPQDPAAHMSITERLEHALEKAAPLLREIFVDFAPFLSRT
FT                   LLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLL
FT                   SQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAK
FT                   YRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGS
FT                   THPEATLKTAVEHAADEDILAKGKQSIKSQALGNQNSENEALLEGDDDTLSSVDEKDLE
FT                   NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHG
FT                   KWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFG
FT                   LPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWV
FT                   ITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTA
FT                   SFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYL
FT                   PEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDL
FT                   IFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEP
FT                   HPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRL
FT                   FAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIACGTGTHRRQVTDLLDQSIQVHSQCFVI
FT                   TSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSR
FT                   DATLLLWYWNGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAELGLVLSGSQEGPC
FT                   LIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVNGKLQATVETDD
FT                   HIRAIQLSRDGQYLLTGGDNGVVIVRQVSDLKQLFAYPGCDAGIRAMALSFDQRCIISG
FT                   MASGSIVLFYNDFNRWHHEYQTRY"
FT   mRNA            join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073198,22078862..22079017,
FT                   22084717..22084884,22100435..22100536,22103306..22104264)
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, transcript
FT                   variant mCT190944"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT190944.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073198,22078862..22079017,
FT                   22084717..22084884,22100435..22100536,22103306..22103553)
FT                   /codon_start=1
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, isoform CRA_a"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT190944.0
FT                   protein_id=mCP111872.0 isoform=CRA_a"
FT                   /protein_id="EDL15375.1"
FT                   /translation="KLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTA
FT                   ILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSK
FT                   LQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFH
FT                   TWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFD
FT                   FKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETAD
FT                   ANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDG
FT                   KLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSI
FT                   GGVQVLFPLFAQLDYKQYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIG
FT                   YSLEKSSKSHVSRAVLELCLAFSKYLSNLQNGMPLLKQLCDHILLNPAVWIHTPAKVQL
FT                   MLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPN
FT                   QKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAE
FT                   HPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLF
FT                   SLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIAT
FT                   LLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDE
FT                   QKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRK
FT                   GDEETGPCSSSLVPEGTGATRGVDVSVGSQHEDRKDSPISPHFTRNSDENSSIGRASSI
FT                   DSASNTELQTHDMSSDEKKVERENQELLDQATVEETATNGAKDDLETSSDAAEPVTINS
FT                   NSLEPGKDTVTISEVSASISSPSEEDAAEMPELLEKSGVEEEEDDDYVELKVEGSPTEE
FT                   AGLPTELQGEGLSVAASEGREEPDMCGHGCEVQVEAPITKIHNDPETTDSEDSRFPTVA
FT                   TAGSLATSSEVPVPQATVQSDSHEMLDGGMKATNLAGETESVSDCADNVSEAPATSEQK
FT                   ITKLDVSSVASDTERFELKASTSTEAPQPQRHGLEISRQQEQTAQGTAPDAVDQQRRDS
FT                   RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTI
FT                   HLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVL
FT                   IFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKARGDTAKSSKT
FT                   IHSLIPMGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLA
FT                   LAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGNASLPDAENTPAEFSSLTLSS
FT                   VEESLEGTSCTRRRDSGLGEETASGLGSGLSVASPAAPLGVSAGPDAISEVLCTLSLEV
FT                   NKSQETRIDGGNELDRKVTPSVPVSKNVNVKDILRSLVNMPADGVTVDPALLPPACLGA
FT                   LGDLSVDPPMQFRSFDRSVIIATKKSSVLPSALTTSAPSSAVSVVSSVDPTHASDTGGE
FT                   SPGSRSPNAKLPSVAAVGSVPQDPAAHMSITERLEHALEKAAPLLREIFVDFAPFLSRT
FT                   LLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLL
FT                   SQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAK
FT                   YRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGS
FT                   THPEATLKTAVEHAADEDILAKGKQSIKSQALGNQNSENEALLEGDDDTLSSVDEKDLE
FT                   NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHG
FT                   KWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFG
FT                   LPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWV
FT                   ITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTA
FT                   SFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYL
FT                   PEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDL
FT                   IFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEP
FT                   HPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRL
FT                   FAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIACGTGTHRRQVTDLLDQSIQVHSQCFVI
FT                   TSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSR
FT                   DATLLLWYWNGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAELGLVLSGSQEGPC
FT                   LIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVNGKLQATVETDD
FT                   HIRVSAVGSTLFLLLGSSK"
FT   mRNA            join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22074043)
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, transcript
FT                   variant mCT190945"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT190945.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073233)
FT                   /codon_start=1
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, isoform CRA_b"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT190945.0
FT                   protein_id=mCP111873.0 isoform=CRA_b"
FT                   /protein_id="EDL15376.1"
FT                   /translation="KLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTA
FT                   ILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSK
FT                   LQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFH
FT                   TWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFD
FT                   FKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETAD
FT                   ANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDG
FT                   KLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSI
FT                   GGVQVLFPLFAQLDYKQYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIG
FT                   YSLEKSSKSHVSRAVLELCLAFSKYLSNLQNGMPLLKQLCDHILLNPAVWIHTPAKVQL
FT                   MLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPN
FT                   QKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAE
FT                   HPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLF
FT                   SLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIAT
FT                   LLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDE
FT                   QKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRK
FT                   GDEETGPCSSSLVPEGTGATRGVDVSVGSQHEDRKDSPISPHFTRNSDENSSIGRASSI
FT                   DSASNTELQTHDMSSDEKKVERENQELLDQATVEETATNGAKDDLETSSDAAEPVTINS
FT                   NSLEPGKDTVTISEVSASISSPSEEDAAEMPELLEKSGVEEEEDDDYVELKVEGSPTEE
FT                   AGLPTELQGEGLSVAASEGREEPDMCGHGCEVQVEAPITKIHNDPETTDSEDSRFPTVA
FT                   TAGSLATSSEVPVPQATVQSDSHEMLDGGMKATNLAGETESVSDCADNVSEAPATSEQK
FT                   ITKLDVSSVASDTERFELKASTSTEAPQPQRHGLEISRQQEQTAQGTAPDAVDQQRRDS
FT                   RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTI
FT                   HLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVL
FT                   IFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKARGDTAKSSKT
FT                   IHSLIPMGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLA
FT                   LAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGNASLPDAENTPAEFSSLTLSS
FT                   VEESLEGTSCTRRRDSGLGEETASGLGSGLSVASPAAPLGVSAGPDAISEVLCTLSLEV
FT                   NKSQETRIDGGNELDRKVTPSVPVSKNVNVKDILRSLVNMPADGVTVDPALLPPACLGA
FT                   LGDLSVDPPMQFRSFDRSVIIATKKSSVLPSALTTSAPSSAVSVVSSVDPTHASDTGGE
FT                   SPGSRSPNAKLPSVAAVGSVPQDPAAHMSITERLEHALEKAAPLLREIFVDFAPFLSRT
FT                   LLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLL
FT                   SQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAK
FT                   YRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGS
FT                   THPEATLKTAVEHAADEDILAKGKQSIKSQALGNQNSENEALLEGDDDTLSSVDEKDLE
FT                   NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHG
FT                   KWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFG
FT                   LPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWV
FT                   ITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTA
FT                   SFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYL
FT                   PEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDL
FT                   IFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEP
FT                   HPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRL
FT                   FAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIGLSLLSLFAIH"
FT   assembly_gap    21626761..21626780
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21657168..21657187
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21658488..21658507
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21660364..21660383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21661348..21661367
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21662462..21663165
FT                   /estimated_length=704
FT                   /gap_type="unknown"
FT   assembly_gap    21695854..21695873
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21703321..21703378
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    21732635..21732654
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21814226..21814449
FT                   /estimated_length=224
FT                   /gap_type="unknown"
FT   gene            complement(21870088..21872665)
FT                   /gene="Mab21l2"
FT                   /locus_tag="mCG_1122"
FT                   /note="gene_id=mCG1122.2"
FT   mRNA            complement(21870088..21872665)
FT                   /gene="Mab21l2"
FT                   /locus_tag="mCG_1122"
FT                   /product="mab-21-like 2 (C. elegans)"
FT                   /note="gene_id=mCG1122.2 transcript_id=mCT8788.2 created on
FT                   19-AUG-2002"
FT   CDS             complement(21870648..21871727)
FT                   /codon_start=1
FT                   /gene="Mab21l2"
FT                   /locus_tag="mCG_1122"
FT                   /product="mab-21-like 2 (C. elegans)"
FT                   /note="gene_id=mCG1122.2 transcript_id=mCT8788.2
FT                   protein_id=mCP22840.1"
FT                   /protein_id="EDL15379.1"
FT                   /translation="MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEV
FT                   EVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSD
FT                   GRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIR
FT                   ERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGKQ
FT                   SSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYE
FT                   CEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAK
FT                   QTWRLAREILTNPKSLDKL"
FT   assembly_gap    21904594..21904656
FT                   /estimated_length=63
FT                   /gap_type="unknown"
FT   assembly_gap    21911993..21912129
FT                   /estimated_length=137
FT                   /gap_type="unknown"
FT   assembly_gap    21934191..21934210
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21935653..21935672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21937378..21937397
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21965087..21965106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    21982867..21982886
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22000391..22000455
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   assembly_gap    22027915..22028767
FT                   /estimated_length=853
FT                   /gap_type="unknown"
FT   assembly_gap    22047100..22047217
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   gene            complement(22095406..22105963)
FT                   /locus_tag="mCG_147518"
FT                   /note="gene_id=mCG147518.0"
FT   mRNA            complement(join(22095406..22096857,22105823..22105963))
FT                   /locus_tag="mCG_147518"
FT                   /product="mCG147518"
FT                   /note="gene_id=mCG147518.0 transcript_id=mCT187781.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(22096561..22096785)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147518"
FT                   /product="mCG147518"
FT                   /note="gene_id=mCG147518.0 transcript_id=mCT187781.0
FT                   protein_id=mCP109362.0"
FT                   /protein_id="EDL15378.1"
FT                   /translation="MAVAKAPVSSRAAPPAHLSAHTRMTWGWGRISTNKMILHVHSLQI
FT                   LQAPPASLKEQGKSSGKYHVILWMKTSDC"
FT   assembly_gap    22102751..22102820
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   gene            complement(22113464..22262382)
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /note="gene_id=mCG1124.3"
FT   mRNA            complement(join(22113464..22114719,22119376..22121220,
FT                   22126319..22126396,22126769..22126902,22132748..22132894,
FT                   22133286..22133405,22140825..22140882,22142236..22142344,
FT                   22143508..22143580,22151813..22151907,22163450..22163551,
FT                   22173397..22173499,22241994..22242325,22261509..>22261947))
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, transcript
FT                   variant mCT190941"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190941.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(22113465..22114719,22119302..22119418,
FT                   22120526..22120606,22121124..22121220,22126319..22126396,
FT                   22126769..22126902,22132748..22132894,22133286..22133405,
FT                   22140825..22140882,22142236..22142344,22143508..22143580,
FT                   22151813..22151907,22163450..22163551,22173397..22173499,
FT                   22241994..22242325,22261509..22262382))
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, transcript
FT                   variant mCT8787"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT8787.2 created on
FT                   26-MAR-2003"
FT   CDS             complement(join(22114519..22114719,22119302..22119418,
FT                   22120526..22120606,22121124..22121220,22126319..22126396,
FT                   22126769..22126902,22132748..22132894,22133286..22133405,
FT                   22140825..22140882,22142236..22142344,22143508..22143580,
FT                   22151813..22151907,22163450..22163551,22173397..22173499,
FT                   22241994..22242325,22261509..22261929))
FT                   /codon_start=1
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT8787.2
FT                   protein_id=mCP22868.2 isoform=CRA_d"
FT                   /protein_id="EDL15374.1"
FT                   /translation="MASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSISGPKGNGLI
FT                   PSPAHSAHCSFYRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLI
FT                   ELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNVNP
FT                   NWSVNIKGGTTRTLAVASSKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHS
FT                   FEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRYAQDDFV
FT                   LDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVNGTPSSQLSTPKSTKSSSSS
FT                   PTSPGSFRGLKISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFPLLEKYRIGKVIG
FT                   DGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEME
FT                   TATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPE
FT                   NLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDVWAAG
FT                   VITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVE
FT                   ARCTAGEILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALD
FT                   KEGQIFCSKLCQDSSRPSREQTSPVPPSAQEAPPPLESPRPPGPPATSGCDLAGTWRRH
FT                   RD"
FT   mRNA            complement(join(22118748..22119418,22121124..22121220,
FT                   22126319..22126396,22126769..22126902,22132748..22132894,
FT                   22133286..22133405,22140825..22140882,22142236..22142344,
FT                   22143508..22143583,22151813..22151907,22163450..22163551,
FT                   22173397..22173499,22241994..22242325,22261509..>22262140))
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, transcript
FT                   variant mCT190939"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190939.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(22119164..22119418,22121124..22121220,
FT                   22126319..22126396,22126769..22126902,22132748..22132894,
FT                   22133286..22133405,22140825..22140882,22142236..22142344,
FT                   22143508..22143583,22151813..22151907,22163450..22163551,
FT                   22173397..22173499,22241994..22242325,22261509..>22261962))
FT                   /codon_start=1
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190939.0
FT                   protein_id=mCP111869.0 isoform=CRA_a"
FT                   /protein_id="EDL15371.1"
FT                   /translation="LICGELSRAAAMASTRSIELEHFEERDKRPRPGSRRGAPSSSGGS
FT                   SISGPKGNGLIPSPAHSAHCSFYRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISN
FT                   DRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPF
FT                   RKVDYTKNVNPNWSVNIKGGTTRTLAVASSKSEVKESKDFIKPKLVTVIRSGVKPRKAV
FT                   RILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGP
FT                   EKYRYAQDDFVLDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVNGTPSSQLS
FT                   TPKSTKSSSSSPTSPGSFRGLKQISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFP
FT                   LLEKYRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVK
FT                   HPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLH
FT                   SLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAET
FT                   GYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAK
FT                   DDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMVSGTQSSASESRGWPSWSCC
FT                   LDSQGSAHGSWCLPCSCLHGGLPGM"
FT   CDS             complement(join(22121067..22121220,22126319..22126396,
FT                   22126769..22126902,22132748..22132894,22133286..22133405,
FT                   22140825..22140882,22142236..22142344,22143508..22143580,
FT                   22151813..22151907,22163450..22163551,22173397..22173499,
FT                   22241994..22242325,22261509..>22261947))
FT                   /codon_start=1
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190941.0
FT                   protein_id=mCP111871.0 isoform=CRA_c"
FT                   /protein_id="EDL15373.1"
FT                   /translation="LSRAAAMASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSISGP
FT                   KGNGLIPSPAHSAHCSFYRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRS
FT                   FDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDY
FT                   TKNVNPNWSVNIKGGTTRTLAVASSKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLN
FT                   KKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRY
FT                   AQDDFVLDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVNGTPSSQLSTPKST
FT                   KSSSSSPTSPGSFRGLKISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFPLLEKYR
FT                   IGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIM
FT                   LVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVH
FT                   RDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKV
FT                   DVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKVLCRAL
FT                   PVYTVGSLHVGL"
FT   mRNA            complement(join(22126231..22126396,22126769..22126902,
FT                   22132748..22132894,22133286..22133405,22140825..22140882,
FT                   22142236..22142344,22143508..22143580,22151813..22151907,
FT                   22163450..22163551,22173397..22173499,22241994..22242325,
FT                   22261509..>22262134))
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, transcript
FT                   variant mCT190940"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190940.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(22126315..22126396,22126769..22126902,
FT                   22132748..22132894,22133286..22133405,22140825..22140882,
FT                   22142236..22142344,22143508..22143580,22151813..22151907,
FT                   22163450..22163551,22173397..22173499,22241994..22242325,
FT                   22261509..>22261962))
FT                   /codon_start=1
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190940.0
FT                   protein_id=mCP111870.0 isoform=CRA_b"
FT                   /protein_id="EDL15372.1"
FT                   /translation="LICGELSRAAAMASTRSIELEHFEERDKRPRPGSRRGAPSSSGGS
FT                   SISGPKGNGLIPSPAHSAHCSFYRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISN
FT                   DRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPF
FT                   RKVDYTKNVNPNWSVNIKGGTTRTLAVASSKSEVKESKDFIKPKLVTVIRSGVKPRKAV
FT                   RILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGP
FT                   EKYRYAQDDFVLDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVNGTPSSQLS
FT                   TPKSTKSSSSSPTSPGSFRGLKISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFPL
FT                   LEKYRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKH
FT                   PNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHS
FT                   LSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETG
FT                   YGLKVDVWAAGVITYILLCGFPPFRR"
FT   assembly_gap    22130992..22131049
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    22142917..22142936
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22152126..22152213
FT                   /estimated_length=88
FT                   /gap_type="unknown"
FT   assembly_gap    22154749..22154768
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22156861..22156880
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22158563..22158582
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22159789..22159808
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22166969..22166988
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22168130..22168191
FT                   /estimated_length=62
FT                   /gap_type="unknown"
FT   assembly_gap    22169532..22169551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22170635..22170898
FT                   /estimated_length=264
FT                   /gap_type="unknown"
FT   assembly_gap    22172329..22172348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22173621..22173640
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22175855..22175874
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22177451..22177479
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    22178554..22178573
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            22200420..22201339
FT                   /pseudo
FT                   /locus_tag="mCG_50654"
FT                   /note="gene_id=mCG50654.2"
FT   mRNA            22200420..22201339
FT                   /pseudo
FT                   /locus_tag="mCG_50654"
FT                   /note="gene_id=mCG50654.2 transcript_id=mCT50837.2 created
FT                   on 28-MAR-2003"
FT   assembly_gap    22215370..22215389
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22248983..22249002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22262383..22262402
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22273261..22273741
FT                   /estimated_length=481
FT                   /gap_type="unknown"
FT   assembly_gap    22278413..22278432
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22284442..22284461
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22293693..22293712
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22294834..22294853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22306238..22306426
FT                   /estimated_length=189
FT                   /gap_type="unknown"
FT   assembly_gap    22307884..22308467
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    22311447..22312315
FT                   /estimated_length=869
FT                   /gap_type="unknown"
FT   assembly_gap    22315515..22316505
FT                   /estimated_length=991
FT                   /gap_type="unknown"
FT   gene            22328347..22331578
FT                   /locus_tag="mCG_3098"
FT                   /note="gene_id=mCG3098.1"
FT   mRNA            join(22328347..22328501,22328784..22329057,
FT                   22329340..22329618,22330075..22330353,22330949..22331045,
FT                   22331134..22331578)
FT                   /locus_tag="mCG_3098"
FT                   /product="mCG3098, transcript variant mCT1889"
FT                   /note="gene_id=mCG3098.1 transcript_id=mCT1889.2 created on
FT                   23-NOV-2004"
FT   mRNA            join(22328347..22328501,22328784..22328942,
FT                   22329340..22329618,22330075..22330353,22330949..22331045,
FT                   22331134..22331578)
FT                   /locus_tag="mCG_3098"
FT                   /product="mCG3098, transcript variant mCT190965"
FT                   /note="gene_id=mCG3098.1 transcript_id=mCT190965.1 created
FT                   on 23-NOV-2004"
FT   CDS             join(22328441..22328501,22328784..22328942,
FT                   22329340..22329618,22330075..22330353,22330949..22331045,
FT                   22331134..22331155)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3098"
FT                   /product="mCG3098, isoform CRA_b"
FT                   /note="gene_id=mCG3098.1 transcript_id=mCT190965.1
FT                   protein_id=mCP111919.1 isoform=CRA_b"
FT                   /protein_id="EDL15370.1"
FT                   /translation="MRYLPCLLLWAFLQVWGQSEVQQKNYTFRCLQTSSFANISWSRTD
FT                   SLILLGDLQTHRWSNDSATISFTKPWSQDPIEIQLSTGCEMYPGNASESFFHVAFQGKY
FT                   AVRFRGTSWQRVLGAPSWLDLPIKVLNADQGTSATVQTLLNDTWPQFARGLLEAGKSDL
FT                   EKQEKPVAWLSSVPSSAHGHLQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNAD
FT                   ETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVG
FT                   AVVYYIWRRRSAYQDIR"
FT   CDS             join(22328441..22328501,22328784..22329049)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3098"
FT                   /product="mCG3098, isoform CRA_a"
FT                   /note="gene_id=mCG3098.1 transcript_id=mCT1889.2
FT                   protein_id=mCP22834.3 isoform=CRA_a"
FT                   /protein_id="EDL15369.1"
FT                   /translation="MRYLPCLLLWAFLQVWGQSEVQQKNYTFRCLQTSSFANISWSRTD
FT                   SLILLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRAHTGISQ
FT                   NDVT"
FT   assembly_gap    22337132..22337151
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22337628..22341132)
FT                   /locus_tag="mCG_3074"
FT                   /note="gene_id=mCG3074.1"
FT   mRNA            complement(join(22337628..22338391,22338480..22338576,
FT                   22339128..22339406,22339862..22340140,22340423..22340695,
FT                   22340982..22341132))
FT                   /locus_tag="mCG_3074"
FT                   /product="mCG3074, transcript variant mCT1902"
FT                   /note="gene_id=mCG3074.1 transcript_id=mCT1902.1 created on
FT                   16-AUG-2002"
FT   mRNA            complement(join(22337634..22338391,22338480..22338576,
FT                   22339128..22339404,22340533..22340695,22340982..>22341104))
FT                   /locus_tag="mCG_3074"
FT                   /product="mCG3074, transcript variant mCT190951"
FT                   /note="gene_id=mCG3074.1 transcript_id=mCT190951.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(22338370..22338391,22338480..22338576,
FT                   22339128..22339406,22339862..22340140,22340423..22340695,
FT                   22340982..22341042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3074"
FT                   /product="mCG3074, isoform CRA_a"
FT                   /note="gene_id=mCG3074.1 transcript_id=mCT1902.1
FT                   protein_id=mCP22865.2 isoform=CRA_a"
FT                   /db_xref="GOA:A0A0R4J090"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="MGI:MGI:107674"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0R4J090"
FT                   /protein_id="EDL15367.1"
FT                   /translation="MRYLPWLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTD
FT                   SVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVK
FT                   MMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDL
FT                   PIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHR
FT                   QLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLAC
FT                   RVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR"
FT   CDS             complement(join(22338370..22338391,22338480..22338576,
FT                   22339128..22339404,22340533..>22340574))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3074"
FT                   /product="mCG3074, isoform CRA_b"
FT                   /note="gene_id=mCG3074.1 transcript_id=mCT190951.0
FT                   protein_id=mCP111917.0 isoform=CRA_b"
FT                   /protein_id="EDL15368.1"
FT                   /translation="LSHHQLHEAMVPGQKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPV
FT                   WVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIIL
FT                   YWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR"
FT   gene            complement(22341662..>22354002)
FT                   /locus_tag="mCG_1032356"
FT                   /note="gene_id=mCG1032356.0"
FT   mRNA            complement(join(22341662..22341864,22343193..22343263,
FT                   22347289..22347367,22353833..>22354002))
FT                   /locus_tag="mCG_1032356"
FT                   /product="mCG1032356"
FT                   /note="gene_id=mCG1032356.0 transcript_id=mCT150060.0
FT                   created on 27-MAR-2003"
FT   CDS             complement(join(22341720..22341864,22343193..>22343209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032356"
FT                   /product="mCG1032356"
FT                   /note="gene_id=mCG1032356.0 transcript_id=mCT150060.0
FT                   protein_id=mCP65812.0"
FT                   /protein_id="EDL15366.1"
FT                   /translation="NHEVLRCMARVFAVLKRFEGAHLVTFGFSSHQTDTSLRFSQIMTV
FT                   QYTEQNKN"
FT   gene            complement(22364711..22365682)
FT                   /pseudo
FT                   /locus_tag="mCG_115367"
FT                   /note="gene_id=mCG115367.1"
FT   mRNA            complement(22364711..22365682)
FT                   /pseudo
FT                   /locus_tag="mCG_115367"
FT                   /note="gene_id=mCG115367.1 transcript_id=mCT116470.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    22366017..22366134
FT                   /estimated_length=118
FT                   /gap_type="unknown"
FT   assembly_gap    22367300..22367319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22367320..22367728)
FT                   /pseudo
FT                   /locus_tag="mCG_1032219"
FT                   /note="gene_id=mCG1032219.1"
FT   mRNA            complement(22367320..22367728)
FT                   /pseudo
FT                   /locus_tag="mCG_1032219"
FT                   /note="gene_id=mCG1032219.1 transcript_id=mCT149923.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    22390242..22390261
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22397335..22397532
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   gene            complement(22426023..>22519264)
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /note="gene_id=mCG115365.0"
FT   mRNA            complement(join(22426023..22427031,22427278..22427355,
FT                   22428216..22428355,22428493..22428600,22429793..22429991,
FT                   22431561..22431661,22431754..22431880,22432546..22432673,
FT                   22432877..22433025,22433191..22433296,22433853..22434003,
FT                   22435500..22435657,22439046..22439195,22441157..22441321,
FT                   22485776..22485921,22519110..22519264))
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /product="kin of IRRE like 1 (Drosophila), transcript
FT                   variant mCT116468"
FT                   /note="gene_id=mCG115365.0 transcript_id=mCT116468.1
FT                   created on 20-AUG-2002"
FT   CDS             complement(join(22426555..22427031,22427278..22427355,
FT                   22428216..22428355,22428493..22428600,22429793..22429991,
FT                   22431561..22431661,22431754..22431880,22432546..22432673,
FT                   22432877..22433025,22433191..22433296,22433853..22434003,
FT                   22435500..22435657,22439046..22439195,22441157..22441321,
FT                   22485776..22485824))
FT                   /codon_start=1
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /product="kin of IRRE like 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG115365.0 transcript_id=mCT116468.1
FT                   protein_id=mCP65551.1 isoform=CRA_a"
FT                   /protein_id="EDL15364.1"
FT                   /translation="MWAPHLVVAYLIFVTLALALPGTQTRFSQEPADQTVVAGQRAVLP
FT                   CVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYEC
FT                   QATEAALRSRRAKLTVLIPPEETRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRD
FT                   GTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELD
FT                   VHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVD
FT                   YSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPP
FT                   LTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPII
FT                   SSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLS
FT                   TLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGATIGAGILVVFSF
FT                   AALVFFLYRRRKGSRKDVTLRKLDIKVETVNREPLTMHSDREDDTASISTATRVMKAIY
FT                   SSFKDDVDLKQDLRCDTIDTREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPT
FT                   RFDGRPSSRLSHSSGYAQLNTYSRAPASDYGTEPTPSGPSAPGGTDTTSQLSYENYEKF
FT                   NSHPFPGAAGYPTYRLGYPQAPPSGLERTPYEAYDPIGKYATATRFSYTSQHSDYGQRF
FT                   QQRMQTHV"
FT   mRNA            complement(join(22428040..22428355,22428493..22428600,
FT                   22429793..22429991,22431561..22431661,22431754..22431880,
FT                   22432546..22432673,22432877..22433025,22433191..22433296,
FT                   22433853..22434003,22435500..22435657,22439046..22439195,
FT                   22441157..22441321,22485776..22485921,22519110..>22519264))
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /product="kin of IRRE like 1 (Drosophila), transcript
FT                   variant mCT190989"
FT                   /note="gene_id=mCG115365.0 transcript_id=mCT190989.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(22428126..22428355,22428493..22428600,
FT                   22429793..22429991,22431561..22431661,22431754..22431880,
FT                   22432546..22432673,22432877..22433025,22433191..22433296,
FT                   22433853..22434003,22435500..22435657,22439046..22439195,
FT                   22441157..22441321,22485776..22485921,22519110..>22519264))
FT                   /codon_start=1
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /product="kin of IRRE like 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG115365.0 transcript_id=mCT190989.0
FT                   protein_id=mCP111935.0 isoform=CRA_b"
FT                   /protein_id="EDL15365.1"
FT                   /translation="EASECAPCVQGREGGERASGGPARADWGPAAGGQHAEPPHLDPHS
FT                   LQHFLTSRALGMTLESPSTRLMTCQSSLLPEKPRFLSQKMWAPHLVVAYLIFVTLALAL
FT                   PGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVV
FT                   GSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEETRIDGGPVILLQ
FT                   AGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLD
FT                   IGRVFTCRSMNEAIPNGKETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEI
FT                   LGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIV
FT                   VYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYT
FT                   CRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWK
FT                   ENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLE
FT                   EREVLPVGIIAGATIGAGILVVFSFAALVFFLYRRRKGSRKDVTLRKLDIKVETVNREP
FT                   LTMHSDREDDTASISTATRVMKAIYSVRIMLLSTWPRLFIVLRPAPPAFNDFRYL"
FT   assembly_gap    22431263..22431282
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22444614..22444633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22446331..22446350
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22451788..22451835
FT                   /estimated_length=48
FT                   /gap_type="unknown"
FT   assembly_gap    22469063..22469082
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22473957..22473976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22551068..22551829)
FT                   /locus_tag="mCG_1032217"
FT                   /note="gene_id=mCG1032217.1"
FT   mRNA            complement(22551068..22551829)
FT                   /locus_tag="mCG_1032217"
FT                   /product="mCG1032217"
FT                   /note="gene_id=mCG1032217.1 transcript_id=mCT149921.1
FT                   created on 28-MAR-2003"
FT   CDS             complement(22551244..22551708)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032217"
FT                   /product="mCG1032217"
FT                   /note="gene_id=mCG1032217.1 transcript_id=mCT149921.1
FT                   protein_id=mCP65744.0"
FT                   /db_xref="GOA:Q561N4"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="MGI:MGI:109240"
FT                   /db_xref="UniProtKB/TrEMBL:Q561N4"
FT                   /protein_id="EDL15363.1"
FT                   /translation="MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPP
FT                   YDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQV
FT                   IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD"
FT   assembly_gap    22554703..22554722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(22554725..22555361)
FT                   /pseudo
FT                   /locus_tag="mCG_1032216"
FT                   /note="gene_id=mCG1032216.1"
FT   mRNA            complement(22554725..22555361)
FT                   /pseudo
FT                   /locus_tag="mCG_1032216"
FT                   /note="gene_id=mCG1032216.1 transcript_id=mCT149920.1
FT                   created on 28-MAR-2003"
FT   assembly_gap    22559737..22559756
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22584831..22584850
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22596808..22599019
FT                   /estimated_length=2212
FT                   /gap_type="unknown"
FT   gene            complement(22601886..22614726)
FT                   /gene="Msr2"
FT                   /locus_tag="mCG_3078"
FT                   /note="gene_id=mCG3078.1"
FT   mRNA            complement(join(22601886..22602517,22603557..22603877,
FT                   22607758..22608036,22608434..22608742,22609992..22610273,
FT                   22610492..22610758,22613309..22613329,22614578..22614726))
FT                   /gene="Msr2"
FT                   /locus_tag="mCG_3078"
FT                   /product="macrophage scavenger receptor 2"
FT                   /note="gene_id=mCG3078.1 transcript_id=mCT1901.1 created on
FT                   16-AUG-2002"
FT   CDS             complement(join(22602498..22602517,22603557..22603877,
FT                   22607758..22608036,22608434..22608742,22609992..22610273,
FT                   22610492..22610758,22613309..22613329,22614578..22614608))
FT                   /codon_start=1
FT                   /gene="Msr2"
FT                   /locus_tag="mCG_3078"
FT                   /product="macrophage scavenger receptor 2"
FT                   /note="gene_id=mCG3078.1 transcript_id=mCT1901.1
FT                   protein_id=mCP22847.2"
FT                   /db_xref="GOA:Q9EQY5"
FT                   /db_xref="InterPro:IPR001190"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017448"
FT                   /db_xref="MGI:MGI:1933397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQY5"
FT                   /protein_id="EDL15362.1"
FT                   /translation="MPLCLLLLVFAPVGVQSDWLSISLPHRSYEGDQVVISCTGKNNGD
FT                   IKRLKYFKDGYHIETYSSASSYTIRNARRGDSGSYSCKADRKFFLFIDTTEETGSKWLN
FT                   VQELFPAPGLTASPLQPVEGSSVTLSCNTWLPSDRATTQLRYSFFKDGHTLQSGWTSSK
FT                   FTISAISKEDSGNYWCEAMTASRSVSKQSHRSYIDVERIPVSQVTMEIQPSRGWGVEGE
FT                   PLVVEGEPLVLACSVAKGTGLITFSWHRQDTKESVGKKSQRSQRVELEIPTIRESHAGG
FT                   YYCTADNNYGLIQSAIVNITVKIPVLNPLLSISVPGVLPFIGDVAELHCEDKRASPPVL
FT                   YWFYHENITLANTSAPFGGKASFKLSLTAGHSGNYSCEAENAWGTKRSEVVTLNVTEPP
FT                   PKVRLVNGPHHCEGRVEVEQEGRWGTVCDDGWDMRDVAVVCRELGCGAAQHTPIAMLYP
FT                   PAVDEALPVLIQVALCNGTEKTLAECDQVEAFDCGHDEDAGAVCEVLPSTF"
FT   assembly_gap    22604866..22604885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22634499..22634581
FT                   /estimated_length=83
FT                   /gap_type="unknown"
FT   assembly_gap    22651173..22651192
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22657866..22657885
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22669873..22670186
FT                   /estimated_length=314
FT                   /gap_type="unknown"
FT   assembly_gap    22672968..22672987
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22688580..22688599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22693692..22694139
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    22695770..22696070
FT                   /estimated_length=301
FT                   /gap_type="unknown"
FT   assembly_gap    22705947..22706352
FT                   /estimated_length=406
FT                   /gap_type="unknown"
FT   gene            22709859..22722769
FT                   /gene="Cd5l"
FT                   /locus_tag="mCG_3081"
FT                   /note="gene_id=mCG3081.1"
FT   mRNA            join(22709859..22709913,22712566..22712601,
FT                   22717474..22717794,22719236..22719574,22720144..22720464,
FT                   22721900..22722769)
FT                   /gene="Cd5l"
FT                   /locus_tag="mCG_3081"
FT                   /product="CD5 antigen-like"
FT                   /note="gene_id=mCG3081.1 transcript_id=mCT1899.1 created on
FT                   15-AUG-2002"
FT   CDS             join(22709886..22709913,22712566..22712601,
FT                   22717474..22717794,22719236..22719574,22720144..22720464,
FT                   22721900..22721913)
FT                   /codon_start=1
FT                   /gene="Cd5l"
FT                   /locus_tag="mCG_3081"
FT                   /product="CD5 antigen-like"
FT                   /note="gene_id=mCG3081.1 transcript_id=mCT1899.1
FT                   protein_id=mCP22851.1"
FT                   /protein_id="EDL15361.1"
FT                   /translation="MAPLFNLMLAILSIFVGSCFSESPTKVQLVGGAHRCEGRVEVEHN
FT                   GQWGTVCDDGWDRRDVAVVCRELNCGAVIQTPRGASYQPPASEQRVLIQGVDCNGTEDT
FT                   LAQCELNYDVFDCSHEEDAGAQCENPDSDLLFIPEDVRLVDGPGHCQGRVEVLHQSQWS
FT                   TVCKAGWNLQVSKVVCRQLGCGRALLTYGSCNKSTQGKGPIWMGKMSCSGQEANLRSCL
FT                   LSRLENNCTHGEDTWMECEDPFELKLVGGDTPCSGRLEVLHKGSWGSVCDDNWGEKEDQ
FT                   VVCKQLGCGKSLHPSPKTRKIYGPGAGRIWLDDVNCSGKEQSLEFCRHRLWGYHDCTHK
FT                   EDVEVICTDFDV"
FT   gene            22728056..22755498
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /note="gene_id=mCG142621.0"
FT   mRNA            join(22728056..22728196,22732945..22733004,
FT                   22733381..22733401,22736194..22736475,22736643..22736921,
FT                   22737258..22737386,22738353..22738377,22740948..22741030,
FT                   22741204..22741275,22741839..22741870,22742833..22743359)
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, transcript variant mCT181219"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181219.0
FT                   created on 19-MAR-2003"
FT   mRNA            join(22728071..22728196,22736194..22736475,
FT                   22736643..22736921,22737258..22737386,22738353..22738377,
FT                   22740948..22741030,22741204..22741275,22741839..22741870,
FT                   22752740..22752782,22753958..22754098,22755344..22755498)
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, transcript variant mCT181220"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181220.0
FT                   created on 19-MAR-2003"
FT   mRNA            join(<22728131..22728196,22733381..22733401,
FT                   22736194..22736475,22736643..22736921,22737258..22737386,
FT                   22738353..22738377,22740948..22741030,22741204..22741275,
FT                   22741839..22741870,22752740..22752782,22753958..22754462)
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, transcript variant mCT190949"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT190949.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(22728131..22728196,22733381..22733401,
FT                   22736194..22736475,22736643..22736921,22737258..22737386,
FT                   22738353..22738377,22740948..22741030,22741204..22741275,
FT                   22741839..22741870,22742833..22743361)
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, transcript variant mCT181218"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181218.0
FT                   created on 19-MAR-2003"
FT   CDS             join(<22728133..22728196,22733381..22733401,
FT                   22736194..22736475,22736643..22736921,22737258..22737386,
FT                   22738353..22738377,22740948..22741030,22741204..22741275,
FT                   22741839..22741870,22752740..22752760)
FT                   /codon_start=1
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, isoform CRA_d"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT190949.0
FT                   protein_id=mCP111878.0 isoform=CRA_d"
FT                   /protein_id="EDL15360.1"
FT                   /translation="HLQVTIPSLVLMLPWLLLLICALPCEPAGISDVSLKTRPPGGWVM
FT                   EGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCA
FT                   ANDGHDPIPSELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFY
FT                   HESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPT
FT                   ENGISHLSLGLTGWLLGCLSLITMALIFCYWLKRKIGRQSEDPVRSPPQTVLQGSTYPK
FT                   SPDSRQPEPLYENVNVVSGNEVYSLVYHTPQVLEPAAAQHVRTHGVSEVQGGIA"
FT   CDS             join(22728166..22728196,22736194..22736475,
FT                   22736643..22736921,22737258..22737386,22738353..22738377,
FT                   22740948..22741030,22741204..22741275,22741839..22741870,
FT                   22752740..22752760)
FT                   /codon_start=1
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181220.0
FT                   protein_id=mCP104140.0 isoform=CRA_c"
FT                   /protein_id="EDL15359.1"
FT                   /translation="MLPWLLLLICGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNI
FT                   TYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIPSELVSIHVR
FT                   VPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGAS
FT                   FNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSLGLTGWLLGC
FT                   LSLITMALIFCYWLKRKIGRQSEDPVRSPPQTVLQGSTYPKSPDSRQPEPLYENVNVVS
FT                   GNEVYSLVYHTPQVLEPAAAQHVRTHGVSEVQGGIA"
FT   CDS             join(22728166..22728196,22732945..22733004,
FT                   22733381..22733401,22736194..22736475,22736643..22736921,
FT                   22737258..22737386,22738353..22738377,22740948..22741030,
FT                   22741204..22741275,22741839..22741870,22742833..22742910)
FT                   /codon_start=1
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181219.0
FT                   protein_id=mCP104141.0 isoform=CRA_b"
FT                   /protein_id="EDL15358.1"
FT                   /translation="MLPWLLLLICGAAQFSVNNIAFSLQPDEMLSLPCEPAGISDVSLK
FT                   TRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQ
FT                   SDADQYYCAANDGHDPIPSELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRG
FT                   SPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALN
FT                   LTGLSLVPTENGISHLSLGLTGWLLGCLSLITMALIFCYWLKRKIGRQSEDPVRSPPQT
FT                   VLQGSTYPKSPDSRQPEPLYENVNVVSGNEVYSLVYHTPQVLEPAAAQHVRTHGVSESF
FT                   QVSSGLYSKPRINIAHMDYEDAM"
FT   CDS             join(22728166..22728196,22733381..22733401,
FT                   22736194..22736475,22736643..22736921,22737258..22737386,
FT                   22738353..22738377,22740948..22741030,22741204..22741275,
FT                   22741839..22741870,22742833..22742910)
FT                   /codon_start=1
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181218.0
FT                   protein_id=mCP104142.0 isoform=CRA_a"
FT                   /protein_id="EDL15357.1"
FT                   /translation="MLPWLLLLICALPCEPAGISDVSLKTRPPGGWVMEGDKLVLICSV
FT                   DRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIPSE
FT                   LVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSA
FT                   PSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSLGL
FT                   TGWLLGCLSLITMALIFCYWLKRKIGRQSEDPVRSPPQTVLQGSTYPKSPDSRQPEPLY
FT                   ENVNVVSGNEVYSLVYHTPQVLEPAAAQHVRTHGVSESFQVSSGLYSKPRINIAHMDYE
FT                   DAM"
FT   assembly_gap    22760961..22760980
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22763841..22763860
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22764906..22764925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22782973..22782992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            22789898..22850036
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /note="gene_id=mCG63865.2"
FT   mRNA            join(22789898..22790070,22794261..22794281,
FT                   22796044..22796307,22797591..22797848,22802188..>22802466)
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /product="Fc receptor-like 5, transcript variant mCT64048"
FT                   /note="gene_id=mCG63865.2 transcript_id=mCT64048.2 created
FT                   on 19-JUN-2003"
FT   mRNA            join(22789934..22790070,22794261..22794281,
FT                   22797591..22797848,22798105..22798389,22800293..22800574,
FT                   22802188..22802466,22808645..22808752,22809773..22809800,
FT                   22811129..22811211,22811391..22811453,22811805..22811874,
FT                   22849028..22850036)
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /product="Fc receptor-like 5, transcript variant mCT181560"
FT                   /note="gene_id=mCG63865.2 transcript_id=mCT181560.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(22790007..22790070,22794261..22794281,
FT                   22797591..22797848,22798105..22798389,22800293..22800574,
FT                   22802188..22802466,22808645..22808752,22809773..22809800,
FT                   22811129..22811211,22811391..22811453,22811805..22811857)
FT                   /codon_start=1
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /product="Fc receptor-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG63865.2 transcript_id=mCT181560.0
FT                   protein_id=mCP104482.0 isoform=CRA_a"
FT                   /protein_id="EDL15355.1"
FT                   /translation="MSGSFSPCVVFTQMWLTLLVVTPVNGQHDFLVLQAPPAVFEGDSV
FT                   VLRCYAKKGIEAETLTFYKDGKALTLHHQSELSIHHANLKDNGQYKCTSKKKWSFGSLY
FT                   TSNTVGVQVQELFPRPVLRARPSHPIDGSPVTLTCQTQLSAQKSDARLQFCFFRNLQLL
FT                   GSGCSRSSEFHIPAIWTEESRRYQCKAETVNSQVRKQSTAFIIPVQRASARFQTHIIPA
FT                   SKLVFEGQLLLLNCSVKGVPGPLKFSWYKKDMLNEETKILKSSNAEFKISQVNISDAGE
FT                   YHCEATNSRRSFVSRAFPITIKVPVSQPVLTLSTGKTQALEGDLMTLHCQSQRGSPCIL
FT                   YEFFYENVSLGNSSILSGGGAYFNFSMSTERSGNYYCTADNGLGAQCSEAIRISIFDMT
FT                   KNRSVPMAAGITVGLLIMAVGVFLFYCWFSRKAGGKPTSDDSRNPSDSEPQEPTYYNVP
FT                   ACIELQPVYSNEPEENVIYTEVRRTQPRQKHADQESESPRSRCQMAEKK"
FT   CDS             join(22790007..22790070,22794261..22794281,
FT                   22796044..22796307,22797591..22797848,22802188..>22802466)
FT                   /codon_start=1
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /product="Fc receptor-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG63865.2 transcript_id=mCT64048.2
FT                   protein_id=mCP42625.2 isoform=CRA_b"
FT                   /protein_id="EDL15356.1"
FT                   /translation="MSGSFSPCVVFTQMWLTLLVVTPVNGQHEAAQQSVVSLQPPWTTF
FT                   FRGEVVTLTCYRFGFSVPQKTKWYQKRKTVKQTPGALVIKAHTLKVHESGEYWCQADSL
FT                   LPSMHVNVEFSEDFLVLQAPPAVFEGDSVVLRCYAKKGIEAETLTFYKDGKALTLHHQS
FT                   ELSIHHANLKDNGQYKCTSKKKWSFGSLYTSNTVGVQVQVPVSQPVLTLSTGKTQALEG
FT                   DLMTLHCQSQRGSPCILYEFFYENVSLGNSSILSGGGAYFNFSMSTERSGNYYCTADNG
FT                   LGAQCSEAIRISIF"
FT   assembly_gap    22791796..22791815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22795963..22795982
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22866689..22866731
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   gene            22875059..22886114
FT                   /gene="Etv3"
FT                   /locus_tag="mCG_3087"
FT                   /note="gene_id=mCG3087.2"
FT   mRNA            join(22875059..22875076,22876694..22876752,
FT                   22877306..22877543,22878659..22878774,22884929..22886114)
FT                   /gene="Etv3"
FT                   /locus_tag="mCG_3087"
FT                   /product="ets variant gene 3"
FT                   /note="gene_id=mCG3087.2 transcript_id=mCT1892.2 created on
FT                   15-AUG-2002"
FT   assembly_gap    22876591..22876628
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   CDS             join(22876707..22876752,22877306..22877543,
FT                   22878659..22878774,22884929..22886070)
FT                   /codon_start=1
FT                   /gene="Etv3"
FT                   /locus_tag="mCG_3087"
FT                   /product="ets variant gene 3"
FT                   /note="gene_id=mCG3087.2 transcript_id=mCT1892.2
FT                   protein_id=mCP22856.2"
FT                   /db_xref="GOA:Q8R4Z4"
FT                   /db_xref="InterPro:IPR000418"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR032929"
FT                   /db_xref="MGI:MGI:1350926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R4Z4"
FT                   /protein_id="EDL15354.1"
FT                   /translation="MKAGCSIVEKPEGGGGYQFPDWAYKAESSPGSRQIQLWHFILELL
FT                   QKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILH
FT                   KTKGKRFTYKFNFNKLVMPNYPFINIRSSGVVPQSAPPVPTASSRFHFPPLDSHSPTGD
FT                   VQPGRFSASSLSASGPESGVTTDRKVEPSDLEDGSASDWHRGMDFMPSRNALGGGAVGH
FT                   QKRKPDILLPLFTRPAMYPDPHSPFAISPVPGRGGVLNVPISPALSLTPTMFSYSPSPG
FT                   LSPFTSSSCFSFNPEEMKHYLHSQACSVFNYHLSPRTFPRYPGLMVPPLQCQMHPEEPS
FT                   QFSIKLQPPPAGRKNRERVESREEAVRGSVPASAPVPSRIKVEPATEKDPDSLRQSTQG
FT                   KEEQTQEVDSMRSRTIEEGKGTGFAHPSPTWPSVSISTPSDEPLEGTEDSEDRSVREPG
FT                   VPEKKEDALMPPKLRLKRRWNDDPEARELNKTGKFLWNGAGPQGLATTATAAADA"
FT   assembly_gap    22886592..22886649
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   gene            22903961..22904764
FT                   /pseudo
FT                   /locus_tag="mCG_3095"
FT                   /note="gene_id=mCG3095.2"
FT   mRNA            22903961..22904764
FT                   /pseudo
FT                   /locus_tag="mCG_3095"
FT                   /note="gene_id=mCG3095.2 transcript_id=mCT1886.2 created on
FT                   28-MAR-2003"
FT   assembly_gap    22929433..22929599
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    22941797..22942189
FT                   /estimated_length=393
FT                   /gap_type="unknown"
FT   assembly_gap    22946148..22946167
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    22947360..22948265
FT                   /estimated_length=906
FT                   /gap_type="unknown"
FT   assembly_gap    22969688..22970351
FT                   /estimated_length=664
FT                   /gap_type="unknown"
FT   assembly_gap    22983256..22983276
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   gene            complement(23032165..23032632)
FT                   /pseudo
FT                   /locus_tag="mCG_3090"
FT                   /note="gene_id=mCG3090.0"
FT   mRNA            complement(23032165..23032632)
FT                   /pseudo
FT                   /locus_tag="mCG_3090"
FT                   /note="gene_id=mCG3090.0 transcript_id=mCT1895.0 created on
FT                   28-MAR-2003"
FT   assembly_gap    23034576..23034700
FT                   /estimated_length=125
FT                   /gap_type="unknown"
FT   gene            23036202..23090670
FT                   /gene="Arhgef11"
FT                   /locus_tag="mCG_3082"
FT                   /note="gene_id=mCG3082.1"
FT   mRNA            join(23036202..23036293,23037196..23037294,
FT                   23038744..23038793,23039664..23039721,23040563..23040741,
FT                   23041528..23041599,23048116..23048235,23054832..23054906,
FT                   23055129..23055230,23062237..23062335,23064171..23064213,
FT                   23065683..23065779,23065893..23066015,23069653..23069797,
FT                   23070044..23070143,23074849..23074975,23078000..23078179,
FT                   23078258..23078305,23078485..23078672,23078893..23079039,
FT                   23079658..23079737,23079886..23080011,23080479..23080596,
FT                   23081032..23081210,23081721..23081796,23082001..23082168,
FT                   23082925..23083015,23083668..23083817,23084298..23084359,
FT                   23085176..23085388,23085664..23086020,23086939..23087067,
FT                   23087860..23088086,23088321..23088510,23089559..23090670)
FT                   /gene="Arhgef11"
FT                   /locus_tag="mCG_3082"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 11"
FT                   /note="gene_id=mCG3082.1 transcript_id=mCT1907.1 created on
FT                   01-NOV-2002"
FT   assembly_gap    23037786..23037850
FT                   /estimated_length=65
FT                   /gap_type="unknown"
FT   CDS             join(23038755..23038793,23039664..23039721,
FT                   23040563..23040741,23041528..23041599,23048116..23048235,
FT                   23054832..23054906,23055129..23055230,23062237..23062335,
FT                   23064171..23064213,23065683..23065779,23065893..23066015,
FT                   23069653..23069797,23070044..23070143,23074849..23074975,
FT                   23078000..23078179,23078258..23078305,23078485..23078672,
FT                   23078893..23079039,23079658..23079737,23079886..23080011,
FT                   23080479..23080596,23081032..23081210,23081721..23081796,
FT                   23082001..23082168,23082925..23083015,23083668..23083817,
FT                   23084298..23084359,23085176..23085388,23085664..23086020,
FT                   23086939..23087067,23087860..23088086,23088321..23088510,
FT                   23089559..23089617)
FT                   /codon_start=1
FT                   /gene="Arhgef11"
FT                   /locus_tag="mCG_3082"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 11"
FT                   /note="gene_id=mCG3082.1 transcript_id=mCT1907.1
FT                   protein_id=mCP22816.2"
FT                   /protein_id="EDL15353.1"
FT                   /translation="MRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSS
FT                   PSSIGVSGLQQNPSLSGGPRVNPTIPPPPPPPPLPPPQHITGPKPLQDPEVQKHATQIL
FT                   RNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVGIDQSPK
FT                   PLIIGPEEDYDPGYFNNESDIIFQDLEKLKSHPAYLVVFLRYIFSQADPGPLLFYLCSE
FT                   VYQQTNPKDSRNLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNSEDPRSALYEAQE
FT                   AVMPEIQEQINDYRSKRTLGLGSLYGENDLLDLDGDPLRERQMAEKQLAALGDIFAPMD
FT                   FAVNTYMSHTGIRLRESRPSSTAEKTQSAPDKDKWLPFFPKTKKQSSNSKKEKDALEDK
FT                   KRNPILRYIGKPKSSSQSIKPGNVRNIIQHFENSHQYDVPEPGTQRLSTGSFPEDLLES
FT                   DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSL
FT                   STRSLENPTPPFTPKMGRRSIESPNLGFCTDVILPHLLEDDLGQLSDLEPEPEVQNWQH
FT                   TVGKDVVANLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELAR
FT                   LFPNLPELIEIHNSWCEAMKKLREEGPIIRDISDLMLARFDGPAREELQQVAAQFCSYQ
FT                   SVALELIRTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLENIIKH
FT                   TAGGTSEHEKLCRARDQCREILKFVNEAVKQTENRHRLEGYQKRLDATALERASNPLAA
FT                   EFKSLDLTTRKMIHEGPLTWRISKDKTLDLQVLLLEDLVVLLQRQEEKLLLKCHSKTAV
FT                   GSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVALTSSDKNIPVF
FT                   VPSNRWMELLEEAVQNATKHPGDAPVLNHPSPPGSQEPAYQGSTSSRVEVNDSEVYPTE
FT                   REPKKPSEGPGPEQRGQDKQLLAQEGPEQEEDAEELRALPCPPPSLDGENRGIRTRDPV
FT                   LLALTGPLLMEGLADAALEDVENLRHLILWSLLPGHTVKTQAAGEPEDDLTPTPSVVSI
FT                   TSHPWDPGSPGQAPAISDNTQFPRPEGSQPEGEDVALCSLAHLPPRTRNSGIWDSPELD
FT                   RNPAEEASSSEPAGSYKVVRKVSLLPGGGVGAAKVAGSNVTPALPESGQSESELSEVEG
FT                   GAQATGNCFYVSMPAEPLDSSTEPPGTPPSLSQCHSLPAWPTEPPQHRGVTGGQRSSLV
FT                   LRDMGVIFHTIEQLTVKLHRLKDMELAHRELLNSLGGESSGGTTPVGSFHTEAARWTDY
FT                   SLSPPAKEALTSDPQNNQEQGSYPEEGSDTPLEDSATDTASSPGP"
FT   assembly_gap    23052510..23052529
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23074688..23074707
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23076539..23076558
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(23089438..23101585)
FT                   /locus_tag="mCG_3093"
FT                   /note="gene_id=mCG3093.2"
FT   mRNA            complement(join(23089438..23091706,23091866..23091987,
FT                   23092349..23092463,23093492..23093580,23093953..23094046,
FT                   23094233..23094382,23095143..23095232,23095305..23095388,
FT                   23095462..23095621,23095814..23095882,23097953..23098030,
FT                   23098179..23098254,23098395..23098523,23098608..23098757,
FT                   23101004..23101526))
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, transcript variant mCT181526"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT181526.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23090410..23091706,23091866..23091987,
FT                   23092349..23092460,23093492..23094046,23094233..23094382,
FT                   23095143..23095232,23095305..23095388,23095462..23095621,
FT                   23095814..23095882,23097953..23098030,23098179..23098254,
FT                   23098395..23098523,23098608..23098757,23101004..>23101326))
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, transcript variant mCT190953"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT190953.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23090411..23091706,23091866..23091987,
FT                   23092349..23092460,23093492..23093580,23093953..23094046,
FT                   23094233..23094382,23095143..23095232,23095305..23095388,
FT                   23095453..23095621,23095814..23095882,23097953..23098030,
FT                   23098179..23098254,23098395..23098523,23098608..23098757,
FT                   23101004..23101585))
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, transcript variant mCT1885"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT1885.1 created on
FT                   27-MAR-2003"
FT   CDS             complement(join(23091596..23091706,23091866..23091987,
FT                   23092349..23092463,23093492..23093580,23093953..23094046,
FT                   23094233..23094382,23095143..23095232,23095305..23095388,
FT                   23095462..23095621,23095814..23095882,23097953..23098030,
FT                   23098179..23098254,23098395..23098523,23098608..23098757,
FT                   23101004..23101163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, isoform CRA_a"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT181526.0
FT                   protein_id=mCP104448.0 isoform=CRA_a"
FT                   /protein_id="EDL15350.1"
FT                   /translation="MSSEPSTTGTSPRTPRPGAQKSSGAVTKKGDRAAKDKTASTLPPV
FT                   GEDEPKNPEEYQCTGVLETDFAELCTRSGYVDFPKVVTRPRVQQSSVPSASTSEKPVLD
FT                   DQRPSASCSQSSLESKYVFFRPTIQVELEQEDSKAVKEIYIRGWKVEDRILGIFSKCLP
FT                   SLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKVSLEGNPIPEQSFSKLMGLDSTI
FT                   VHLSLRNNNINDHGAQLLGQALSTLQNSNRTLVSLNLAFNHIGDVGAGYIADGLRLNRS
FT                   LLWLSLAHNHIQDKGALKLAEVLRPFELTHREVVERRRLLLVKGTQERSRSPSSSRYGD
FT                   SKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEKTGEVVKKEEKLGSGQSPTQ
FT                   GTPKKEDAAKAGKGKVTIPEQKMSKGKATKMGAKEKRSILLESEQLVVEATEMVNPLLE
FT                   PVEHRDGKVFLPGNKVLLHLNLLRNQITEVGLEGFLTAVQYQVQVSKPKTSPKAPLGLL
FT                   WLSLAKNCFDPQCPTHVMIQELMLPRDPVKAKAREEEAAAT"
FT   CDS             complement(join(23091596..23091706,23091866..23091987,
FT                   23092349..23092460,23093492..23093580,23093953..23094046,
FT                   23094233..23094382,23095143..23095232,23095305..23095388,
FT                   23095453..23095621,23095814..23095882,23097953..23098030,
FT                   23098179..23098254,23098395..23098523,23098608..23098757,
FT                   23101004..23101163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, isoform CRA_b"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT1885.1
FT                   protein_id=mCP22864.1 isoform=CRA_b"
FT                   /protein_id="EDL15351.1"
FT                   /translation="MSSEPSTTGTSPRTPRPGAQKSSGAVTKKGDRAAKDKTASTLPPV
FT                   GEDEPKNPEEYQCTGVLETDFAELCTRSGYVDFPKVVTRPRVQQSSVPSASTSEKPVLD
FT                   DQRPSASCSQSSLESKYVFFRPTIQVELEQEDSKAVKEIYIRGWKVEDRILGIFSKCLP
FT                   SLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKVSLEGNPIPEQSFSKLMGLDSTI
FT                   VHLSLRNNNINDHGAQLLGQALSTLQNSNRTLVSLNLAFNHIGDVGAGYIADVRAGLRL
FT                   NRSLLWLSLAHNHIQDKGALKLAEVLRPFELTHREVVERRRLLLVKGTQERSRSPSSSR
FT                   YGDSKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEKTGEVVKKEEKLGSGQS
FT                   PTQGTPKKEDAAKAGKGKVTIPEQKMSKGKATKMGAKEKRSILLESELVVEATEMVNPL
FT                   LEPVEHRDGKVFLPGNKVLLHLNLLRNQITEVGLEGFLTAVQYQVQVSKPKTSPKAPLG
FT                   LLWLSLAKNCFDPQCPTHVMIQELMLPRDPVKAKAREEEAAAT"
FT   CDS             complement(join(23093816..23094046,23094233..23094382,
FT                   23095143..23095232,23095305..23095388,23095462..23095621,
FT                   23095814..23095882,23097953..23098030,23098179..23098254,
FT                   23098395..23098523,23098608..23098757,23101004..>23101220))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, isoform CRA_c"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT190953.0
FT                   protein_id=mCP111918.0 isoform=CRA_c"
FT                   /protein_id="EDL15352.1"
FT                   /translation="GPQSPVSSCLSLEGSKSTPMSSEPSTTGTSPRTPRPGAQKSSGAV
FT                   TKKGDRAAKDKTASTLPPVGEDEPKNPEEYQCTGVLETDFAELCTRSGYVDFPKVVTRP
FT                   RVQQSSVPSASTSEKPVLDDQRPSASCSQSSLESKYVFFRPTIQVELEQEDSKAVKEIY
FT                   IRGWKVEDRILGIFSKCLPSLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKVSLE
FT                   GNPIPEQSFSKLMGLDSTIVHLSLRNNNINDHGAQLLGQALSTLQNSNRTLVSLNLAFN
FT                   HIGDVGAGYIADGLRLNRSLLWLSLAHNHIQDKGALKLAEVLRPFELTHREVVERRRLL
FT                   LVKGTQERSRSPSSSRYGDSKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEK
FT                   TGEVVKKEEKLGSGQSPTQGTPKKEDAAKAGKGSKCENPLWDSSPPTWRKSFGQGVGAW
FT                   LCLPGAVLSRLSLGLVYNE"
FT   assembly_gap    23096195..23096503
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   gene            complement(23102599..23123092)
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /note="gene_id=mCG122089.1"
FT   mRNA            complement(join(23102599..23102996,23105240..23105485,
FT                   23105570..23105644,23105780..23105903,23105984..23106072,
FT                   23106237..23106449,23106602..23106730,23106838..23106966,
FT                   23107880..23108008,23108178..23108324,23108407..23108509,
FT                   23108612..23108775,23109992..23110112,23110193..23110367,
FT                   23110639..23110851,23110936..23111072,23111231..23111351,
FT                   23111992..23112235,23112390..23112482,23113226..23113326,
FT                   23113609..23113713,23114357..23114518,23116345..23116414,
FT                   23123014..>23123080))
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /product="RIKEN cDNA 3110045G13, transcript variant
FT                   mCT190943"
FT                   /note="gene_id=mCG122089.1 transcript_id=mCT190943.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23102845..23102996,23105240..23105485,
FT                   23105570..23105644,23105780..23105903,23105984..23106072,
FT                   23106237..23106449,23106602..23106730,23106838..23106966,
FT                   23107880..23108008,23108178..23108324,23108407..23108509,
FT                   23108612..23108775,23109992..23110112,23110193..23110367,
FT                   23110639..23110851,23110936..23111072,23111231..23111351,
FT                   23111992..23112235,23112390..23112482,23113226..23113326,
FT                   23113609..23113713,23114357..>23114517))
FT                   /codon_start=1
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /product="RIKEN cDNA 3110045G13, isoform CRA_b"
FT                   /note="gene_id=mCG122089.1 transcript_id=mCT190943.0
FT                   protein_id=mCP111875.0 isoform=CRA_b"
FT                   /protein_id="EDL15349.1"
FT                   /translation="CVLPAAGCSAVLLPCALSQASAMPLCPLLLLALGLRLTGTLNSND
FT                   PNVCTFWESFTTTTKESHLRPFSLLPAESCHRPWEDPHTCAQPTVVYRTVYRQVVKMDS
FT                   RPRLQCCRGYYESRGACVPLCAQECVHGRCVAPNQCQCAPGWRGGDCSSECAPGMWGPQ
FT                   CDKFCHCGNNSSCDPKSGACFCPSGLQPPNCLQPCPAGHYGPACQFDCQCYGASCDPQD
FT                   GACFCPPGRAGPSCNVPCSQGTDGFFCPRTYPCQNGGVPQGSQGSCSCPPGWMGVICSL
FT                   PCPEGFHGPNCTQECRCHNGGLCDRFTGQCHCAPGYIGDRCQEECPVGRFGQDCAETCD
FT                   CAPGARCFPANGACLCEHGFTGDRCTERLCPDGRYGLSCQEPCTCDPEHSLSCHPMHGE
FT                   CSCQPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGLCLADSGLCRCAPGYTGPHCANLC
FT                   PPDTYGINCSSRCSCENAIACSPIDGTCICKEGWQRGNCSVPCPLGTWGFNCNASCQCA
FT                   HDGVCSPQTGACTCTPGWHGAHCQLPCPKGQFGEGCASVCDCDHSDGCDPVHGQCRCQA
FT                   GWMGTRCHLPCPEGFWGANCSNTCTCKNGGTCVSENGNCVCAPGFRGPSCQRPCPPGRY
FT                   GKRCVQCKCNNNHSSCHPSDGTCSCLAGWTGPDCSEACPPGHWGLKCSQLCQCHHGGTC
FT                   HPQDGSCICTPGWTGPNCLEGCPPRMFGVNCSQLCQCDLGEMCHPETGACVCPPGHSGA
FT                   DCKMGSQESFTIMPTSPVTHNSLGAVIGIAVLGTLVVALIALFIGYRQWQKGKEHEHLA
FT                   VAYSTGRLDGSDYVMPDVSPSYSHYYSNPSYHTLSQCSPNPPPPNKVPGSQLFVSSQAP
FT                   ERPSRAHGRENHTTLPADWKHRREPHDRGASHLDRSYSCSYSHRNGPGPFCHKGPISEE
FT                   GLGASVMSLSSENPYATIRDLPSLPGEPRESGYVEMKGPPSVSPPRQSLHLRDRQQRQL
FT                   QPQRDSGTYEQPSPLSHNEESLGSTPPLPPGLPPGHYDSPKNSHIPGHYDLPPVRHPPS
FT                   PPSRRQDR"
FT   assembly_gap    23103077..23103096
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   mRNA            complement(join(23103230..23103426,23105240..23105485,
FT                   23105570..23105644,23105780..23105903,23105984..23106072,
FT                   23106237..23106563,23106602..23106730,23107880..23108008,
FT                   23108178..23108324,23108407..23108509,23108612..23108775,
FT                   23109992..23110112,23110193..23110367,23110639..23110851,
FT                   23110936..23111072,23111231..23111351,23111992..23112235,
FT                   23112390..23112482,23113226..23113326,23113609..23113713,
FT                   23114357..23114518,23116345..23116414,23117360..23117493,
FT                   23123014..23123092))
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /product="RIKEN cDNA 3110045G13, transcript variant
FT                   mCT123304"
FT                   /note="gene_id=mCG122089.1 transcript_id=mCT123304.1
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(23103275..23103426,23105240..23105485,
FT                   23105570..23105644,23105780..23105903,23105984..23106072,
FT                   23106237..23106563,23106602..23106730,23107880..23108008,
FT                   23108178..23108324,23108407..23108509,23108612..23108775,
FT                   23109992..23110112,23110193..23110367,23110639..23110851,
FT                   23110936..23111072,23111231..23111351,23111992..23112235,
FT                   23112390..23112482,23113226..23113326,23113609..23113713,
FT                   23114357..23114451))
FT                   /codon_start=1
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /product="RIKEN cDNA 3110045G13, isoform CRA_a"
FT                   /note="gene_id=mCG122089.1 transcript_id=mCT123304.1
FT                   protein_id=mCP65437.1 isoform=CRA_a"
FT                   /protein_id="EDL15348.1"
FT                   /translation="MPLCPLLLLALGLRLTGTLNSNDPNVCTFWESFTTTTKESHLRPF
FT                   SLLPAESCHRPWEDPHTCAQPTVVYRTVYRQVVKMDSRPRLQCCRGYYESRGACVPLCA
FT                   QECVHGRCVAPNQCQCAPGWRGGDCSSECAPGMWGPQCDKFCHCGNNSSCDPKSGACFC
FT                   PSGLQPPNCLQPCPAGHYGPACQFDCQCYGASCDPQDGACFCPPGRAGPSCNVPCSQGT
FT                   DGFFCPRTYPCQNGGVPQGSQGSCSCPPGWMGVICSLPCPEGFHGPNCTQECRCHNGGL
FT                   CDRFTGQCHCAPGYIGDRCQEECPVGRFGQDCAETCDCAPGARCFPANGACLCEHGFTG
FT                   DRCTERLCPDGRYGLSCQEPCTCDPEHSLSCHPMHGECSCQPGWAGLHCNESCPQDTHG
FT                   PGCQEHCLCLHGGLCLADSGLCRCAPGYTGPHCANLCPPDTYGINCSSRCSCENAIACS
FT                   PIDGTCICKEGWQRGNCSVPCPLGTWGFNCNASCQCAHDGVCSPQTGACTCTPGWHGAH
FT                   CQLPCPKGQFGEGCASVCDCDHSDGCDPVHGQCRCQAGWMGTRCHLPCPEGFWGANCSN
FT                   TCTCKNGGTCVSENGNCVCAPGFRGPSCQRPCPPGRYGKRCVQCKCNNNHSSCHPSDGT
FT                   CSCLAGWTGPDCSEGCPPRMFGVNCSQLCQCDLGEMCHPETGACVCPPGHSGADCKMGS
FT                   GTQGALITFSVFLTMHSSSLAERTKVPVSVPTPHLTGSQESFTIMPTSPVTHNSLGAVI
FT                   GIAVLGTLVVALIALFIGYRQWQKGKEHEHLAVAYSTGRLDGSDYVMPDVSPSYSHYYS
FT                   NPSYHTLSQCSPNPPPPNKVPGSQLFVSSQAPERPSRAHGRENHTTLPADWKHRREPHD
FT                   RGASHLDRSYSCSYSHRNGPGPFCHKGPISEEGLGASVMSLSSENPYATIRDLPSLPGE
FT                   PRESGYVEMKGPPSVSPPRQSLHLRDRQQRQLQPQRDSGTYEQPSPLSHNEESLGSTPP
FT                   LPPGLPPGHYDSPKNSHIPGHYDLPPVRHPPSPPSRRQDR"
FT   assembly_gap    23104256..23104275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23112818..23113027
FT                   /estimated_length=210
FT                   /gap_type="unknown"
FT   assembly_gap    23117200..23117219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   gene            complement(23132381..>23149282)
FT                   /locus_tag="mCG_3085"
FT                   /note="gene_id=mCG3085.1"
FT   mRNA            complement(join(23132381..23132735,23133772..23133930,
FT                   23134207..23134447,23135498..23135739,23135877..23136007,
FT                   23136289..23136435,23136863..23136965,23137212..23137267,
FT                   23137808..23138137,23140106..23140238,23142455..23142597,
FT                   23142760..23142959,23145512..23145583,23145808..23145882,
FT                   23149071..>23149282))
FT                   /locus_tag="mCG_3085"
FT                   /product="mCG3085"
FT                   /note="gene_id=mCG3085.1 transcript_id=mCT1896.2 created on
FT                   31-OCT-2002"
FT   CDS             complement(join(23132550..23132735,23133772..23133930,
FT                   23134207..23134447,23135498..23135739,23135877..23136007,
FT                   23136289..23136435,23136863..23136965,23137212..23137267,
FT                   23137808..23138137,23140106..23140238,23142455..23142597,
FT                   23142760..23142959,23145512..23145583,23145808..23145882,
FT                   23149071..23149282))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3085"
FT                   /product="mCG3085"
FT                   /note="gene_id=mCG3085.1 transcript_id=mCT1896.2
FT                   protein_id=mCP22857.2"
FT                   /protein_id="EDL15347.1"
FT                   /translation="MLRGQRLGQLGWHRPAAGLGSLMTSLMLACASAASCREVCCPVGP
FT                   SGLRCTRAGSLDTLRGLRGAGNLTELYVENQQHLQRLEFEDLQGLGELRSLTIVKSGLR
FT                   FVAPDAFRFTPRLSHLPVAPSFPDSQHPLPNRTLSGNPLHCSCALFWLQRWEQEGLCGV
FT                   HTQTLHDSGPGDQFLPLGHNTSCGVPTVKIQMPNDSVEVGDDVFLQCQVEGLALQQADW
FT                   ILTELEGAATVKKFGDLPSLGLILVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPA
FT                   SVHLGLAVEQHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTQFLESALTNETMRHG
FT                   CLRLNQPTHVNNGNYTLLAANPYGQAAASVMAAFMDNPFEFNPEDPIPDGNSTSRDPVE
FT                   KKDETPFGVSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHF
FT                   MTLGGSSLSPTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLA
FT                   ECYNLLNDQDKMLVAVKALKEASENARQDFQREAELLTMLQHQHIVRFFGVCTEGGPLL
FT                   MVFEYMRHGDLNRFLRYKNPPLLPSLLSSLQEYPCLSARSHGPDAKLLAGGEDVAPGPL
FT                   GLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYY
FT                   RVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECI
FT                   TQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDVHARLQALAQAPPSYLDVLG"
FT   gene            23151200..23170260
FT                   /gene="Insrr"
FT                   /locus_tag="mCG_3075"
FT                   /note="gene_id=mCG3075.1"
FT   mRNA            join(23151200..23151646,23154489..23155040,
FT                   23156530..23156833,23156920..23157062,23157224..23157368,
FT                   23158155..23158369,23158550..23158676,23162732..23162970,
FT                   23163438..23163605,23163694..23163889,23164054..23164095,
FT                   23164174..23164394,23164592..23164728,23164809..23164971,
FT                   23165100..23165205,23165743..23165795,23167112..23167341,
FT                   23167722..23167832,23167940..23168099,23168345..23168474,
FT                   23168607..23168741,23169294..23170260)
FT                   /gene="Insrr"
FT                   /locus_tag="mCG_3075"
FT                   /product="insulin receptor-related receptor"
FT                   /note="gene_id=mCG3075.1 transcript_id=mCT1916.1 created on
FT                   15-AUG-2002"
FT   CDS             join(23151562..23151646,23154489..23155040,
FT                   23156530..23156833,23156920..23157062,23157224..23157368,
FT                   23158155..23158369,23158550..23158676,23162732..23162970,
FT                   23163438..23163605,23163694..23163889,23164054..23164095,
FT                   23164174..23164394,23164592..23164728,23164809..23164971,
FT                   23165100..23165205,23165743..23165795,23167112..23167341,
FT                   23167722..23167832,23167940..23168099,23168345..23168474,
FT                   23168607..23168741,23169294..23169534)
FT                   /codon_start=1
FT                   /gene="Insrr"
FT                   /locus_tag="mCG_3075"
FT                   /product="insulin receptor-related receptor"
FT                   /note="gene_id=mCG3075.1 transcript_id=mCT1916.1
FT                   protein_id=mCP22873.1"
FT                   /db_xref="GOA:Q9WTL4"
FT                   /db_xref="InterPro:IPR000494"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002011"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006211"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016246"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR028792"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="MGI:MGI:1346037"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTL4"
FT                   /protein_id="EDL15346.1"
FT                   /translation="MAVPALWPWGVHLLMSLLSLGSGLDTLEVCPSLDIRSEVTELRRL
FT                   ENCSVVEGHLQILLMFAATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLTVI
FT                   RGTRLFLGYALIIFEMPHLRDVGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPG
FT                   TNHIVGNKLGEECADVCPGVLGAAGEPCSRTTFSGRTDYRCWTSSHCQKVCPCPRGMAC
FT                   TAGGDCCHSECLGGCSQPEDPRACVACRHLYFQGVCLRACPPGTYQYESWRCVTAELCA
FT                   HLREVPGLATTFGIYEGSCLAQCPPGFTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQA
FT                   TQDLVGCTHVEGNLILNLRQGYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNL
FT                   KLIRGDSMVDGNYTLYVLDNQNLQQLGSWVTAGLTIPVGKIYFAFNPRLCLEHIYQLEE
FT                   VTGTRGRQSKAEINPRTNGDRAACQTRTLRFVFNLTEEDRILLRWERYEPLEARDLLSF
FT                   IVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVR
FT                   AITLTTAEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNI
FT                   TYYLVLWQRLAEDGDLYINDYCHRGLRLPTSSHDTRFDREDPALEAEPEQGCCPCQHSP
FT                   PGQALPALEAQEVTFQKKFENFLHHAITIPKAPWKVTSINKNPQRDSERHRREAGLLRL
FT                   GKNNSDFEIQEDKVPRERAILSGLRHFTEYRIDIHACNHAAHTVGCSAATFVFARTMPH
FT                   READGIPGKVAWKAAGKSSVTLHWLEPPDPNGLILKYEIKYRRLGEEATVLCVSRLRYA
FT                   KVGGVHLALLPPGNYSAKVRATSLAGNGSWTDGVTFYITDLEEEDTGGMRIFLTVTPVG
FT                   FMLLVTLAALGFFYSRKRNSTLYTSVNPEYFSASHMYVPDEWEVPREQIAIIRELGQGS
FT                   FGMVYEGLARGLEAGEESTPVALKTVNELASARERVEFLKEASVMKAFKCHHVVRLLGV
FT                   VSQGQPTLVIMELMTRGDLKSHLRSLRPEAENNPGLPQPALSDMIQMAGEIADGMAYLA
FT                   AKKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKD
FT                   GIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMDGGVLEELENCPIQLQELM
FT                   RLCWQHSPRLRPTFVHILDRIQDELRPSFRLCSFYYSPECQRGQASLLPTEAEPDSPPT
FT                   LNGASDYSAPNGGPGH"
FT   assembly_gap    23174562..23174747
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    23178571..23178718
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   gene            23200972..23206994
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /note="gene_id=mCG3076.1"
FT   mRNA            join(23200972..23201330,23201860..23202014,
FT                   23202581..23202762,23203286..23203375,23203534..23203702,
FT                   23205946..23206098,23206290..23206994)
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /product="SH2 domain protein 2A, transcript variant
FT                   mCT1903"
FT                   /note="gene_id=mCG3076.1 transcript_id=mCT1903.1 created on
FT                   26-MAR-2003"
FT   mRNA            join(23201254..23201330,23201860..23202014,
FT                   23202581..23202762,23203286..23203375,23203534..23203702,
FT                   23205946..23206074,23206290..>23206323)
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /product="SH2 domain protein 2A, transcript variant
FT                   mCT181531"
FT                   /note="gene_id=mCG3076.1 transcript_id=mCT181531.0 created
FT                   on 26-MAR-2003"
FT   CDS             join(23201297..23201330,23201860..23202014,
FT                   23202581..23202762,23203286..23203375,23203534..23203702,
FT                   23205946..23206098,23206290..23206631)
FT                   /codon_start=1
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /product="SH2 domain protein 2A, isoform CRA_a"
FT                   /note="gene_id=mCG3076.1 transcript_id=mCT1903.1
FT                   protein_id=mCP22845.1 isoform=CRA_a"
FT                   /protein_id="EDL15344.1"
FT                   /translation="MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSM
FT                   QVMKEQGVQLSPRTNHTVVSASAPGTAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQ
FT                   AHWLLLKTAPLWFHGFITRREAERLLQPQPLGCYLVRFSESAVTFVLSYRSQTCCRHFL
FT                   LAQLGDGRHVVLGEDSAHAQLQDLLEHYTECPLSPYGEILTQPLARQTAEPAGLSLRAD
FT                   SDSGSKRQDPDTQLSLLLQQGQAQASGHTEKVWASQQKATSQASRPRPPIPAKPQLPPE
FT                   VYTSPASRLHQAPPINPIYQEPDEPIAFYAMGRGSPGDAPSNIYAEVEGPSGTAPIGHP
FT                   ILRKCWSRPISRGQVREVQGKISSRSRAERGSPS"
FT   CDS             join(23201297..23201330,23201860..23202014,
FT                   23202581..23202762,23203286..23203375,23203534..23203702,
FT                   23205946..23206074,23206290..>23206323)
FT                   /codon_start=1
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /product="SH2 domain protein 2A, isoform CRA_b"
FT                   /note="gene_id=mCG3076.1 transcript_id=mCT181531.0
FT                   protein_id=mCP104453.0 isoform=CRA_b"
FT                   /protein_id="EDL15345.1"
FT                   /translation="MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSM
FT                   QVMKEQGVQLSPRTNHTVVSASAPGTAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQ
FT                   AHWLLLKTAPLWFHGFITRREAERLLQPQPLGCYLVRFSESAVTFVLSYRSQTCCRHFL
FT                   LAQLGDGRHVVLGEDSAHAQLQDLLEHYTECPLSPYGEILTQPLARQTAEPAGLSLRAD
FT                   SDSGSKRQDPDTQLSLLLQQGQAQASGHTEKTSQASRPRPPI"
FT   gene            complement(23213142..23239969)
FT                   /gene="Prcc"
FT                   /locus_tag="mCG_3086"
FT                   /note="gene_id=mCG3086.1"
FT   mRNA            complement(join(23213142..23213573,23214373..23214438,
FT                   23216358..23216501,23221959..23222054,23224231..23224797,
FT                   23226868..23226915,23239264..23239969))
FT                   /gene="Prcc"
FT                   /locus_tag="mCG_3086"
FT                   /product="papillary renal cell carcinoma
FT                   (translocation-associated)"
FT                   /note="gene_id=mCG3086.1 transcript_id=mCT1891.1 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(23213487..23213573,23214373..23214438,
FT                   23216358..23216501,23221959..23222054,23224231..23224797,
FT                   23226868..23226915,23239264..23239731))
FT                   /codon_start=1
FT                   /gene="Prcc"
FT                   /locus_tag="mCG_3086"
FT                   /product="papillary renal cell carcinoma
FT                   (translocation-associated)"
FT                   /note="gene_id=mCG3086.1 transcript_id=mCT1891.1
FT                   protein_id=mCP22838.2"
FT                   /db_xref="GOA:Q9EQC8"
FT                   /db_xref="InterPro:IPR018800"
FT                   /db_xref="MGI:MGI:2137738"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQC8"
FT                   /protein_id="EDL15343.1"
FT                   /translation="MSLVAYASSDDSEPDEPEPEPEPEEEDVAAPMPGPTLGGLFASLP
FT                   APKGPALLPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPAGVSPAEAA
FT                   GVGEGLGLPSPQGPGLSLPPAVGGVGPPLGLPKPKKRTEPVRIAAPELQKGDSDSEEDE
FT                   PAKKKVVLQGSGEGTGLSALLPQPKNLTVKETNRLLLPHAFSRKPSDISSDAKPSRLAS
FT                   KTKPASLAPVLGTTTTTPSPSAIKAAAKSAALQVTKQITQEDDDSDEEVAPENFFSLPD
FT                   KAEPPGVEPYPYPVPTVPEELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGD
FT                   DYSYNQFSTYGDANAAGAYYQDYYSGGYYPAPDPALVPPQEIAPDASFIDDEAFKRLQG
FT                   KRNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQIT
FT                   YLIHQAKERELELKNTWSENKLSRRQTQAKYGF"
FT   assembly_gap    23217339..23217358
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23242935..23243138
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    23250875..23251994
FT                   /estimated_length=1120
FT                   /gap_type="unknown"
FT   gene            23259922..23269659
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /note="gene_id=mCG3084.3"
FT   mRNA            join(23259922..23260107,23260208..23260317,
FT                   23266697..23266773,23266919..23267057,23267658..23267843,
FT                   23268079..23268296,23268508..23269272)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT185422"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185422.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(23259954..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23268538,23269391..23269659)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT185420"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185420.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(23259968..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23269301)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT1900"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT1900.2 created on
FT                   12-JUN-2003"
FT   CDS             join(23260231..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_b"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185420.0
FT                   protein_id=mCP106678.0 isoform=CRA_b"
FT                   /protein_id="EDL15338.1"
FT                   /translation="MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKY
FT                   QVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQ
FT                   KKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLE
FT                   DSPKRPKESGDHEEEDKEIAALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAA
FT                   KEEAEAQGVRDHESL"
FT   CDS             join(23260231..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_b"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT1900.2
FT                   protein_id=mCP22852.2 isoform=CRA_b"
FT                   /protein_id="EDL15341.1"
FT                   /translation="MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKY
FT                   QVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQ
FT                   KKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLE
FT                   DSPKRPKESGDHEEEDKEIAALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAA
FT                   KEEAEAQGVRDHESL"
FT   CDS             join(23260231..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_b"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185422.0
FT                   protein_id=mCP106680.0 isoform=CRA_b"
FT                   /protein_id="EDL15342.1"
FT                   /translation="MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKY
FT                   QVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQ
FT                   KKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLE
FT                   DSPKRPKESGDHEEEDKEIAALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAA
FT                   KEEAEAQGVRDHESL"
FT   mRNA            join(23260450..23260768,23266697..23266773,
FT                   23266919..23267057,23267447..23267516,23267658..23267843,
FT                   23268079..23268296,23268508..23269294)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT185423"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185423.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(23260482..23260768,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23269294)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT181530"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT181530.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(23266706..23266773,23266919..23267057,
FT                   23267658..23267843,23268079..23268296,23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_a"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT181530.1
FT                   protein_id=mCP104452.1 isoform=CRA_a"
FT                   /protein_id="EDL15337.1"
FT                   /translation="MPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESKEKFGKPN
FT                   KRKGFSEGLWEIENNPTVKASGYQSSQKKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEE
FT                   GKLVIDEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDKEIAALEGERPLPVEV
FT                   EKNSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHESL"
FT   CDS             join(23266767..23266773,23266919..23267057,
FT                   23267447..23267516,23267658..23267843,23268079..23268296,
FT                   23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_d"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185423.0
FT                   protein_id=mCP106681.0 isoform=CRA_d"
FT                   /protein_id="EDL15340.1"
FT                   /translation="MRRHSWAPKTSSLMRNPRRSLASPTRGKGSARGCGRSRTTLQSRP
FT                   LATSPPPSCTEPCLPGLWVNPRANPTESSQKKSCAAEPEVEPEAHEGDGDKKGSAEGSS
FT                   DEEGKLVIDEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDKEIAALEGERPLP
FT                   VEVEKNSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHESL"
FT   mRNA            join(23267567..23267843,23268079..23268383)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT185421"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185421.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(23267643..23267843,23268079..23268300)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_c"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185421.0
FT                   protein_id=mCP106679.0 isoform=CRA_c"
FT                   /protein_id="EDL15339.1"
FT                   /translation="MSPPQSSQKKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVI
FT                   DEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDKEIAALEGERPLPVEVEKNST
FT                   PSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHER"
FT   gene            23273105..23277601
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /note="gene_id=mCG3097.1"
FT   mRNA            join(23273105..23273300,23275749..23275980,
FT                   23276063..23276158,23276320..23276483,23276867..23276997,
FT                   23277142..23277601)
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, transcript
FT                   variant mCT1888"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT1888.1 created on
FT                   26-MAR-2003"
FT   mRNA            join(23273138..23273300,23275749..23275980,
FT                   23276063..23276158,23276320..23276423,23276867..23276997,
FT                   23277142..23277596)
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, transcript
FT                   variant mCT181527"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181527.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(23273140..23273246,23275749..23275980,
FT                   23276063..23276158,23276320..23276423,23276867..23276997,
FT                   23277142..23277365)
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, transcript
FT                   variant mCT181529"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181529.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(23273292..23273423,23275749..23275980,
FT                   23276063..23276158,23276320..23276423,23276867..23276997,
FT                   23277142..23277594)
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, transcript
FT                   variant mCT181528"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181528.0 created
FT                   on 26-MAR-2003"
FT   assembly_gap    23275256..23275275
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   CDS             join(23275798..23275980,23276063..23276158,
FT                   23276320..23276483,23276867..23276997,23277142..23277278)
FT                   /codon_start=1
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT1888.1
FT                   protein_id=mCP22819.1 isoform=CRA_b"
FT                   /protein_id="EDL15335.1"
FT                   /translation="MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVV
FT                   VEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDH
FT                   RGTMIASEAPLLHHQVKLVDPVDRQAQGPLVKGLLTLESSDRVGKPTEIQWRFTEAGER
FT                   VRVSTRSGRIIPKPEFPRADGIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAM
FT                   GIQETRRFKKVYWY"
FT   CDS             join(23275798..23275980,23276063..23276158,
FT                   23276320..23276423,23276867..23276997,23277142..23277278)
FT                   /codon_start=1
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181527.0
FT                   protein_id=mCP104450.0 isoform=CRA_a"
FT                   /protein_id="EDL15333.1"
FT                   /translation="MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVV
FT                   VEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDH
FT                   RGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRAD
FT                   GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY"
FT   CDS             join(23275798..23275980,23276063..23276158,
FT                   23276320..23276423,23276867..23276997,23277142..23277278)
FT                   /codon_start=1
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181529.0
FT                   protein_id=mCP104449.0 isoform=CRA_a"
FT                   /protein_id="EDL15334.1"
FT                   /translation="MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVV
FT                   VEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDH
FT                   RGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRAD
FT                   GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY"
FT   CDS             join(23275798..23275980,23276063..23276158,
FT                   23276320..23276423,23276867..23276997,23277142..23277278)
FT                   /codon_start=1
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181528.0
FT                   protein_id=mCP104451.0 isoform=CRA_a"
FT                   /protein_id="EDL15336.1"
FT                   /translation="MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVV
FT                   VEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDH
FT                   RGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRAD
FT                   GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY"
FT   gene            complement(23276855..23283861)
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /note="gene_id=mCG3080.2"
FT   mRNA            complement(join(23276855..23277844,23278276..23279363,
FT                   23280445..23280588,23280769..23280831,23281277..23281469,
FT                   23281638..23281762,23283570..>23283841))
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, transcript variant
FT                   mCT190991"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT190991.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23277577..23277844,23278276..23278460,
FT                   23278879..23279363,23280445..23280588,23280769..23280831,
FT                   23281277..23281469,23281638..23281762,23283570..23283861))
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, transcript variant
FT                   mCT1898"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT1898.2 created on
FT                   13-DEC-2002"
FT   mRNA            complement(join(23277593..23277844,23278276..23278460,
FT                   23278874..23279363,23280445..23280588,23280769..23280831,
FT                   23281277..23281429,23281638..23281972))
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, transcript variant
FT                   mCT177228"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT177228.0 created
FT                   on 13-DEC-2002"
FT   mRNA            complement(join(23277595..23279363,23280445..23280588,
FT                   23280769..23280831,23281277..23281762,23283570..>23283860))
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, transcript variant
FT                   mCT190992"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT190992.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23277723..23277844,23278276..23278460,
FT                   23278879..23279363,23280445..23280588,23280769..23280831,
FT                   23281277..23281469,23281638..23281762,23283570..23283680))
FT                   /codon_start=1
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, isoform CRA_b"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT1898.2
FT                   protein_id=mCP22830.3 isoform=CRA_b"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="MGI:MGI:2387197"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Q8"
FT                   /protein_id="EDL15330.1"
FT                   /translation="MRGVSAHGLSHEERRQLAVDLTRVLAHYRSILDAYIIEFFTDSLW
FT                   GTLPHSWQEALDGLNPPQLATLLLGMPRDGEEMRYRSVWPLTLLALKSTACALAFTRTP
FT                   GFHTPSEFLENPSQSSRLTAPFRKHVKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSG
FT                   QGHLSRFMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRP
FT                   HHVVQWVSPTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALA
FT                   SVGCCYMKLSDPGSYPLSQWIAGLPGHELPYRLREGACHALEDYAERLHKAEPGLQTHC
FT                   FRAALETVIRQVCPELRRPGVQGIPRVHELKIEEYVKQGLKRVGLDPQLPLDLAALQAH
FT                   QAQENRVVAFFSLALLLAPLVETLILLDRMLYLQEQGFYAELLPIFSPELSPRNLVLVA
FT                   TKTPLGQAFSTLETEDN"
FT   CDS             complement(join(23278875..23279363,23280445..23280588,
FT                   23280769..23280831,23281277..23281469,23281638..23281762,
FT                   23283570..>23283839))
FT                   /codon_start=1
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, isoform CRA_c"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT190991.0
FT                   protein_id=mCP111948.0 isoform=CRA_c"
FT                   /protein_id="EDL15331.1"
FT                   /translation="GRDRPERCRRAGSEFLLCVGRAELSPVWVAWFRGTDLVSPHLLPP
FT                   CTDISRHRMRGVSAHGLSHEERRQLAVDLTRVLAHYRSILDAYIIEFFTDSLWGTLPHS
FT                   WQEALDGLNPPQLATLLLGMPRDGEEMRYRSVWPLTLLALKSTACALAFTRTPGFHTPS
FT                   EFLENPSQSSRLTAPFRKHVKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSR
FT                   FMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQW
FT                   VSPTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCY
FT                   MKLSDPGSYPLSQWIAGLPGHELPYRLREGACHALEDYAERLHKAEPGLQTHCFRAALE
FT                   TVIRQVCPELRRPGVQGIPRVHELKIEE"
FT   CDS             complement(join(23278875..23279363,23280445..23280588,
FT                   23280769..23280831,23281277..23281429,23281638..23281721))
FT                   /codon_start=1
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, isoform CRA_a"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT177228.0
FT                   protein_id=mCP100150.0 isoform=CRA_a"
FT                   /protein_id="EDL15329.1"
FT                   /translation="MARSTGWTEPTTAGHPAAGDAEGRGGNESTACALAFTRTPGFHTP
FT                   SEFLENPSQSSRLTAPFRKHVKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLS
FT                   RFMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQ
FT                   WVSPTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCC
FT                   YMKLSDPGSYPLSQWIAGLPGHELPYRLREGACHALEDYAERLHKAEPGLQTHCFRAAL
FT                   ETVIRQVCPELRRPGVQGIPRVHELKIEE"
FT   CDS             complement(join(23278875..23279363,23280445..23280588,
FT                   23280769..23280831,23281277..>23281492))
FT                   /codon_start=1
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, isoform CRA_d"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT190992.0
FT                   protein_id=mCP111949.0 isoform=CRA_d"
FT                   /protein_id="EDL15332.1"
FT                   /translation="QPGLDYLRYRSVWPLTLLALKSTACALAFTRTPGFHTPSEFLENP
FT                   SQSSRLTAPFRKHVKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSRFMSLGL
FT                   GLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQWVSPTTL
FT                   CEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDP
FT                   GSYPLSQWIAGLPGHELPYRLREGACHALEDYAERLHKAEPGLQTHCFRAALETVIRQV
FT                   CPELRRPGVQGIPRVHELKIEE"
FT   gene            23285162..23293434
FT                   /gene="Isg20l2"
FT                   /locus_tag="mCG_3091"
FT                   /note="gene_id=mCG3091.2"
FT   mRNA            join(23285162..23285991,23292290..23292490,
FT                   23292954..23293434)
FT                   /gene="Isg20l2"
FT                   /locus_tag="mCG_3091"
FT                   /product="interferon stimulated exonuclease gene 20-like 2"
FT                   /note="gene_id=mCG3091.2 transcript_id=mCT1890.2 created on
FT                   31-OCT-2002"
FT   CDS             join(23285419..23285991,23292290..23292490,
FT                   23292954..23293067)
FT                   /codon_start=1
FT                   /gene="Isg20l2"
FT                   /locus_tag="mCG_3091"
FT                   /product="interferon stimulated exonuclease gene 20-like 2"
FT                   /note="gene_id=mCG3091.2 transcript_id=mCT1890.2
FT                   protein_id=mCP22808.2"
FT                   /protein_id="EDL15328.1"
FT                   /translation="MPKEEKEAAASKRDSERSKDKKAPLSWLTPAPSKKTASVVSKIDL
FT                   LGEFQSALPKTKSTQKKGSKKKSLKKKIATENSTQAQSKDKGSKKKPLKKNAVPNSTQA
FT                   RSEDKCPTVPQNLPGKMVAIDCEMVGTGPKGRVSSLARCSIVNYNGDVLYDEYVLPPCY
FT                   IVNYRTRWSGIRKCHMVNATPFKTARSQILKILSGKVVIGHAIHNDYKALQYFHPKSLT
FT                   RDTSRIPLLNRKADCPENVTLSLKHLTKKLLSRDIQVGNTGHSSVEDAQATMELYKLVE
FT                   VEWEQHLAQNPPEN"
FT   gene            23302403..23307095
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /note="gene_id=mCG3092.1"
FT   mRNA            join(23302403..23302625,23305837..23306015,
FT                   23306200..23306316,23306709..23307095)
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /product="cellular retinoic acid binding protein II,
FT                   transcript variant mCT1884"
FT                   /note="gene_id=mCG3092.1 transcript_id=mCT1884.1 created on
FT                   09-APR-2003"
FT   mRNA            join(<23302426..23302625,23306202..23306316,
FT                   23306709..23307094)
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /product="cellular retinoic acid binding protein II,
FT                   transcript variant mCT181525"
FT                   /note="gene_id=mCG3092.1 transcript_id=mCT181525.0 created
FT                   on 09-APR-2003"
FT   CDS             join(23302556..23302625,23305837..23306015,
FT                   23306200..23306316,23306709..23306759)
FT                   /codon_start=1
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /product="cellular retinoic acid binding protein II,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3092.1 transcript_id=mCT1884.1
FT                   protein_id=mCP22829.1 isoform=CRA_a"
FT                   /protein_id="EDL15326.1"
FT                   /translation="MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIK
FT                   QENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGE
FT                   GPKTSWSRELTNDGELILTMTADDVVCTRVYVRE"
FT   CDS             <23306726..23307040
FT                   /codon_start=1
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /product="cellular retinoic acid binding protein II,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3092.1 transcript_id=mCT181525.0
FT                   protein_id=mCP104447.0 isoform=CRA_b"
FT                   /protein_id="EDL15327.1"
FT                   /translation="RCVHQGLRPRVSAYGSKNCLRRLLCPLQDTNLPPTSILQTSSPLT
FT                   PEGYCFLQGLLFFAFSTPERGRSSEPSHRHLPLPGQQSQLHTRVLPGRDCLSGLYSLSL
FT                   "
FT   gene            <23324804..23334162
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /note="gene_id=mCG8845.2"
FT   mRNA            join(<23324804..23325699,23326703..23326827,
FT                   23328513..23328586,23329132..23334162)
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /product="nestin, transcript variant mCT190960"
FT                   /note="gene_id=mCG8845.2 transcript_id=mCT190960.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(23324840..23325699,23326703..23326827,
FT                   23328513..23328586,23329132..23330401,23330534..23334160)
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /product="nestin, transcript variant mCT9439"
FT                   /note="gene_id=mCG8845.2 transcript_id=mCT9439.2 created on
FT                   13-AUG-2002"
FT   CDS             join(<23324845..23325699,23326703..23326827,
FT                   23328513..23328586,23329132..23333741)
FT                   /codon_start=1
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /product="nestin, isoform CRA_a"
FT                   /note="gene_id=mCG8845.2 transcript_id=mCT190960.0
FT                   protein_id=mCP111928.0 isoform=CRA_a"
FT                   /protein_id="EDL15324.1"
FT                   /translation="KLQGPLPSLVLHVRLPSGGQTSDMEGCVGEESFQMWELNRRLEAY
FT                   LTRVKTLEEQNQLLSAELGGLRAQSGDASWRARADDELAALRVLVDQRWREKHEAEVQR
FT                   DNLAEELESVAGRCQQVRLARERTIEEAACSRRALEAEKNARGWLSTQAAELERELEAL
FT                   RASHEEERAHLNAQAACTPRRPPAPAHASPIRAPEVEELARRLGEVWRGAVRDYQERVA
FT                   HMESSLGQARERLGQAVRGARESRLEVQQLQADRDSLQERREALEQRLEGRWQDRLQAT
FT                   EKFQLAVEALEQEKQGLQSQIAQILEGGQQLAHLKMSLSLEVATYRTLLEAENSRLQTP
FT                   GRSSQASLGFPDPKLKLHFLGIPEDQHLGSVLPVLSPTSFSSPLPNTLETPVTAFLKTQ
FT                   EFLKARTPTLASTPIPPMSEAPYPKNAEVRAQDVPHSLLQGGRQQAPEPLWAEATVPSS
FT                   TGVLPELEEPGGEQPDHFPDDPSSLAPPLNPHHSILEAKDRESSESRVSSIFQEEEGQI
FT                   WELVKKEAATEVKVENSLAQEIQESGLDTEEIQDSQGPLQKETLEALGDEPLMSLKTQN
FT                   HETPGKENCNSSIEENSGTVKSPEKEKQTPLKSLEEKNVEAEKTLENGVLELSKPLGEE
FT                   EPRMEDQELMSPEHTLETVSFLGKENQEVVRSSEEQNLESLITFKEESQYPLGGPEAED
FT                   QMLERLVEKEDQRFPRSPEEDQQAFRPLEKENQEPLRFEEAEDQVLERLIEKERQESLK
FT                   SPEEEDQQAFRLLEKENQEPLRFEDAEDQVLERLIEKERQESLKSPEEEDQQAFRLLEK
FT                   ENQEPLRFEEAEDQVLERLVEKESQESLKSPEEEDQRTGKPLEKENQESLRSLDENQET
FT                   IVLLESKNQRPLRSLEVEEEEQRIVKPLEKVSQVSLESLEKENVQSPRYLEDDDHMIKS
FT                   LLEDKTHEILGSLEDRNGENFIPPENETQGSLRPPEEEDQRIVNHLEKESQEFLRSPEA
FT                   EEEEEQVMVRSLEGENHDPLSSVVKEEQMAESKLENESQDSGKSLEDESQETFGSLEKE
FT                   NLESLRSLAGQDQEEQKLEQETQQPLRAVEDEQMTVNPPEKVDPELPKPLRNDQEVVRS
FT                   LDKENQESLVSLNEGGMETVKSSETENIESLETVGECLGRRKSVDTQEPLWSTEVTSET
FT                   IEPLEDETQEPLGCVDENQEVLTPLERESQELRSLGKWNPETVESPGGVEDSQQCLEVE
FT                   EGPEREQHQESLRSLGEVEWELPGSGSQQRWEDVVEDGEGQEASLGATGVETEDKAELH
FT                   LRGQGGEEKAVEEGELLQDAVGEAWSLGSSEPKEQRVPAEPLDDLEGQPEQTGTLEVPV
FT                   AQGMPEATEQDEDRAQAGEQDSVEVTLGLEAARAGLELEQEVVGLEDPRHFAREEAIHP
FT                   SLGEESVKAKIDQGLEEPGKEPKEAGALDSGIPELPKTSSETLECKGWEESGEGWGEEE
FT                   ASLETSDHEGSHAPQPRPPKTEEDEGLQAALTVPGPKLLEPCSPIPILTDAHELQPQAE
FT                   GIQEAGWQPEAGTEALGRVEDEPEFGRGEIPEGLQDWEEGREDSEADELGETLPDSTPL
FT                   GLYLKSPASPKWEQAGEQRLFPQGEARKEGWSPAVLAAQGLSDPPEEEQQGHDSDLSSE
FT                   EFEDLGTEASLLPGVPKEVSDHLGQEPPVLQPACWDQGGESDGFADEEESGEEGEEEDA
FT                   DEEEGAESGAQWWGPGPSGGGVKVQDVTQRGDLEHESVGDSGLWDDGLSGAAANVLVTA
FT                   LETVSQDSAEPSGSEGSESASLEGEEGQAIDHLDAPQEVTSVVPGAGDTFDISGQGPNL
FT                   ESEQVNGRMENGLEQAEGQVVLHGDEDQDIPLQEQGTLKAPLVGSPVHLGPSQPLKFTL
FT                   SGVDGDSWSSGED"
FT   CDS             join(23324914..23325699,23326703..23326827,
FT                   23328513..23328586,23329132..23330401,23330534..23333741)
FT                   /codon_start=1
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /product="nestin, isoform CRA_b"
FT                   /note="gene_id=mCG8845.2 transcript_id=mCT9439.2
FT                   protein_id=mCP22843.2 isoform=CRA_b"
FT                   /protein_id="EDL15325.1"
FT                   /translation="MEGCVGEESFQMWELNRRLEAYLTRVKTLEEQNQLLSAELGGLRA
FT                   QSGDASWRARADDELAALRVLVDQRWREKHEAEVQRDNLAEELESVAGRCQQVRLARER
FT                   TIEEAACSRRALEAEKNARGWLSTQAAELERELEALRASHEEERAHLNAQAACTPRRPP
FT                   APAHASPIRAPEVEELARRLGEVWRGAVRDYQERVAHMESSLGQARERLGQAVRGARES
FT                   RLEVQQLQADRDSLQERREALEQRLEGRWQDRLQATEKFQLAVEALEQEKQGLQSQIAQ
FT                   ILEGGQQLAHLKMSLSLEVATYRTLLEAENSRLQTPGRSSQASLGFPDPKLKLHFLGIP
FT                   EDQHLGSVLPVLSPTSFSSPLPNTLETPVTAFLKTQEFLKARTPTLASTPIPPMSEAPY
FT                   PKNAEVRAQDVPHSLLQGGRQQAPEPLWAEATVPSSTGVLPELEEPGGEQPDHFPDDPS
FT                   SLAPPLNPHHSILEAKDRESSESRVSSIFQEEEGQIWELVKKEAATEVKVENSLAQEIQ
FT                   ESGLDTEEIQDSQGPLQKETLEALGDEPLMSLKTQNHETPGKENCNSSIEENSGTVKSP
FT                   EKEKQTPLKSLEEKNVEAEKTLENGVLELSKPLGEEEPRMEDQELMSPEHTLETVSFLG
FT                   KENQEVVRSSEEQNLESLITFKEESQYPLGGPEAEDQMLERLVEKEDQRFPRSPEEDQQ
FT                   AFRPLEKENQEPLRFEEAEDQVLERLIEKERQESLKSPEEEDQQAFRLLEKENQEPLRF
FT                   EEAEDQVLERLVEKESQESLKSPEEEDQRTGKPLEKENQESLRSLDENQETIVLLESKN
FT                   QRPLRSLEVEEEEQRIVKPLEKVSQVSLESLEKENVQSPRYLEDDDHMIKSLLEDKTHE
FT                   ILGSLEDRNGENFIPPENETQGSLRPPEEEDQRIVNHLEKESQEFLRSPEAEEEEEQVM
FT                   VRSLEGENHDPLSSVVKEEQMAESKLENESQDSGKSLEDESQETFGSLEKENLESLRSL
FT                   AGQDQEEQKLEQETQQPLRAVEDEQMTVNPPEKVDPELPKPLRNDQEVVRSLDKENQES
FT                   LVSLNEGGMETVKSSETENIESLETVGECLGRRKSVDTQEPLWSTEVTSETIEPLEDET
FT                   QEPLGCVDENQEVLTPLERESQELRSLGKWNPETVESPGGVEDSQQCLEVEEGPEREQH
FT                   QESLRSLGEVEWELPGSGSQQRWEDVVEDGEGQEASLGATGVETEDKAELHLRGQGGEE
FT                   KAVEEGELLQDAVGEAWSLGSSEPKEQRVPAEPLDDLEGQPEQTGTLEVPVAQGMPEAT
FT                   EQDEDRAQAGEQDSVEVTLGLEAARAGLELEQEVVGLEDPRHFAREEAIHPSLGEESVK
FT                   AKIDQGLEEPGKEPKEAGALDSGIPELPKTSSETLECKGWEESGEGWGEEEASLETSDH
FT                   EGSHAPQPRPPKTEEDEGLQAALTVPGPKLLEPCSPIPILTDAHELQPQAEGIQEAGWQ
FT                   PEAGTEALGRVEDEPEFGRGEIPEGLQDWEEGREDSEADELGETLPDSTPLGLYLKSPA
FT                   SPKWEQAGEQRLFPQGEARKEGWSPAVLAAQGLSDPPEEEQQGHDSDLSSEEFEDLGTE
FT                   ASLLPGVPKEVSDHLGQEPPVLQPACWDQGGESDGFADEEESGEEGEEEDADEEEGAES
FT                   GAQWWGPGPSGGGVKVQDVTQRGDLEHESVGDSGLWDDGLSGAAANVLVTALETVSQDS
FT                   AEPSGSEGSESASLEGEEGQAIDHLDAPQEVTSVVPGAGDTFDISGQGPNLESEQVNGR
FT                   MENGLEQAEGQVVLHGDEDQDIPLQEQGTLKAPLVGSPVHLGPSQPLKFTLSGVDGDSW
FT                   SSGED"
FT   gene            complement(23341228..23353924)
FT                   /gene="Bcan"
FT                   /locus_tag="mCG_8847"
FT                   /note="gene_id=mCG8847.1"
FT   mRNA            complement(join(23341228..23341664,23341969..23342159,
FT                   23342390..23342534,23342865..23342947,23343834..23343992,
FT                   23344369..23344476,23346749..23347336,23347806..23348027,
FT                   23349104..23349397,23349812..23349939,23350233..23350407,
FT                   23350679..23351050,23351439..23351549,23353797..23353924))
FT                   /gene="Bcan"
FT                   /locus_tag="mCG_8847"
FT                   /product="brevican"
FT                   /note="gene_id=mCG8847.1 transcript_id=mCT9441.1 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(23341569..23341664,23341969..23342159,
FT                   23342390..23342534,23342865..23342947,23343834..23343992,
FT                   23344369..23344476,23346749..23347336,23347806..23348027,
FT                   23349104..23349397,23349812..23349939,23350233..23350407,
FT                   23350679..23351050,23351439..23351529))
FT                   /codon_start=1
FT                   /gene="Bcan"
FT                   /locus_tag="mCG_8847"
FT                   /product="brevican"
FT                   /note="gene_id=mCG8847.1 transcript_id=mCT9441.1
FT                   protein_id=mCP22844.2"
FT                   /db_xref="GOA:Q61361"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR000538"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR018378"
FT                   /db_xref="MGI:MGI:1096385"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61361"
FT                   /protein_id="EDL15323.1"
FT                   /translation="MIPLLLSLLAALVLTQAPAALADDLKEDSSEDRAFRVRIGATQLR
FT                   GVLGGALAIPCHVHHLRPPHSRRAAPGFPRVKWTFLSGDREVEVLVARGLRVKVNEAYR
FT                   FRVALPAYPASLTDVSLVLSELRPNDSGVYRCEVQHGIDDSSDAVEVKVKGVVFLYREG
FT                   SARYAFSFAGAQEACARIGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQNPREA
FT                   CSGDMDGYPGVRNYGVVGPDDLYDVYCYAEDLNGELFLGAPPSKLTWEEARDYCLERGA
FT                   QIASTGQLYAAWNGGLDRCSPGWLADGSVRYPIITPSQRCGGGLPGVKTLFLFPNQTGF
FT                   PSKQNRFNVYCFRDSAHPSASSEASSPASDGLEAIVTVTEKLEELQLPQEAMESESRGA
FT                   IYSIPISEDGGGGSSTPEDPAEAPRTPLESETQSIAPPTESSEEEGVALEEEERFKDLE
FT                   ALEEEKEQEDLWVWPRELSSPLPTGSETEHSLSQVSPPAQAVLQLGASPSPGPPRVRGP
FT                   PAETLLPPREGSPTSTPGGAREVGGETGSPELSGVPRESEEAGSSSLEDGPSLLPATWA
FT                   PVGPRELETPSEEKSGRTVLAGTSVQAQPVLPTDSASHGGVAVAPSSGDCIPSPCHNGG
FT                   TCLEEKEGFRCLCLPGYGGDLCDVGLHFCSPGWEAFQGACYKHFSTRRSWEEAESQCRA
FT                   LGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGAPLLYENWNPGQPDSY
FT                   FLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPQLPLAQIFGRPRLRYAV
FT                   DTVLRYRCRDGLAQRNLPLIRCQENGLWEAPQISCVPRRPGRALRSMDAPEGPRGQLSR
FT                   HRKAPLTPPSSL"
FT   assembly_gap    23357869..23357888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    23361611..23363244
FT                   /estimated_length=1634
FT                   /gap_type="unknown"
FT   gene            complement(23377572..>2338309