spacer

EBI Dbfetch

ID   CH466547; SV 2; linear; genomic DNA; CON; MUS; 27575588 BP.
XX
AC   CH466547;
XX
PR   Project:PRJNA11785;
XX
DT   04-AUG-2005 (Rel. 84, Created)
DT   10-JUN-2007 (Rel. 92, Last updated, Version 7)
XX
DE   Mus musculus 232000009774422 genomic scaffold, whole genome shotgun
DE   sequence.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mus; Mus.
XX
RN   [1]
RP   1-27575588
RX   DOI; 10.1126/science.1069193.
RX   PUBMED; 12040188.
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Miklos G.L., Wides R.,
RA   Halpern A., Li P.W., Sutton G.G., Nadeau J., Salzberg S.L., Holt R.A.,
RA   Kodira C.D., Lu F., Chen L., Deng Z., Evangelista C.C., Gan W.,
RA   Heiman T.J., Li J., Li Z., Merkulov G.V., Milshina N.V., Naik A.K., Qi R.,
RA   Shue B.C., Wang A., Wang J., Wang X., Yan X., Ye J., Yooseph S., Zhao Q.,
RA   Zheng L., Zhu S.C., Biddick K., Bolanos R., Delcher A.L., Dew I.M.,
RA   Fasulo D., Flanigan M.J., Huson D.H., Kravitz S.A., Miller J.R.,
RA   Mobarry C.M., Reinert K., Remington K.A., Zhang Q., Zheng X.H.,
RA   Nusskern D.R., Lai Z., Lei Y., Zhong W., Yao A., Guan P., Ji R.R., Gu Z.,
RA   Wang Z.Y., Zhong F., Xiao C., Chiang C.C., Yandell M., Wortman J.R.,
RA   Amanatides P.G., Hladun S.L., Pratts E.C., Johnson J.E., Dodson K.L.,
RA   Woodford K.J., Evans C.A., Gropman B., Rusch D.B., Venter E., Wang M.,
RA   Smith T.J., Houck J.T., Tompkins D.E., Haynes C., Jacob D., Chin S.H.,
RA   Allen D.R., Dahlke C.E., Sanders R., Li K., Liu X., Levitsky A.A.,
RA   Majoros W.H., Chen Q., Xia A.C., Lopez J.R., Donnelly M.T., Newman M.H.,
RA   Glodek A., Kraft C.L., Nodell M., Ali F., An H.J., Baldwin-Pitts D.,
RA   Beeson K.Y., Cai S., Carnes M., Carver A., Caulk P.M., Center A.,
RA   Chen Y.H., Cheng M.L., Coyne M.D., Crowder M., Danaher S., Davenport L.B.,
RA   Desilets R., Dietz S.M., Doup L., Dullaghan P., Ferriera S., Fosler C.R.,
RA   Gire H.C., Gluecksmann A., Gocayne J.D., Gray J., Hart B., Haynes J.,
RA   Hoover J., Howland T., Ibegwam C., Jalali M., Johns D., Kline L., Ma D.S.,
RA   MacCawley S., Magoon A., Mann F., May D., McIntosh T.C., Mehta S., Moy L.,
RA   Moy M.C., Murphy B.J., Murphy S.D., Nelson K.A., Nuri Z., Parker K.A.,
RA   Prudhomme A.C., Puri V.N., Qureshi H., Raley J.C., Reardon M.S.,
RA   Regier M.A., Rogers Y.H., Romblad D.L., Schutz J., Scott J.L., Scott R.,
RA   Sitter C.D., Smallwood M., Sprague A.C., Stewart E., Strong R.V., Suh E.,
RA   Sylvester K., Thomas R., Tint N.N., Tsonis C., Wang G., Wang G.,
RA   Williams M.S., Williams S.M., Windsor S.M., Wolfe K., Wu M.M., Zaveri J.,
RA   Chaturvedi K., Gabrielian A.E., Ke Z., Sun J., Subramanian G., Venter J.C.,
RA   Pfannkoch C.M., Barnstead M., Stephenson L.D.;
RT   "A comparison of whole-genome shotgun-derived mouse chromosome 16 and the
RT   human genome";
RL   Science 296(5573):1661-1671(2002).
XX
RN   [2]
RP   1-27575588
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (05-JUL-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
RN   [3]
RP   1-27575588
RA   Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.;
RT   ;
RL   Submitted (02-SEP-2005) to the INSDC.
RL   Celera Genomics, 45 W. Gude Dr., Rockville, MD 20850, USA
XX
DR   MD5; 8ed04a52d49dd0920a8d6603ed06d1ef.
DR   ENA; AAHY010000000; SET.
DR   ENA; AAHY000000000; SET.
DR   ENA-CON; CM000211.
DR   Ensembl-Gn; ENSMUSG00000001017; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001021; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001023; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001025; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001416; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000001419; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000003382; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004892; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004894; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004895; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000004896; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000005640; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000008601; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000015852; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027776; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027782; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027792; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027827; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027828; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027931; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027932; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027937; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027944; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027950; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027995; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000027996; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028003; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028004; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028020; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028040; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028047; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028049; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028051; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028057; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028059; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028063; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028064; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000028081; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000031286; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033831; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000033981; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000034139; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000038965; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041237; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000041423; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042312; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000042579; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044080; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000044330; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000047557; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048304; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000048416; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000049741; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000050144; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000051036; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000052310; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056054; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000056071; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000059743; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000064068; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074457; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074479; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000074513; mus_musculus.
DR   Ensembl-Gn; ENSMUSG00000091175; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001043; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001046; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001049; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001051; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001452; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000001455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005014; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005015; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000005016; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000008745; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000015467; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029345; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029353; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029367; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029414; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029540; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029541; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029546; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029562; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029623; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029625; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029632; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029633; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029654; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029674; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029682; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029684; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029686; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029700; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029711; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000029722; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000033643; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000038450; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000039047; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000047111; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048138; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000048246; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049230; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000049937; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000050258; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000054148; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000057935; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000058981; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000059407; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000060738; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000061322; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000063119; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069927; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000069960; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000073572; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000075316; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000076639; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000077916; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000079724; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000081848; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090192; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090971; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000090986; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098910; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098911; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098952; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000098997; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107329; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107331; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107334; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107335; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107340; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107342; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107343; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107344; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107346; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107582; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000107816; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000115699; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000117167; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000119109; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000143514; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147948; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000147991; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000165898; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166173; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000166237; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000169222; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170036; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000170377; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172333; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000175779; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000176500; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000181271; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000182831; mus_musculus.
XX
CC   On Sep 6, 2005 this sequence version replaced gi:70980433.
CC   This is the July 2001 combined whole genome shotgun assembly of Mus
CC   musculus. It contains 27 million Celera reads on four Mus musculus
CC   strains (129X1/SvJ, 129S1/SvImJ, DBA/2J and A/J), 13 million reads
CC   on C57BL/6J from the NCBI Trace Archive, 0.4 million BAC end
CC   sequences from TIGR, and unfinished and finished BACs pulled from
CC   NCBI (Nature 2002. 420:520-562). The assembly process relied on
CC   Celera's paired reads and BAC end reads for long range order and
CC   orientation. Its scaffolds were mapped to chromosomes using STS
CC   maps. For more detailed information about whole genome sequencing
CC   and Celera's assembly process, please refer to Venter, J.C. et al.
CC   Science 2001. 291:1304-1351.
CC   This version of genes, transcripts, and proteins was
CC   computationally created in November 2001 from the whole-genome
CC   mapping of transcript and protein sequences on the Celera mouse
CC   genome assembly by Celera Chromosome Team and Content Systems.  The
CC   data sets used by this annotation process were collected in 2001
CC   and include RefSeq (NM_ from mouse and human) sequences, GenBank
CC   mRNA and dbEST sequences, mammalian SwissProt sequences,  and NRAA
CC   sequences (all mouse unless noted otherwise).  The initial gene set
CC   was manually curated between 2002 and 2003. Subsequently, automated
CC   annotation updates were performed.  The CDS of each transcript was
CC   manually or computationally defined by either the longest
CC   ATG-to-Stop or the longest open reading frame. All CDSs
CC   corresponding to the longest open reading frames with no starting
CC   ATG were flagged as partial.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..27575588
FT                   /organism="Mus musculus"
FT                   /chromosome="3"
FT                   /strain="mixed"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <64984..73897
FT                   /locus_tag="mCG_6369"
FT                   /note="gene_id=mCG6369.1"
FT   mRNA            join(<64984..65116,70676..70769,72542..72714,73750..73897)
FT                   /locus_tag="mCG_6369"
FT                   /product="mCG6369"
FT                   /note="gene_id=mCG6369.1 transcript_id=mCT5944.1 created on
FT                   19-NOV-2002"
FT   CDS             join(<64985..65116,70676..70769,72542..72714,73750..73851)
FT                   /codon_start=1
FT                   /locus_tag="mCG_6369"
FT                   /product="mCG6369"
FT                   /note="gene_id=mCG6369.1 transcript_id=mCT5944.1
FT                   protein_id=mCP8210.1"
FT                   /protein_id="EDL15549.1"
FT                   /translation="SQPHTLLQRVKACTTEEDQEKLMQITSLHSLNAFLLPIKTVGVQL
FT                   CVESQVKMNLTGNLLFSLPDLYLKCVITLTGFAGKISQMPVILTPLHFDRDPLQKQPSC
FT                   QRSVVIRTFITSDFMTGVPETPGNEIPVEVVLKMVTEIKKIPGISRIMYDLTSKPPETT
FT                   EWE"
FT   gene            91735..92544
FT                   /pseudo
FT                   /locus_tag="mCG_1032246"
FT                   /note="gene_id=mCG1032246.1"
FT   mRNA            91735..92544
FT                   /pseudo
FT                   /locus_tag="mCG_1032246"
FT                   /note="gene_id=mCG1032246.1 transcript_id=mCT149950.1
FT                   created on 28-MAR-2003"
FT   gene            complement(<104527..189842)
FT                   /locus_tag="mCG_119118"
FT                   /note="gene_id=mCG119118.1"
FT   mRNA            complement(join(<104527..104818,157533..157656,
FT                   171711..171941,180449..181318,184035..184326,
FT                   189507..189842))
FT                   /locus_tag="mCG_119118"
FT                   /product="mCG119118"
FT                   /note="gene_id=mCG119118.1 transcript_id=mCT120282.1
FT                   created on 19-NOV-2002"
FT   CDS             complement(join(<104527..104818,157533..157656,
FT                   171711..171941,180449..181318,184035..184326,
FT                   189507..189748))
FT                   /codon_start=1
FT                   /locus_tag="mCG_119118"
FT                   /product="mCG119118"
FT                   /note="gene_id=mCG119118.1 transcript_id=mCT120282.1
FT                   protein_id=mCP65693.1"
FT                   /protein_id="EDL15548.1"
FT                   /translation="MASRNKCLILGFTVFLWVELYTQYPHIDQNVTCRLLRKFNLTGYV
FT                   EAENHSVVIGGLFPVHYRTMPTSDSDEEIESPMCEGFNFRGFRWMKTMIHTIKEINERK
FT                   DILPNHTLGYQIFDNCFSITKAMESSSVFLTGQEEYKPNWRNSTGKFLIGIIGAGGSTM
FT                   SAAVSRIVGIHHVPQVGYASSSSIFSNDIQFPYILRTIPSDKFQSEAIVNLIRHFGWVW
FT                   VGAIASDDDYGKYGVKFFREEMESANLCVAFSETIPKVYSNEKMKIAVDAVKSSTAKVI
FT                   VLYATDIDLSPFVLEVIHHNITDRTWIATEAWITSALIAKPEYFPYFGGTFGFAVPRSV
FT                   IPGLKEFLYDVHPSKDPNDVLTIEFWQTAFNCTWPNSTVPYNVDHRVNMTGKEDRLYDM
FT                   SDQLCTGEEKLEDLKSTYLDTSQLRITNNVRQAVYLLAHAIDLFSQADIREEYRENAVL
FT                   ENKPNFESVKLWLYLTKIKFITHDGRKIELGRNGDVLNGSYDILNWHMDNTGEITFVKV
FT                   GEYKFTSSKYEFVLPKNSTLFWNTESSRLPDSVCTKVCPPGTRKGIHQGQPICCFDCIP
FT                   CTDGYVSEKPGQRECDPCGEDDWSNAEKSKCVPKLVEFLAYEEALGFTLVILSIFGALV
FT                   VLAVTAVYVVHRHTPLVKANDRELSFLIQMSLGITVLSSMLFIGKPCN"
FT   gene            361012..361860
FT                   /pseudo
FT                   /locus_tag="mCG_1032245"
FT                   /note="gene_id=mCG1032245.1"
FT   mRNA            361012..361860
FT                   /pseudo
FT                   /locus_tag="mCG_1032245"
FT                   /note="gene_id=mCG1032245.1 transcript_id=mCT149949.1
FT                   created on 31-MAR-2003"
FT   gene            411148..673208
FT                   /locus_tag="mCG_147520"
FT                   /note="gene_id=mCG147520.0"
FT   mRNA            join(411148..411459,671346..673208)
FT                   /locus_tag="mCG_147520"
FT                   /product="mCG147520"
FT                   /note="gene_id=mCG147520.0 transcript_id=mCT187783.0
FT                   created on 13-JAN-2004"
FT   CDS             join(411185..411459,671346..671634)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147520"
FT                   /product="mCG147520"
FT                   /note="gene_id=mCG147520.0 transcript_id=mCT187783.0
FT                   protein_id=mCP109364.0"
FT                   /protein_id="EDL15547.1"
FT                   /translation="MLAARTGAAGSQISEDNSKFRKQSGLSSGGKDRSPKKAPENAKDS
FT                   SLSPTGQSQLRARQLALLREVEMNWYLKLCELSSEHTTAHTTGMPHSLSQIDFDASLSS
FT                   CPSQAFKPRHFYHLHVLNLVGLLRHHHQTVVTHSKTQSVRQRWKPDSAHRKRQCRLCLR
FT                   ARLMGRISVWTLTEEQKFRGKGKE"
FT   gene            <566384..>834881
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /note="gene_id=mCG13445.3"
FT   mRNA            join(<566384..567009,716069..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   823626..824133)
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, transcript variant mCT190986"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT190986.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<566660..567009,711308..711423,716061..716112,
FT                   753555..753592,755958..756037,757877..757921,
FT                   760429..760473,762400..762443,777753..777839,
FT                   814602..814687,815361..815481,816587..816681,
FT                   822947..823067,829658..829750,834792..834881)
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, transcript variant mCT11663"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT11663.2 created
FT                   on 14-OCT-2002"
FT   CDS             join(<566762..567009,716069..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   823626..823642)
FT                   /codon_start=1
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, isoform CRA_c"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT190986.0
FT                   protein_id=mCP111940.0 isoform=CRA_c"
FT                   /protein_id="EDL15544.1"
FT                   /translation="EDLALSWEAMQVSIACTEHNLKSRNGEDRLLSKQSSNAPNVVNAA
FT                   RAKFRTVAIIARSLGTFTPQHHISLKESTAKQTGMKYRNLGKSGLRVSCLGLGTWVTFG
FT                   GQISDEVAERLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLY
FT                   WGGKAETERGLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQ
FT                   GMAMYWGTSRWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGV
FT                   GAMTWSPLACGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAE
FT                   RLGCTLPQLAVGSSPC"
FT   mRNA            join(<566789..567009,716069..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   829658..829746,834792..>834881)
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, transcript variant mCT190985"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT190985.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(566789..567009,716069..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   829658..829746,834792..834881)
FT                   /codon_start=1
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, isoform CRA_b"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT190985.0
FT                   protein_id=mCP111939.0 isoform=CRA_b"
FT                   /db_xref="GOA:P63143"
FT                   /db_xref="InterPro:IPR001395"
FT                   /db_xref="InterPro:IPR005399"
FT                   /db_xref="InterPro:IPR005400"
FT                   /db_xref="InterPro:IPR005983"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="MGI:MGI:109155"
FT                   /db_xref="UniProtKB/Swiss-Prot:P63143"
FT                   /protein_id="EDL15543.1"
FT                   /translation="MQVSIACTEHNLKSRNGEDRLLSKQSSNAPNVVNAARAKFRTVAI
FT                   IARSLGTFTPQHHISLKESTAKQTGMKYRNLGKSGLRVSCLGLGTWVTFGGQISDEVAE
FT                   RLMTIAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETER
FT                   GLSRKHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTS
FT                   RWSAMEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLA
FT                   CGIISGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQL
FT                   AVAWCLRNEGVSSVLLGSSTPEQLIENLGAIQVLPKMTSHVVNEIDNILRNKPYSKKDY
FT                   RS"
FT   gene            complement(590233..>760967)
FT                   /locus_tag="mCG_145238"
FT                   /note="gene_id=mCG145238.0"
FT   mRNA            complement(join(590233..591787,594145..594359,
FT                   713432..713537,756582..756815,760881..>760967))
FT                   /locus_tag="mCG_145238"
FT                   /product="mCG145238"
FT                   /note="gene_id=mCG145238.0 transcript_id=mCT184662.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(590997..>591299)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145238"
FT                   /product="mCG145238"
FT                   /note="gene_id=mCG145238.0 transcript_id=mCT184662.0
FT                   protein_id=mCP105805.0"
FT                   /protein_id="EDL15546.1"
FT                   /translation="SQRHGQGSRAGHQRSFGRESLPGLFVATAFCHTQPSALSSDPAVN
FT                   TLPSVCHQNFPLLHSQEGVFVVALSCAWIIQDNLLSSGSPNKLQLQISRATHSQC"
FT   CDS             join(<711400..711423,716061..716112,753555..753592,
FT                   755958..756037,757877..757921,760429..760473,
FT                   762400..762443,777753..777839,814602..814687,
FT                   815361..815481,816587..816681,822947..823067,
FT                   829658..829750,834792..834802)
FT                   /codon_start=1
FT                   /gene="Kcnab1"
FT                   /locus_tag="mCG_13445"
FT                   /product="potassium voltage-gated channel, shaker-related
FT                   subfamily, beta member 1, isoform CRA_a"
FT                   /note="gene_id=mCG13445.3 transcript_id=mCT11663.2
FT                   protein_id=mCP18402.2 isoform=CRA_a"
FT                   /protein_id="EDL15542.1"
FT                   /translation="LSGDTAFKCSRNLGKSGLRVSCLGLGTWVTFGGQISDEVAERLMT
FT                   IAYESGVNLFDTAEVYAAGKAEVILGSIIKKKGWRRSSLVITTKLYWGGKAETERGLSR
FT                   KHIIEGLKGSLQRLQLEYVDVVFANRPDSNTPMEEIVRAMTHVINQGMAMYWGTSRWSA
FT                   MEIMEAYSVARQFNMIPPVCEQAEYHLFQREKVEVQLPELYHKIGVGAMTWSPLACGII
FT                   SGKYGNGVPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAVAW
FT                   CLRNEGVSSVLLGSSTPEQLIENLGAIQASPP"
FT   gene            complement(782354..>807763)
FT                   /locus_tag="mCG_144656"
FT                   /note="gene_id=mCG144656.0"
FT   mRNA            complement(join(782354..783414,784487..784717,
FT                   807339..807400,807734..>807763))
FT                   /locus_tag="mCG_144656"
FT                   /product="mCG144656"
FT                   /note="gene_id=mCG144656.0 transcript_id=mCT184080.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(784605..784717,807339..807400,
FT                   807734..>807762))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144656"
FT                   /product="mCG144656"
FT                   /note="gene_id=mCG144656.0 transcript_id=mCT184080.0
FT                   protein_id=mCP105801.0"
FT                   /protein_id="EDL15545.1"
FT                   /translation="RQKNGSHERGYLKGVARRGAMSRMESEKGKALYLSEELRLSRDRN
FT                   LPECRCGQSLDLKLSALPCALC"
FT   gene            complement(837970..850935)
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /note="gene_id=mCG13448.2"
FT   mRNA            complement(join(837970..840347,841305..841436,
FT                   846102..846200,849697..849823,850777..850935))
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /product="signal sequence receptor, gamma, transcript
FT                   variant mCT11666"
FT                   /note="gene_id=mCG13448.2 transcript_id=mCT11666.2 created
FT                   on 18-NOV-2002"
FT   CDS             complement(join(840281..840347,841305..841436,
FT                   846102..846200,849697..849823,850777..850909))
FT                   /codon_start=1
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /product="signal sequence receptor, gamma, isoform CRA_a"
FT                   /note="gene_id=mCG13448.2 transcript_id=mCT11666.2
FT                   protein_id=mCP18388.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q4FK79"
FT                   /db_xref="InterPro:IPR009779"
FT                   /db_xref="MGI:MGI:1914687"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FK79"
FT                   /protein_id="EDL15540.1"
FT                   /translation="MAPKGGSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVSAIPIW
FT                   LYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKEVTRKL
FT                   SEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILKNFNPT
FT                   VNYILSISASSGLIALLSTGSK"
FT   mRNA            complement(join(840343..841436,846102..846200,
FT                   849697..849823,850777..>850926))
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /product="signal sequence receptor, gamma, transcript
FT                   variant mCT190988"
FT                   /note="gene_id=mCG13448.2 transcript_id=mCT190988.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(841256..841436,846102..846200,
FT                   849697..849823,850777..>850924))
FT                   /codon_start=1
FT                   /gene="Ssr3"
FT                   /locus_tag="mCG_13448"
FT                   /product="signal sequence receptor, gamma, isoform CRA_b"
FT                   /note="gene_id=mCG13448.2 transcript_id=mCT190988.0
FT                   protein_id=mCP111941.0 isoform=CRA_b"
FT                   /protein_id="EDL15541.1"
FT                   /translation="VFSSAMAPKGGSKQQSEEDLLLQDFSRNLSAKSSALFFGNAFIVS
FT                   AIPIWLYWRIWHMDLIQSAVLYSVMTLVSTYLVAFAYKNVKFVLKHKVAQKREDAVSKE
FT                   VTRKLSEADNRKMSRKEKDERILWKKNEVADYEATTFSIFYNNTLFLVLVIVASFFILK
FT                   NFNPTVYPLESFPINSSLLCF"
FT   gene            851693..853635
FT                   /locus_tag="mCG_63314"
FT                   /note="gene_id=mCG63314.1"
FT   mRNA            851693..853635
FT                   /locus_tag="mCG_63314"
FT                   /product="mCG63314"
FT                   /note="gene_id=mCG63314.1 transcript_id=mCT63497.1 created
FT                   on 19-NOV-2002"
FT   CDS             851709..853556
FT                   /codon_start=1
FT                   /locus_tag="mCG_63314"
FT                   /product="mCG63314"
FT                   /note="gene_id=mCG63314.1 transcript_id=mCT63497.1
FT                   protein_id=mCP38993.0"
FT                   /protein_id="EDL15539.1"
FT                   /translation="MAVYHGMLRFGRLCIASLGARGPRTLLTRPRPNSKLQSVRALSSG
FT                   MVNCTNPLPIGGLSYIQGHTDSHLVNTTVGECLDATAQRFPDREALVILHENIRLNFAQ
FT                   LKEEVDKAASGLLSIGLRKGDRLGMQGPNSYAWVLIQLATAQAGIILVSVNPAYQSSEL
FT                   EYVLRKVGCKGIVFPKQFKTQQYYDILKQVCPELEKAQPGALKSERLPDLTTVISVDAP
FT                   LPGTLLLDNIVAAGGKEQNLAQLRYNQRFLSCYDPINIQFTSGTTGNPKGATLSHHNIV
FT                   NNSMLIGQRLKMPTKTAEELRVVLPSPLYHCLGSVGGTMVSMMHGATLLLSFPSFNGKK
FT                   ALEAISREKGTLLYGTPTMFVDILNQPDFSSYDFTSIRGGVIAGSPAPPELIRAIINKM
FT                   NMKELVVVYGTTENSPVTFMNFPEDTLEQKAGSVGRIMPHTKAQIVNVETGELTNLNVP
FT                   GELYIRGYCVMQGYWGEPQKTFETVGQDKWYRTGDIASMDEQGFCKIVGRSKDMIIRGG
FT                   ENIYPAELEDFFLKHPQVQEAQVVGVKDKRMGEEICACIPLKSGETTTAEEIKAFCKGK
FT                   ISHFKIPRYIVFVEGYPLTISGKIQKFKLREQMEQHLKL"
FT   gene            complement(957982..958411)
FT                   /pseudo
FT                   /locus_tag="mCG_1032206"
FT                   /note="gene_id=mCG1032206.1"
FT   mRNA            complement(957982..958411)
FT                   /pseudo
FT                   /locus_tag="mCG_1032206"
FT                   /note="gene_id=mCG1032206.1 transcript_id=mCT149910.1
FT                   created on 28-MAR-2003"
FT   gene            complement(967036..>980890)
FT                   /locus_tag="mCG_144655"
FT                   /note="gene_id=mCG144655.0"
FT   mRNA            complement(join(967036..967367,968335..968382,
FT                   968843..969081,980754..>980890))
FT                   /locus_tag="mCG_144655"
FT                   /product="mCG144655"
FT                   /note="gene_id=mCG144655.0 transcript_id=mCT184079.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(967129..967367,968335..968382,
FT                   968843..>968942))
FT                   /codon_start=1
FT                   /locus_tag="mCG_144655"
FT                   /product="mCG144655"
FT                   /note="gene_id=mCG144655.0 transcript_id=mCT184079.0
FT                   protein_id=mCP105799.0"
FT                   /protein_id="EDL15538.1"
FT                   /translation="SETGDIHISSRRSKEKPSKAKHIKIRRLKKEYKPSKGKARTFSCI
FT                   NRTPAYSTELVPEQPGLHQETLSKKEEEEEEEEAAAAAAAAAAAAAAAREMAQQLRVLP
FT                   QDQGLIPSTYMVTYNCLYHQFQKI"
FT   gene            979925..1007522
FT                   /gene="Tiparp"
FT                   /locus_tag="mCG_13447"
FT                   /note="gene_id=mCG13447.1"
FT   mRNA            join(979925..980147,982742..983702,998210..998378,
FT                   999528..999688,1004539..1004814,1005121..1007522)
FT                   /gene="Tiparp"
FT                   /locus_tag="mCG_13447"
FT                   /product="TCDD-inducible poly(ADP-ribose) polymerase"
FT                   /note="gene_id=mCG13447.1 transcript_id=mCT11665.1 created
FT                   on 18-NOV-2002"
FT   CDS             join(982783..983702,998210..998378,999528..999688,
FT                   1004539..1004814,1005121..1005568)
FT                   /codon_start=1
FT                   /gene="Tiparp"
FT                   /locus_tag="mCG_13447"
FT                   /product="TCDD-inducible poly(ADP-ribose) polymerase"
FT                   /note="gene_id=mCG13447.1 transcript_id=mCT11665.1
FT                   protein_id=mCP18384.2"
FT                   /protein_id="EDL15537.1"
FT                   /translation="MEVETTEPEPDCVVQPPSPSDDFSCQMRISEKISPLKTCFKKKQE
FT                   QKRLGTGTLRSLRPILNTLLESGSLDGVFRARDQNRDESSLHEHIVKKPLEINPSCPPA
FT                   ENSMPVLIPDGTNVEGQLPEAHPSTDAPEQGVPIQDHSFPPETISGTVADSTTGHFQTD
FT                   LLHPVSGDVPTSPDCVDKVMDYVPGAFQDNSFTIQYILDTSDKLSTELFQDKSEEASLE
FT                   LVFELVNQLQYHTHQENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQS
FT                   VSNDSQEHLERFYCNPENDRMRMKYGGQDFWADLNAMTVFETTEFDQLRRLSTPPCSNS
FT                   NSIYHTFWKFFCRDHFGWREYPESVVRLIEEANSRGLKEVRFMMWNNHYILHNSFFRRE
FT                   IKRRPLFRSCFILIPYLQTLGGVPTQASLPLEATSSQIICPDGVTSANFYPETWVYMHP
FT                   SQDFIQVPVSAEDKSYRIIYNLFHKTVPEFKYRILQILRVQNQFLWEKYKRKKEYMNRK
FT                   MSGRDRIINERHLFHGTSQDVVDGICKHNFDPRVCGKHATMFGQGSYFAKKASYSHNFS
FT                   KKSSKGVHFMFLAKVLTGRYTMGSHGMRRPPPVNPGSVTSDLYDSCVDNFFEPQIFVIF
FT                   NDDQSYPYFVIQYEEVSNTVSI"
FT   gene            complement(1067698..1068448)
FT                   /pseudo
FT                   /locus_tag="mCG_1032244"
FT                   /note="gene_id=mCG1032244.1"
FT   mRNA            complement(1067698..1068448)
FT                   /pseudo
FT                   /locus_tag="mCG_1032244"
FT                   /note="gene_id=mCG1032244.1 transcript_id=mCT149948.1
FT                   created on 31-MAR-2003"
FT   gene            1119118..>1181947
FT                   /locus_tag="mCG_121055"
FT                   /note="gene_id=mCG121055.1"
FT   mRNA            join(1119118..1119473,1122252..1122340,1137147..1137361,
FT                   1180002..1180121,1181772..>1181947)
FT                   /locus_tag="mCG_121055"
FT                   /product="mCG121055"
FT                   /note="gene_id=mCG121055.1 transcript_id=mCT122251.1
FT                   created on 18-NOV-2002"
FT   CDS             join(1122293..1122340,1137147..1137361,1180002..1180121,
FT                   1181772..>1181947)
FT                   /codon_start=1
FT                   /locus_tag="mCG_121055"
FT                   /product="mCG121055"
FT                   /note="gene_id=mCG121055.1 transcript_id=mCT122251.1
FT                   protein_id=mCP65738.1"
FT                   /protein_id="EDL15536.1"
FT                   /translation="MDRHIPMHALPEEIQKMSPEETVCKYCGVSYLILHEFKAMEEKLK
FT                   AVQEEMKFYQGSVEREKKLQEKLQSLSQEFEQYKSDSESKKARVEDASIQLKKQQNGFQ
FT                   RVQKELGHLQLELKIKQKQSQVFSQRLSEYKYFWNKTLLLLTFTKRELTSIKYEIYDNF
FT                   QNWTSLKGEVFLQIKSISDTALA"
FT   gene            complement(1400642..>1412688)
FT                   /locus_tag="mCG_8564"
FT                   /note="gene_id=mCG8564.2"
FT   mRNA            complement(join(1400642..1401438,1402181..1402279,
FT                   1402387..1402498,1402752..1402893,1402986..1403090,
FT                   1403181..1403280,1404970..1405034,1405924..1406044,
FT                   1411343..1411452,1411991..1412065,1412298..>1412670))
FT                   /locus_tag="mCG_8564"
FT                   /product="mCG8564, transcript variant mCT7392"
FT                   /note="gene_id=mCG8564.2 transcript_id=mCT7392.1 created on
FT                   14-OCT-2002"
FT   mRNA            complement(join(1400646..1401438,1402181..1402279,
FT                   1402387..1402893,1402986..1403090,1403181..1405034,
FT                   1405924..1406044,1409694..1409766,1411343..1411452,
FT                   1411991..1412065,1412298..>1412688))
FT                   /locus_tag="mCG_8564"
FT                   /product="mCG8564, transcript variant mCT190993"
FT                   /note="gene_id=mCG8564.2 transcript_id=mCT190993.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(1401090..1401438,1402181..1402279,
FT                   1402387..1402498,1402752..1402893,1402986..1403090,
FT                   1403181..1403280,1404970..1405034,1405924..1406044,
FT                   1411343..1411452,1411991..1412065,1412298..>1412669))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8564"
FT                   /product="mCG8564, isoform CRA_b"
FT                   /note="gene_id=mCG8564.2 transcript_id=mCT7392.1
FT                   protein_id=mCP18404.1 isoform=CRA_b"
FT                   /protein_id="EDL15535.1"
FT                   /translation="VSLWVPAASGVRGARWNYGVRASPDLDRCRRRRRCRLRLVRRPER
FT                   GASSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLDLPSETD
FT                   LRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACINLASKIE
FT                   EAPRRIRDVINVFHHLRQLRGKRTPSPLILDQNYINTKNQVIKAERRVLKELGFCVHVK
FT                   HPHKIIVMYLQVLECERNQTLVQTAWNYMNDSLRTNVFVRFQPETIACACIYLAARALQ
FT                   IPLPTRPHWFLLFGTTEEEIQEICIETLRLYTRKKPNYELLEKEVEKRKVALQEAKLKA
FT                   KGLNLDGTPALSTLGGFSPASKPSSPREVKAEEKSPVSINVKTVKKEPEDRQQASKSPY
FT                   NGVRKDSKRSRTSRSASRSRSRTRSRSRSHSPRRHYNNRRSRSGTYSSRSRSRSRSHSE
FT                   SPRRHHNHGSPHLKAKHTREDLKSSNRHGHKRKKSRSRSQSKTRDHSDVTKKHRHERGH
FT                   HRDRRERSRSFERSHKGKHHGGSRSGHGRHRR"
FT   CDS             complement(join(1409736..1409766,1411343..1411452,
FT                   1411991..1412065,1412298..>1412687))
FT                   /codon_start=1
FT                   /locus_tag="mCG_8564"
FT                   /product="mCG8564, isoform CRA_a"
FT                   /note="gene_id=mCG8564.2 transcript_id=mCT190993.0
FT                   protein_id=mCP111953.0 isoform=CRA_a"
FT                   /protein_id="EDL15534.1"
FT                   /translation="RRGRWLVSLWVPAASGVRGARWNYGVRASPDLDRCRRRRRCRLRL
FT                   VRRPERGASSSGTTTTTTTTTGGILIGDRLYSEVSLTIDHSLIPEERLSPTPSMQDGLD
FT                   LPSETDLRILGCELIQAAGILLRLPQVAMATGQVLFHRFFYSKSFVKHSFEIVAMACIN
FT                   LASKIEEAPRRIRDVINVFHHLRQLRGKSDQLHLPKPG"
FT   gene            complement(1484101..1486034)
FT                   /locus_tag="mCG_8565"
FT                   /note="gene_id=mCG8565.2"
FT   mRNA            complement(join(1484101..1484523,1485750..1486034))
FT                   /locus_tag="mCG_8565"
FT                   /product="mCG8565"
FT                   /note="gene_id=mCG8565.2 transcript_id=mCT7393.2 created on
FT                   19-NOV-2002"
FT   CDS             complement(1484216..1484359)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8565"
FT                   /product="mCG8565"
FT                   /note="gene_id=mCG8565.2 transcript_id=mCT7393.2
FT                   protein_id=mCP18377.1"
FT                   /protein_id="EDL15533.1"
FT                   /translation="MEVPYSIIKGKARLGRMVHRKPYATVTFTQEDKGALVKLVEAIKE
FT                   QL"
FT   gene            complement(1510733..1723767)
FT                   /gene="Veph1"
FT                   /locus_tag="mCG_122317"
FT                   /note="gene_id=mCG122317.1"
FT   mRNA            complement(join(1510733..1511437,1515152..1515288,
FT                   1541248..1541365,1575052..1575186,1579294..1579433,
FT                   1611358..1611755,1612677..1612886,1625423..1625643,
FT                   1665828..1666037,1675763..1675929,1704045..1704219,
FT                   1714476..1714691,1723483..1723767))
FT                   /gene="Veph1"
FT                   /locus_tag="mCG_122317"
FT                   /product="ventricular zone expressed PH domain homolog 1
FT                   (zebrafish)"
FT                   /note="gene_id=mCG122317.1 transcript_id=mCT123534.1
FT                   created on 18-NOV-2002"
FT   CDS             complement(join(1511201..1511437,1515152..1515288,
FT                   1541248..1541365,1575052..1575186,1579294..1579433,
FT                   1611358..1611755,1612677..1612886,1625423..1625643,
FT                   1665828..1666037,1675763..1675929,1704045..1704219,
FT                   1714476..1714691,1723483..1723722))
FT                   /codon_start=1
FT                   /gene="Veph1"
FT                   /locus_tag="mCG_122317"
FT                   /product="ventricular zone expressed PH domain homolog 1
FT                   (zebrafish)"
FT                   /note="gene_id=mCG122317.1 transcript_id=mCT123534.1
FT                   protein_id=mCP65644.1"
FT                   /protein_id="EDL15531.1"
FT                   /translation="MEYEVYQLLRGFLSLTLTTDHGPGFTEIQLIQHTMHQLFRLVLGQ
FT                   KDLSKAGDLFSLDDAEIEDSLTEALEQIKVISSSLDYQTNNNDQAVVEICITRITTAIR
FT                   ETESIEKHARALVGLWDSCLEHNLRPAGKDEDTPHAKIASDIMSCILQNYNRTPVMVLA
FT                   VPIAVKFLHRGSKELCRNMSNYLSLAAITKADLLADHTEGIIKSILQGNAMLLRVLPAV
FT                   YEKQPQPINRHLAELLALMSQLEQTEQYHLLRLLHVAAKRKDVEVVQKCVPFLIRNLKD
FT                   STYNDIILNILIEIAGHEPLALNSFLPMLKEIAEQFPYLTGQMARIFGAVGHVDEERAR
FT                   SCLRYLVSQLANMEHPFHHILLLEIKSITDAFSSILGPHSRDIFRMSNSFTNIAKLLSR
FT                   QLENSKADSSRRKTSTEVSIPEKLRELNSMEPESEDHEKLQVKIQAFEDKINAESNTPG
FT                   SGRRYSLDHISKEERKSIRFSRSRSLALNTVLTNGVSVEDNEVEEKAGMHASISLSQID
FT                   PLSHGIGKLPFKTDTHGSPLRNSSASHPSIIHTEPETMPETFKENIQEEILEAATSPIE
FT                   YQDKLYLHLRENLSKVKAYALEIAKKVPIPDQCTIEDTMRSCVAKLFFTCSLKGHYCLY
FT                   SKSSFILVSQAPQPWIQVMFLSQQSLFPEPLSIQSGSVQFLKALWEKTQDTGAHSFEVA
FT                   MTESTFPQQKDLEQLQLHLEEVRFFDVFGFSETAGAWQCFMCNNPEKATVVNQDGQPLI
FT                   EGKLKEKQVRWKFIKRWKTHYFTLAGNQLLFQKGKSKDDPDDSPIELSKVQSVKAVAKK
FT                   RRDRSLPRAFEIFTDSKTYVFKAKDEKNAEEWLQCINVALAQAKERESREVTTYL"
FT   gene            1680315..1686156
FT                   /gene="Ptx3"
FT                   /locus_tag="mCG_8563"
FT                   /note="gene_id=mCG8563.1"
FT   mRNA            join(1680315..1680543,1681002..1681403,1684944..1686156)
FT                   /gene="Ptx3"
FT                   /locus_tag="mCG_8563"
FT                   /product="pentraxin related gene"
FT                   /note="gene_id=mCG8563.1 transcript_id=mCT7391.1 created on
FT                   14-OCT-2002"
FT   CDS             join(1680414..1680543,1681002..1681403,1684944..1685557)
FT                   /codon_start=1
FT                   /gene="Ptx3"
FT                   /locus_tag="mCG_8563"
FT                   /product="pentraxin related gene"
FT                   /note="gene_id=mCG8563.1 transcript_id=mCT7391.1
FT                   protein_id=mCP18403.2"
FT                   /protein_id="EDL15532.1"
FT                   /translation="MHLPAILLCALWSAVVAETSDDYELMYVNLDNEIDNGLHPTEDPT
FT                   PCDCRQEHSEWDKLFIMLENSQMREGMLLQATDDVLRGELQRLRAELGRLAGGMARPCA
FT                   AGGPADARLVRALEPLLQESRDASLRLARLEDAEARRPEATVPGLGAVLEELRRTRADL
FT                   SAVQSWVARHWLPAGCETAIFFPMRSKKIFGSVHPVRPMKLESFSTCIWVKATDVLNKT
FT                   ILFSYGTKWNPYEIQLYLSSQSLVLVVGGKENKLAADTVVSLGRWSHLCGTWSSEQGSM
FT                   SLWANGELVATTVEMAKSHSVPEGGLLQIGQEKNGCCVGGGFDESLAFSGRITGFNIWD
FT                   RVLSEEEIRASGGVESCHIRGNVVGWGVTEIQAHGGAQYVS"
FT   gene            complement(2425239..2433710)
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /note="gene_id=mCG4342.1"
FT   mRNA            complement(join(2425239..2425911,2427412..2427500,
FT                   2427821..2427878,2430154..2430362,2433177..2433710))
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, transcript variant
FT                   mCT181553"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT181553.0 created
FT                   on 26-MAR-2003"
FT   mRNA            complement(join(2425239..2425869,2427408..2427500,
FT                   2427821..2427878,2430154..2430362,2433177..2433710))
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, transcript variant
FT                   mCT2754"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT2754.2 created on
FT                   26-MAR-2003"
FT   mRNA            complement(join(2425239..2425875,2427412..2427500,
FT                   2427821..2427878,2430154..2430362,2433032..>2433107))
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, transcript variant
FT                   mCT190955"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT190955.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(2425618..2425911,2427412..2427500,
FT                   2427821..2427878,2430154..2430362,2433177..2433522))
FT                   /codon_start=1
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, isoform CRA_a"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT181553.0
FT                   protein_id=mCP104475.0 isoform=CRA_a"
FT                   /protein_id="EDL15528.1"
FT                   /translation="MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPGCVEP
FT                   GRDDRSSPAVRAAGGGGGAGGGGGGGGGGGGGAGGGGAGGGAGGGRSPVRELDMGAAER
FT                   SREPGSPRLTEVSPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETH
FT                   YPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPY
FT                   VNVGALRMPFQQDSHCNVTPLSFQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAPP
FT                   FGLPLATLAADSASAASVVAAAAAAKTTSKNSSIADLRLKAKKHAAALGL"
FT   CDS             complement(join(2425618..2425875,2427412..2427500,
FT                   2427821..2427878,2430154..2430362,2433032..>2433038))
FT                   /codon_start=1
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, isoform CRA_b"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT190955.0
FT                   protein_id=mCP111920.0 isoform=CRA_b"
FT                   /protein_id="EDL15529.1"
FT                   /translation="WRVSPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERL
FT                   FDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEAC
FT                   RVAPYVNVGALRMPFQQVQAQLQLDSAVAHAHHHLHPHLAAHAPYMMFPAPPFGLPLAT
FT                   LAADSASAASVVAAAAAAKTTSKNSSIADLRLKAKKHAAALGL"
FT   CDS             complement(join(2425646..2425869,2427408..2427500,
FT                   2427821..2427878,2430154..2430362,2433177..2433522))
FT                   /codon_start=1
FT                   /gene="Shox2"
FT                   /locus_tag="mCG_4342"
FT                   /product="short stature homeobox 2, isoform CRA_c"
FT                   /note="gene_id=mCG4342.1 transcript_id=mCT2754.2
FT                   protein_id=mCP18390.2 isoform=CRA_c"
FT                   /protein_id="EDL15530.1"
FT                   /translation="MEELTAFVSKSFDQKVKEKKEAITYREVLESGPLRGAKEPGCVEP
FT                   GRDDRSSPAVRAAGGGGGAGGGGGGGGGGGGGAGGGGAGGGAGGGRSPVRELDMGAAER
FT                   SREPGSPRLTEVSPELKDRKDDAKGMEDEGQTKIKQRRSRTNFTLEQLNELERLFDETH
FT                   YPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQENQLHKGVLIGAASQFEACRVAPY
FT                   VNVGALRMPFQQASAAAAGQRRGARAPPPASAPGRARALHDVPGTALRTAAGHAGRGLG
FT                   LGRLGGGRCRRRQDHQQELQHRGSQTES"
FT   gene            <2433372..2808633
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /note="gene_id=mCG4343.2"
FT   mRNA            join(<2433372..2433508,2534596..2534769,2631147..2631183,
FT                   2656744..2656795,2740372..2740445,2800153..2800259,
FT                   2805710..2805862,2806457..2808633)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT120907"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT120907.1 created
FT                   on 27-MAR-2003"
FT   mRNA            join(<2437481..2437646,2446397..2446592,2448345..2448470,
FT                   2534596..2534784,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800259,2806457..2808633)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT2752"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT2752.2 created on
FT                   27-MAR-2003"
FT   CDS             join(2437481..2437646,2446397..2446592,2448345..2448470,
FT                   2534596..2534773)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT2752.2
FT                   protein_id=mCP18385.2 isoform=CRA_e"
FT                   /protein_id="EDL15527.1"
FT                   /translation="MTIHSLGIPNGPAACIDALDSSAEAAWCWNQEGAELKLKQVLRTP
FT                   VAPWLEEGVPEMGRRSSDTEEESRSKRKKKHRRRSSSSSSSDSRTYSRKKGGRRPRSDS
FT                   RSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRSRSRGRGKPYRVQRSRSKSRTRR
FT                   SRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDKEKREKEKDKGKDKEVHSIKRG"
FT   mRNA            join(<2437556..2437686,2446397..2446592,2448345..2448470,
FT                   2534596..2534769,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800263,2805714..2805862,
FT                   2806457..2807191)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT190958"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190958.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2437565..2437686,2446397..2446592,2448345..2448470,
FT                   2631147..2631183,2656744..2656795,2740377..2740445,
FT                   2800153..2800259,2801940..2803958)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT190959"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190959.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<2437598..2437686,2446397..2446592,2448345..2448470,
FT                   2534596..2534769,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800259,2805710..2805862,
FT                   2806457..2808633)
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, transcript
FT                   variant mCT190957"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190957.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<2437632..2437686,2446397..2446592,2448345..2448470,
FT                   2534596..2534769,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800263,2805714..2805862,
FT                   2806457..2806549)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190958.0
FT                   protein_id=mCP111922.0 isoform=CRA_c"
FT                   /protein_id="EDL15525.1"
FT                   /translation="KRGFQVPTSGGANPKVEPEMGRRSSDTEEESRSKRKKKHRRRSSS
FT                   SSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRS
FT                   RSRGRGKPYRVQRSRSKSRTRRSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDK
FT                   EKREKEKDKGKDKEVHSIKRGDSGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKA
FT                   KERSEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKKVIEPSEVQH
FT                   VTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDDNSLAHPNLFIEKAEAEEKWFKRLI
FT                   ALRQERLMGSPVA"
FT   CDS             join(<2437632..2437686,2446397..2446592,2448345..2448470,
FT                   2534596..2534769,2631147..2631183,2656744..2656795,
FT                   2740377..2740445,2800153..2800259,2805710..2805862,
FT                   2806457..2806549)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190957.0
FT                   protein_id=mCP111921.0 isoform=CRA_b"
FT                   /protein_id="EDL15524.1"
FT                   /translation="KRGFQVPTSGGANPKVEPEMGRRSSDTEEESRSKRKKKHRRRSSS
FT                   SSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRS
FT                   RSRGRGKPYRVQRSRSKSRTRRSRSRPRPRSHSRSSERSSHRRTRSRSRDRDRRKVRDK
FT                   EKREKEKDKGKDKEVHSIKRGDSGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALKA
FT                   KERSEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKKAVEPSEVQH
FT                   VTAASGPASAAAEPPSTGKEIDPDSIPTAIKYQDDNSLAHPNLFIEKAEAEEKWFKRLI
FT                   ALRQERLMGSPVA"
FT   CDS             join(<2437632..2437686,2446397..2446592,2448345..2448470,
FT                   2631147..2631183,2656744..2656795,2740377..2740445,
FT                   2800153..2800259,2801940..2801996)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT190959.0
FT                   protein_id=mCP111923.0 isoform=CRA_d"
FT                   /protein_id="EDL15526.1"
FT                   /translation="KRGFQVPTSGGANPKVEPEMGRRSSDTEEESRSKRKKKHRRRSSS
FT                   SSSSDSRTYSRKKGGRRPRSDSRSWSRDRQLRSHSYERRRRRRSSSSSSYGSRRKRSRS
FT                   RSRGRGKPYRVQRSRSKSRTRRDSGNIKAGLEHLPPAEQAKARLQLVLEAAAKADEALK
FT                   AKERSEEEAKRRKEEDQATLVEQVKRVKEIEAIESDSFVQQTFRSSKDVKKVLGRHDGL
FT                   SSLHSNDYLC"
FT   CDS             join(<2656788..2656795,2740372..2740445,2800153..2800259,
FT                   2805710..2805862,2806457..2806549)
FT                   /codon_start=1
FT                   /gene="Rsrc1"
FT                   /locus_tag="mCG_4343"
FT                   /product="arginine/serine-rich coiled-coil 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4343.2 transcript_id=mCT120907.1
FT                   protein_id=mCP65849.1 isoform=CRA_a"
FT                   /protein_id="EDL15523.1"
FT                   /translation="SCCAAKADEALKAKERSEEEAKRRKEEDQATLVEQVKRVKEIEAI
FT                   ESDSFVQQTFRSSKDVKKAVEPSEVQHVTAASGPASAAAEPPSTGKEIDPDSIPTAIKY
FT                   QDDNSLAHPNLFIEKAEAEEKWFKRLIALRQERLMGSPVA"
FT   gene            2824441..2850217
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /note="gene_id=mCG4348.2"
FT   mRNA            join(2824441..2824561,2834792..2834939,2843059..2843194,
FT                   2844154..2844282,2845471..2845518)
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, transcript variant
FT                   mCT181551"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT181551.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(2824447..2824561,2834792..2834939,2841232..2841276,
FT                   2843111..2843194,2844154..2844282,2845471..2845630,
FT                   2848000..2848129,2849921..2850217)
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, transcript variant
FT                   mCT181550"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT181550.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(2824482..2824561,2834792..2834939,2843111..2843194,
FT                   2844154..2844282,2845471..2845630,2848000..2848129,
FT                   2849921..2850181)
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, transcript variant
FT                   mCT2736"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT2736.1 created on
FT                   26-MAR-2003"
FT   CDS             join(2824515..2824561,2834792..2834939,2841232..2841276,
FT                   2843111..2843194,2844154..2844282,2845471..2845630,
FT                   2848000..2848129,2849921..2850026)
FT                   /codon_start=1
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT181550.0
FT                   protein_id=mCP104473.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q8JZS2"
FT                   /db_xref="InterPro:IPR019376"
FT                   /db_xref="MGI:MGI:1341819"
FT                   /db_xref="UniProtKB/TrEMBL:Q8JZS2"
FT                   /protein_id="EDL15520.1"
FT                   /translation="MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSIS
FT                   DGRGRTHNRRERDDGEDSLTATSFSLVPFGRFGGMHADVNPFQTMDRMMANMRSGIQEL
FT                   QRNFGQLSMDPNGHSFCSSSVMTYSKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSD
FT                   SGLERMAVGHHIHDRGHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQNEVLKYK
FT                   SIGRSGNTGMRSVGHEHPGSRELKRREKIHRNSAIESGRRSNVFVDKLNVKGSPVKITK
FT                   K"
FT   CDS             join(2824515..2824561,2834792..2834939,2843111..2843194,
FT                   2844154..2844282,2845471..2845630,2848000..2848129,
FT                   2849921..2850026)
FT                   /codon_start=1
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT2736.1
FT                   protein_id=mCP18379.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q3V042"
FT                   /db_xref="InterPro:IPR019376"
FT                   /db_xref="MGI:MGI:1341819"
FT                   /db_xref="UniProtKB/TrEMBL:Q3V042"
FT                   /protein_id="EDL15522.1"
FT                   /translation="MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSIS
FT                   DGRGRTHNRRERDDGEDSLTHADVNPFQTMDRMMANMRSGIQELQRNFGQLSMDPNGHS
FT                   FCSSSVMTYSKVGDEPPKVFQASTQTRRAPGGVKETRKAMRDSDSGLERMAVGHHIHDR
FT                   GHVIRKSKNNKTGDEEVNQEFINMNESDAHAFDDEWQNEVLKYKSIGRSGNTGMRSVGH
FT                   EHPGSRELKRREKIHRNSAIESGRRSNVFVDKLNVKGSPVKITKK"
FT   CDS             join(2824515..2824561,2834792..2834939,2843059..2843079)
FT                   /codon_start=1
FT                   /gene="Mlf1"
FT                   /locus_tag="mCG_4348"
FT                   /product="myeloid leukemia factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG4348.2 transcript_id=mCT181551.0
FT                   protein_id=mCP104472.0 isoform=CRA_b"
FT                   /protein_id="EDL15521.1"
FT                   /translation="MFRMLSSSFEDDPFFADSFLAHRESMRNMMRSFSEPLGRDLLSIS
FT                   DGRGRTHNRRERDDGEDSLTKTYLHL"
FT   gene            2872533..2918954
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /note="gene_id=mCG4344.2"
FT   mRNA            join(2872533..2872735,2874063..2874215,2875768..2875900,
FT                   2877918..2878122,2880959..2881075,2882520..2882670,
FT                   2885973..2886127,2887191..2887275,2892097..2892234,
FT                   2893717..2893818,2896088..2896144,2898991..2899128,
FT                   2900306..2900388,2910225..2910387,2911884..2912028,
FT                   2915889..2916049,2916979..2917032,2917145..2917493)
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /product="G elongation factor, mitochondrial 1, transcript
FT                   variant mCT181552"
FT                   /note="gene_id=mCG4344.2 transcript_id=mCT181552.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(2872597..2872735,2874063..2874215,2875768..2875900,
FT                   2877918..2878122,2880959..2881075,2882520..2882674,
FT                   2885977..2886127,2887191..2887275,2892097..2892265,
FT                   2893727..2893818,2896088..2896144,2898991..2899128,
FT                   2900306..2900388,2910225..2910387,2911884..2912028,
FT                   2915889..2916049,2916979..2917032,2917145..2918954)
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /product="G elongation factor, mitochondrial 1, transcript
FT                   variant mCT2743"
FT                   /note="gene_id=mCG4344.2 transcript_id=mCT2743.2 created on
FT                   26-MAR-2003"
FT   CDS             join(2872652..2872735,2874063..2874215,2875768..2875900,
FT                   2877918..2878122,2880959..2881075,2882520..2882674,
FT                   2885977..2886127,2887191..2887275,2892097..2892265,
FT                   2893727..2893818,2896088..2896144,2898991..2899128,
FT                   2900306..2900388,2910225..2910387,2911884..2912028,
FT                   2915889..2916049,2916979..2917032,2917145..2917276)
FT                   /codon_start=1
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /product="G elongation factor, mitochondrial 1, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG4344.2 transcript_id=mCT2743.2
FT                   protein_id=mCP18400.2 isoform=CRA_b"
FT                   /protein_id="EDL15517.1"
FT                   /translation="MRLLRVAAALGRGPFPRVPAVLGWQGKQADWKTRRWCSSGPVPNE
FT                   KIRNIGISAHIDSGKTTLTERVLYYTGRIATMHEVKGKDGVGAVMDSMELERQRGITIQ
FT                   SAATYTMWKDININIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVSRQM
FT                   KRYNVPFLTFINKLDRMGSNPSRALQQMRSKLNHNAAFVQIPIGLEGDFKGIIDLIEER
FT                   AIYFDGDFGQIVRYDEIPAGLRAAAADHRQELIECVANSDEQLGELFLEEKIPSVSDLK
FT                   ATIRRATLSRSFTPVFLGSALKNKGVQPLLDAVLEYLPNPSEVQNYAILNQNDSKEKTK
FT                   ILMNPQRDDSHPFVGLAFKLEAGRFGQLTYVRNYQGELKKGSTIYNTRTGKKVRVQRLV
FT                   RMHADMMEASISAATRRREVYAGDICALFGIDCASGDTFTNKDNSDLSMESIHVPEPVI
FT                   SIAMRPSNKNDLEKFSKGIGRFTREDPTFKVHFDPESKETIVSGMGELHLEIYAQRMER
FT                   EYGCPCITGKPKVAFRETIVAPVPFDFTHKKQSGGAGQFGKVIGVLEPLPPEDYTKLEF
FT                   SDETFGSNVPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIR
FT                   AGEGALKQALANGTLCIIEPIMSVEVIAPNEFQGTVFAGINRRHGVITGQDGIEDYFTL
FT                   YADVPLNNMFGYSTELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKK
FT                   GKAKN"
FT   CDS             join(2872652..2872735,2874063..2874215,2875768..2875900,
FT                   2877918..2878122,2880959..2881075,2882520..2882670,
FT                   2885973..2886127,2887191..2887275,2892097..2892234,
FT                   2893717..2893818,2896088..2896144,2898991..2899128,
FT                   2900306..2900388,2910225..2910387,2911884..2912028,
FT                   2915889..2916049,2916979..2917032,2917145..2917276)
FT                   /codon_start=1
FT                   /gene="Gfm1"
FT                   /locus_tag="mCG_4344"
FT                   /product="G elongation factor, mitochondrial 1, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG4344.2 transcript_id=mCT181552.0
FT                   protein_id=mCP104474.0 isoform=CRA_a"
FT                   /protein_id="EDL15516.1"
FT                   /translation="MRLLRVAAALGRGPFPRVPAVLGWQGKQADWKTRRWCSSGPVPNE
FT                   KIRNIGISAHIDSGKTTLTERVLYYTGRIATMHEVKGKDGVGAVMDSMELERQRGITIQ
FT                   SAATYTMWKDININIIDTPGHVDFTIEVERALRVLDGAVLVLCAVGGVQCQTMTVSRQM
FT                   KRYNVPFLTFINKLDRMGSNPSRALQQMRSKLNHNAAFVQIPIGLEGDFKGIIDLIEER
FT                   AIYFDGDFGQIVRYDEIPAGLRAAAADHRQELIECVANSDEQLGELFLEEKIPSVSDLK
FT                   RAIRRATLSRSFTPVFLGSALKNKGVQPLLDAVLEYLPNPSEVQNYAILNQNDSKEKTK
FT                   ILMNPQRDDSHPFVGLAFKLEAGRFGQLTYVRNYQGELKKGSTIYNTRTGKKVRVQRLV
FT                   RMHADMMEDVEEVYAGDICALFGIDCASGDTFTNKDNSDLSMESIHVPEPVISIAMRPS
FT                   NKNDLEKFSKGIGRFTREDPTFKVHFDPESKETIVSGMGELHLEIYAQRMEREYGCPCI
FT                   TGKPKVAFRETIVAPVPFDFTHKKQSGGAGQFGKVIGVLEPLPPEDYTKLEFSDETFGS
FT                   NVPKQFVPAVEKGFLDACEKGPLSGHKLSGLRFVLQDGAHHMVDSNEISFIRAGEGALK
FT                   QALANGTLCIIEPIMSVEVIAPNEFQGTVFAGINRRHGVITGQDGIEDYFTLYADVPLN
FT                   NMFGYSTELRSCTEGKGEYTMEYCRYQPCSPSTQEELINKYLEATGQLPVKKGKAKN"
FT   gene            complement(2900415..2906289)
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /note="gene_id=mCG4347.1"
FT   mRNA            complement(join(2900415..2900745,2901012..2901074,
FT                   2903340..2903476,2903730..2903907,2904777..2904839,
FT                   2906004..2906231))
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /product="latexin, transcript variant mCT2735"
FT                   /note="gene_id=mCG4347.1 transcript_id=mCT2735.0 created on
FT                   26-MAR-2003"
FT   mRNA            complement(join(2900416..2900745,2901012..2901074,
FT                   2903730..2903907,2904777..2904839,2906004..2906289))
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /product="latexin, transcript variant mCT181549"
FT                   /note="gene_id=mCG4347.1 transcript_id=mCT181549.0 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(2900647..2900745,2901012..2901074,
FT                   2903340..2903476,2903730..2903907,2904777..2904839,
FT                   2906004..2906132))
FT                   /codon_start=1
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /product="latexin, isoform CRA_b"
FT                   /note="gene_id=mCG4347.1 transcript_id=mCT2735.0
FT                   protein_id=mCP18374.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q14BZ3"
FT                   /db_xref="InterPro:IPR009684"
FT                   /db_xref="MGI:MGI:107633"
FT                   /db_xref="UniProtKB/TrEMBL:Q14BZ3"
FT                   /protein_id="EDL15519.1"
FT                   /translation="MEIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDI
FT                   PGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDN
FT                   TFYQSLMSLKRPLEAQDIPDNFGNVSPQMKPVQHLAWVACGYVMWQNSTEDTWYKMLKI
FT                   QTVKQVQRNDDFIELDYTILLHDIASQEIIPWQMQVLWHPQYGTKVKHNSRLPKEGQAE
FT                   "
FT   CDS             complement(join(2901061..2901074,2903730..2903907,
FT                   2904777..2904839,2906004..2906132))
FT                   /codon_start=1
FT                   /gene="Lxn"
FT                   /locus_tag="mCG_4347"
FT                   /product="latexin, isoform CRA_a"
FT                   /note="gene_id=mCG4347.1 transcript_id=mCT181549.0
FT                   protein_id=mCP104471.0 isoform=CRA_a"
FT                   /protein_id="EDL15518.1"
FT                   /translation="MEIPPTHYAASRAASVAENCINYQQGTPHKLFLVQTVQQASKEDI
FT                   PGRGHKYHLKFSVEEIIQKQVTVNCTAEVLYPQMGQGSAPEVNFTFEGEIGKNPDEEDN
FT                   TFYQSLMSLKRPLEAQDIPAKKR"
FT   gene            complement(2921318..>2957975)
FT                   /locus_tag="mCG_4346"
FT                   /note="gene_id=mCG4346.1"
FT   mRNA            complement(join(2921318..2922038,2922118..2922180,
FT                   2927690..2927826,2933412..2933592,2938187..2938252,
FT                   2957522..2957653,2957667..>2957975))
FT                   /locus_tag="mCG_4346"
FT                   /product="mCG4346"
FT                   /note="gene_id=mCG4346.1 transcript_id=mCT2734.1 created on
FT                   18-NOV-2002"
FT   CDS             complement(join(2921889..2922038,2922118..2922180,
FT                   2927690..2927826,2933412..2933592,2938187..2938252,
FT                   2957522..2957653,2957667..2957975))
FT                   /codon_start=1
FT                   /locus_tag="mCG_4346"
FT                   /product="mCG4346"
FT                   /note="gene_id=mCG4346.1 transcript_id=mCT2734.1
FT                   protein_id=mCP18386.1"
FT                   /protein_id="EDL15515.1"
FT                   /translation="MGHDPLSRRRLLVLLLGQGGEEGRRPGGGGEWPPWPISVSTANRV
FT                   QGAQRQLSPSTQPRGPLPPVSMQPRQPPMPALLLSLWLLPSLALAAAVTEPADLEYTEP
FT                   AAVGLPRGILQLAARAALHFFNFRAGSPSALRVLATVQEGRAWVNPQEGCEVDLVFSTE
FT                   QYNPEQEGERLGKCSARVFFKNEKPRPAVNVTCARLFDKVKRQEKDYRLYKQMKQLKTP
FT                   LHSISIPDSHGHIDNSLRPLWDLAFLGSSYVMWEKTTQVLHYYLVQLSSVERLKTDDDS
FT                   IDFDFTVLLHEFSTQEIIPCRIHLVWYPGKPLKVNYHCQEQQSPEEASGTMEASAMAPP
FT                   EFGNF"
FT   gene            complement(3013604..3015860)
FT                   /locus_tag="mCG_147519"
FT                   /note="gene_id=mCG147519.0"
FT   mRNA            complement(join(3013604..3014230,3015825..3015860))
FT                   /locus_tag="mCG_147519"
FT                   /product="mCG147519"
FT                   /note="gene_id=mCG147519.0 transcript_id=mCT187782.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(3013826..3014008)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147519"
FT                   /product="mCG147519"
FT                   /note="gene_id=mCG147519.0 transcript_id=mCT187782.0
FT                   protein_id=mCP109363.0"
FT                   /protein_id="EDL15514.1"
FT                   /translation="MGEAVLPLVCCVVPSPPFCPHHLWQVGKLSKDLESGRTSLVPSWL
FT                   QHPGELVLHLAWTTG"
FT   gene            3025735..3047200
FT                   /gene="Mfsd1"
FT                   /locus_tag="mCG_4345"
FT                   /note="gene_id=mCG4345.1"
FT   mRNA            join(3025735..3025944,3027611..3027663,3028565..3028677,
FT                   3030268..3030310,3030885..3030952,3032798..3032906,
FT                   3035537..3035639,3037266..3037364,3037735..3037846,
FT                   3039136..3039192,3039561..3039717,3040995..3041092,
FT                   3042907..3043019,3043560..3043607,3044289..3044346,
FT                   3045662..3047200)
FT                   /gene="Mfsd1"
FT                   /locus_tag="mCG_4345"
FT                   /product="major facilitator superfamily domain containing
FT                   1"
FT                   /note="gene_id=mCG4345.1 transcript_id=mCT2738.2 created on
FT                   18-NOV-2002"
FT   CDS             join(3025785..3025944,3027611..3027663,3028565..3028677,
FT                   3030268..3030310,3030885..3030952,3032798..3032906,
FT                   3035537..3035639,3037266..3037364,3037735..3037846,
FT                   3039136..3039192,3039561..3039717,3040995..3041092,
FT                   3042907..3043019,3043560..3043607,3044289..3044346,
FT                   3045662..3045665)
FT                   /codon_start=1
FT                   /gene="Mfsd1"
FT                   /locus_tag="mCG_4345"
FT                   /product="major facilitator superfamily domain containing
FT                   1"
FT                   /note="gene_id=mCG4345.1 transcript_id=mCT2738.2
FT                   protein_id=mCP18378.2"
FT                   /protein_id="EDL15513.1"
FT                   /translation="MEDEDGEDRALLGGRREADSAVHGAPRALSALCDPSRLAHRLVVL
FT                   SLMCFLGFGSYFCYDNPAALQTQVKRDMQVNTTKFMLLYAWYSWPNVVLCFLGGFLIDR
FT                   IFGIRWGTVIFSCFVCIGQVIFALGGIFNAFWLMELGRFVFGIGGESLAVAQNTYAVSW
FT                   FKGKELNLVFGLQLSMARIGSTVNMNLMGWLYGKIEALLGSAGHMTLGVTLMIGCITCI
FT                   FSLICALALAYLDRRAEKILHKEQGKTGEVIKLRDIKDFSLPLILVFVICVCYYVAVFP
FT                   FIGLGKVFFMEKFRFSSQSASAINSIVYIISAPMSPLFGLLVDKTGKNIIWVLYAVAAT
FT                   LVSHMMLAFTFWNPWIAMCLLGFSYSLLACALWPMVAFIVPEHQLGTAYGFMQSIQNLG
FT                   LAVIAILAGMILDSKGYLLLEVFFIACVSLSLLAVVCLYLVNRAQGGNLNYSAKQRERM
FT                   KLSHPE"
FT   gene            complement(3048708..>3050812)
FT                   /locus_tag="mCG_48670"
FT                   /note="gene_id=mCG48670.2"
FT   mRNA            complement(join(3048708..3048937,3049021..>3050812))
FT                   /locus_tag="mCG_48670"
FT                   /product="mCG48670"
FT                   /note="gene_id=mCG48670.2 transcript_id=mCT48853.2 created
FT                   on 18-NOV-2002"
FT   CDS             complement(3049985..>3050566)
FT                   /codon_start=1
FT                   /locus_tag="mCG_48670"
FT                   /product="mCG48670"
FT                   /note="gene_id=mCG48670.2 transcript_id=mCT48853.2
FT                   protein_id=mCP39015.2"
FT                   /protein_id="EDL15512.1"
FT                   /translation="RCKLASRVDTVASKVQTAVTMKGVTKNMAQVTKALDKALSAMDLQ
FT                   KVSAVMDRFEQQVQNLDVYTSVMEDSVSSATMLTTPQEQVDSLIVQIAEENGLEVLDQL
FT                   SQLPEGASAVGESSVRSQEDQLSRRLAALRNQHVHGRCCLPCPMMFWRLLPNCASLSPT
FT                   LRSCLGSFPTCQAGALELSLRLGSRSLSWY"
FT   gene            <3332996..3497137
FT                   /gene="D230050A05"
FT                   /locus_tag="mCG_144654"
FT                   /note="gene_id=mCG144654.0"
FT   mRNA            join(<3332996..3333098,3481881..3481945,3487782..3487862,
FT                   3495807..3497137)
FT                   /gene="D230050A05"
FT                   /locus_tag="mCG_144654"
FT                   /product="hypothetical protein LOC208426"
FT                   /note="gene_id=mCG144654.0 transcript_id=mCT184078.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<3332997..3333098,3481881..3481945,3487782..3487862,
FT                   3495807..3495984)
FT                   /codon_start=1
FT                   /gene="D230050A05"
FT                   /locus_tag="mCG_144654"
FT                   /product="hypothetical protein LOC208426"
FT                   /note="gene_id=mCG144654.0 transcript_id=mCT184078.0
FT                   protein_id=mCP105800.0"
FT                   /protein_id="EDL15511.1"
FT                   /translation="TVTPGSVLPRNTVRQPLIQSPLTCRCSRNFKMRLEELKRLQNPLE
FT                   QVDDGKYLLENHQLAMDVENNIENYPLSLQPLESKVKIIQRAWREYLQRQDPLEKRSPS
FT                   PPSVSSDKLSSSVSMNTFSDSSTPVSVSRPLAWTVLH"
FT   gene            3942164..>3943932
FT                   /locus_tag="mCG_52724"
FT                   /note="gene_id=mCG52724.2"
FT   mRNA            join(3942164..3942279,3943248..>3943932)
FT                   /locus_tag="mCG_52724"
FT                   /product="mCG52724"
FT                   /note="gene_id=mCG52724.2 transcript_id=mCT52907.2 created
FT                   on 18-NOV-2002"
FT   CDS             3943266..>3943932
FT                   /codon_start=1
FT                   /locus_tag="mCG_52724"
FT                   /product="mCG52724"
FT                   /note="gene_id=mCG52724.2 transcript_id=mCT52907.2
FT                   protein_id=mCP39036.2"
FT                   /protein_id="EDL15510.1"
FT                   /translation="MDLGSDAGSSSSSRASSQSNSTKVTPCSECKSSSSPGGSLDLVSA
FT                   LEDYEEPFPVYQKKVIDEWAPEEDGEEEEEEDDRGYRDDGCPAREPGDVSARIGSSGSG
FT                   SRSAATTMPSPMPNGNLHPHDPQDLRHNGNVVVAGRPNASRVPRRPIQKTQPPGSRRGG
FT                   RNRASGGLCLQPPDGGTRVPEEPPAPPMDWEALEKHLAGLQFREQEVRNQGQARTNSTS
FT                   "
FT   gene            <4021073..4075073
FT                   /gene="Schip1"
FT                   /locus_tag="mCG_15117"
FT                   /note="gene_id=mCG15117.2"
FT   mRNA            join(<4021073..4021323,4044815..4044933,4065060..4065177,
FT                   4066231..4066428,4067216..4067339,4069593..4069686,
FT                   4074421..4075073)
FT                   /gene="Schip1"
FT                   /locus_tag="mCG_15117"
FT                   /product="schwannomin interacting protein 1"
FT                   /note="gene_id=mCG15117.2 transcript_id=mCT12852.2 created
FT                   on 03-SEP-2002"
FT   CDS             join(<4021174..4021323,4044815..4044933,4065060..4065177,
FT                   4066231..4066428,4067216..4067339,4069593..4069686,
FT                   4074421..4074472)
FT                   /codon_start=1
FT                   /gene="Schip1"
FT                   /locus_tag="mCG_15117"
FT                   /product="schwannomin interacting protein 1"
FT                   /note="gene_id=mCG15117.2 transcript_id=mCT12852.2
FT                   protein_id=mCP18396.2"
FT                   /protein_id="EDL15509.1"
FT                   /translation="SAGSPCLTRAFSRACGCSALSLRSLAQQSSFGVCVLGCSEMVHQE
FT                   NCSYQAQKNERESIRQKLALGSFFDDGPGIYTSCSKSGKPSLSARLQSGMNLQICFVND
FT                   SGSDKDSDADDSKTETSLDTPLSPMSKQSSSYSDRDTTEEESESLDDMDFLTRQKKLQA
FT                   EAKMALAMAKPMAKMQVEVEKQNRKKSPVADLLPHMPHISECLMKRSLKPTDLRDMTIG
FT                   QLQVIVNDLHSQIESLNEELVQLLLIRDELHTEQDAMLVDIEDLTRHAESQQKHMAEKM
FT                   PAK"
FT   gene            4136922..4144826
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /note="gene_id=mCG15114.2"
FT   mRNA            join(4136922..4137019,4137769..4137844,4138301..4138434,
FT                   4140439..4140552,4141468..4141509,4141583..4141624,
FT                   4141715..4141858,4144173..4144803)
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, transcript variant mCT181511"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT181511.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(4137702..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141509,4141583..4141624,4141715..4141858,
FT                   4144173..4144826)
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, transcript variant mCT10117"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT10117.2 created
FT                   on 26-MAR-2003"
FT   mRNA            join(<4137805..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141624,4141715..4141858,4144173..4144369)
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, transcript variant mCT190970"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT190970.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<4137805..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141554)
FT                   /codon_start=1
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, isoform CRA_b"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT190970.0
FT                   protein_id=mCP111879.0 isoform=CRA_b"
FT                   /protein_id="EDL15508.1"
FT                   /translation="SSSQCRSSMCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQS
FT                   RNLLKTTDDMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATR
FT                   ETSSTTVSKHSKGSFPMTDS"
FT   CDS             join(4137829..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141509,4141583..4141624,4141715..4141858,
FT                   4144173..4144328)
FT                   /codon_start=1
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, isoform CRA_a"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT10117.2
FT                   protein_id=mCP18399.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q549G3"
FT                   /db_xref="InterPro:IPR004281"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:96539"
FT                   /db_xref="UniProtKB/TrEMBL:Q549G3"
FT                   /protein_id="EDL15506.1"
FT                   /translation="MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTD
FT                   DMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRG
FT                   SCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELM
FT                   QSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA"
FT   CDS             join(4137829..4137844,4138301..4138434,4140439..4140552,
FT                   4141468..4141509,4141583..4141624,4141715..4141858,
FT                   4144173..4144328)
FT                   /codon_start=1
FT                   /gene="Il12a"
FT                   /locus_tag="mCG_15114"
FT                   /product="interleukin 12a, isoform CRA_a"
FT                   /note="gene_id=mCG15114.2 transcript_id=mCT181511.0
FT                   protein_id=mCP104433.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q549G3"
FT                   /db_xref="InterPro:IPR004281"
FT                   /db_xref="InterPro:IPR009079"
FT                   /db_xref="InterPro:IPR012351"
FT                   /db_xref="MGI:MGI:96539"
FT                   /db_xref="UniProtKB/TrEMBL:Q549G3"
FT                   /protein_id="EDL15507.1"
FT                   /translation="MCQSRYLLFLATLALLNHLSLARVIPVSGPARCLSQSRNLLKTTD
FT                   DMVKTAREKLKHYSCTAEDIDHEDITRDQTSTLKTCLPLELHKNESCLATRETSSTTRG
FT                   SCLPPQKTSLMMTLCLGSIYEDLKMYQTEFQAINAALQNHNHQQIILDKGMLVAIDELM
FT                   QSLNHNGETLRQKPPVGEADPYRVKMKLCILLHAFSTRVVTINRVMGYLSSA"
FT   gene            complement(4188763..>4190301)
FT                   /locus_tag="mCG_1032467"
FT                   /note="gene_id=mCG1032467.0"
FT   mRNA            complement(join(4188763..4189342,4190222..>4190301))
FT                   /locus_tag="mCG_1032467"
FT                   /product="mCG1032467"
FT                   /note="gene_id=mCG1032467.0 transcript_id=mCT150171.0
FT                   created on 27-MAR-2003"
FT   CDS             complement(4188921..>4189106)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032467"
FT                   /product="mCG1032467"
FT                   /note="gene_id=mCG1032467.0 transcript_id=mCT150171.0
FT                   protein_id=mCP65633.0"
FT                   /protein_id="EDL15505.1"
FT                   /translation="DLTSSSTSRRRTERARLDLAWTFETPKPTLSDIPPPRRPHLLILP
FT                   NSPSAGNQLLKRLCRN"
FT   gene            <4274980..4276876
FT                   /locus_tag="mCG_15115"
FT                   /note="gene_id=mCG15115.0"
FT   mRNA            join(<4274980..4275831,4276020..4276876)
FT                   /locus_tag="mCG_15115"
FT                   /product="mCG15115"
FT                   /note="gene_id=mCG15115.0 transcript_id=mCT10118.1 created
FT                   on 18-NOV-2002"
FT   CDS             join(<4275747..4275831,4276020..4276387)
FT                   /codon_start=1
FT                   /locus_tag="mCG_15115"
FT                   /product="mCG15115"
FT                   /note="gene_id=mCG15115.0 transcript_id=mCT10118.1
FT                   protein_id=mCP18394.1"
FT                   /protein_id="EDL15504.1"
FT                   /translation="EIHAENMWRCLRQSFFFFFFLKIYLFIIWSYRRLRLIEDCNPVLK
FT                   RYAKEGGEFDYVISDLTVVPISTSPEEDCTWEFLRLIVDLSVKVLKQDGKYFTQGNCVN
FT                   LTEALSLYGEQLGRLYCPVEFSKEIICVPSYLELCVFYTVWKKVKP"
FT   gene            complement(4296877..4299230)
FT                   /locus_tag="mCG_147524"
FT                   /note="gene_id=mCG147524.0"
FT   mRNA            complement(4296877..4299230)
FT                   /locus_tag="mCG_147524"
FT                   /product="mCG147524"
FT                   /note="gene_id=mCG147524.0 transcript_id=mCT187787.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(4298443..4298949)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147524"
FT                   /product="mCG147524"
FT                   /note="gene_id=mCG147524.0 transcript_id=mCT187787.0
FT                   protein_id=mCP109369.0"
FT                   /protein_id="EDL15503.1"
FT                   /translation="MAKSTSRMSSPESLRTNQPTLSRKAWSGSLQQRTAVALAESQQRS
FT                   RSPHASSAQPPPPREGATNASANSSSSGSSGGGAGATDRPSAVTPGPHMAGADLRWRPG
FT                   PRGSELRLAPALRWVPRAPPPAPRLPAARAVLTWPRWGGRRSPGRARRLREAAAAHRCR
FT                   RLGSL"
FT   gene            complement(4321460..4428666)
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /note="gene_id=mCG120371.1"
FT   mRNA            complement(join(4321460..4323129,4327433..4327556,
FT                   4338664..4338836,4338946..4339035,4340144..4340315,
FT                   4342009..4342156,4342542..4342677,4351859..4351923,
FT                   4354954..4355117,4359979..4360053,4364220..4364338,
FT                   4374451..4374630,4386274..4386411,4387717..4387806,
FT                   4391941..4392050,4409522..4409590,4411991..4412101,
FT                   4414849..4415076,4418610..4418689,4428555..4428666))
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas), transcript variant mCT121560"
FT                   /note="gene_id=mCG120371.1 transcript_id=mCT121560.1
FT                   created on 18-NOV-2002"
FT   CDS             complement(join(4323019..4323129,4327433..4327556,
FT                   4338664..4338836,4338946..4339035,4340144..4340315,
FT                   4342009..4342156,4342542..4342677,4351859..4351923,
FT                   4354954..4355117,4359979..4360053,4364220..4364338,
FT                   4374451..4374630,4386274..4386411,4387717..4387806,
FT                   4391941..4392050,4409522..4409549))
FT                   /codon_start=1
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas), isoform CRA_a"
FT                   /note="gene_id=mCG120371.1 transcript_id=mCT121560.1
FT                   protein_id=mCP65466.1 isoform=CRA_a"
FT                   /protein_id="EDL15500.1"
FT                   /translation="MLRSTLAQQGTPVYSVAWGPDSEKVLYTAGKQLIIKPLQPNAKVL
FT                   QWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYGSQPHEHPITSVAWAPDG
FT                   ELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQIAGACGNGHVVFAHVVE
FT                   QRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASLNHAHLVVSTSLQCYVFS
FT                   TKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEGRFISSPKFPGMRTDILN
FT                   AQTVSLSNDTIAIKDKADEKIIFLFEASTGKPLGDGKLLSHKNEISEIALDQKGLTNDR
FT                   KIAFIDKNRDLYITSVKRFGKEEQIIKLGTMVHTLAWCDTCNILCGIQDTRFTVWYYPN
FT                   TIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHISISPYPAILHEY
FT                   VSSSKWEEAVRLCRFVKEQSMWACLAAMAVANRDMVTAEIAYAAVGEIDKVRYINAIKD
FT                   LPSRESKMAHILMFSGNIQEAETVLLQAGLVYQAIQININLYNWERALELAVKYKTHVD
FT                   TVLAYRQKFLDTFGKQETNKRYLQYAEGLQIDWEKIKAKIEMEITKERDRSSSGQSSKS
FT                   VGLKH"
FT   mRNA            complement(join(4341497..4342677,4354954..4355117,
FT                   4359979..4360053,4364220..4364338,4374451..4374630,
FT                   4386274..4386411,4387717..4387806,4391941..4392050,
FT                   4409522..4409590,4411991..4412101,4414849..4415076,
FT                   4418610..4418689,4428555..>4428621))
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas), transcript variant mCT190928"
FT                   /note="gene_id=mCG120371.1 transcript_id=mCT190928.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(4342673..4342677,4354954..4355117,
FT                   4359979..4360053,4364220..4364338,4374451..4374630,
FT                   4386274..4386411,4387717..4387806,4391941..4392050,
FT                   4409522..4409590,4411991..4412101,4414849..4415076,
FT                   4418610..>4418634))
FT                   /codon_start=1
FT                   /gene="Ift80"
FT                   /locus_tag="mCG_120371"
FT                   /product="intraflagellar transport 80 homolog
FT                   (Chlamydomonas), isoform CRA_b"
FT                   /note="gene_id=mCG120371.1 transcript_id=mCT190928.0
FT                   protein_id=mCP111874.0 isoform=CRA_b"
FT                   /protein_id="EDL15501.1"
FT                   /translation="RYLSQRNQTSHQELVSCVGWTTAEELYSCSDDHQIVKWNLLTSET
FT                   SLIVKLPDDIYPIDLHWFPKSLGIKKQTQAESFVLTSSDGKFHLISKLGRVEKSVEAHC
FT                   GAVLAGRWNYEGTALVTVGEDGQVKIWSKTGMLRSTLAQQGTPVYSVAWGPDSEKVLYT
FT                   AGKQLIIKPLQPNAKVLQWKAHDGIILKVDWNSVNDLILSAGEDCKYKVWDSYGRVLYG
FT                   SQPHEHPITSVAWAPDGELFAVGSFHTLRLCDKTGWSYALEKPNTGSIFNIAWSIDGTQ
FT                   IAGACGNGHVVFAHVVEQRWEWKNFQVTLTKRRTMQVRNVLNDAVDLLEFRDRVIKASL
FT                   NHAHLVVSTSLQCYVFSTKNWNTPLIFDLKEGTVSLILQAERHFLLVDGGGIYLHSYEG
FT                   RFISSPKFPGMRTDILNAQTVSLSNDTIAIKDKADEKK"
FT   gene            <4376109..>4376793
FT                   /locus_tag="mCG_1032464"
FT                   /note="gene_id=mCG1032464.0"
FT   mRNA            join(<4376109..4376182,4376279..4376414,4376468..>4376793)
FT                   /locus_tag="mCG_1032464"
FT                   /product="mCG1032464"
FT                   /note="gene_id=mCG1032464.0 transcript_id=mCT150168.0
FT                   created on 28-MAR-2003"
FT   CDS             join(<4376288..4376414,4376468..4376793)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032464"
FT                   /product="mCG1032464"
FT                   /note="gene_id=mCG1032464.0 transcript_id=mCT150168.0
FT                   protein_id=mCP65615.0"
FT                   /protein_id="EDL15502.1"
FT                   /translation="YRQVPASPCNYLRMCNSIAPPLPLINTSPFACIAPSIPLISICTS
FT                   PFACVFKPWAWLIHFGVLIQLQNGFRVVIRTRPSSLSTPHLVIRRRSPRDPRITGPAGQ
FT                   VTSASQVLGLKLNNFLSLSILDSRKESFCFVVYSLWFLTKLVLHQT"
FT   gene            4428901..>4455990
FT                   /gene="Smc4"
FT                   /locus_tag="mCG_120372"
FT                   /note="gene_id=mCG120372.0"
FT   mRNA            join(4428901..4429213,4430129..4430336,4431312..4431490,
FT                   4432052..4432243,4433617..4433793,4440225..4440389,
FT                   4440758..4440885,4442177..4442317,4443272..4443422,
FT                   4446326..4446559,4448242..4448427,4449901..4450062,
FT                   4451553..4451778,4451879..4451958,4452506..4452658,
FT                   4453462..4453588,4454300..4454489,4455487..4455631,
FT                   4455816..>4455990)
FT                   /gene="Smc4"
FT                   /locus_tag="mCG_120372"
FT                   /product="structural maintenance of chromosomes 4"
FT                   /note="gene_id=mCG120372.0 transcript_id=mCT121561.0
FT                   created on 18-NOV-2002"
FT   CDS             join(4430204..4430336,4431312..4431490,4432052..4432243,
FT                   4433617..4433793,4440225..4440389,4440758..4440885,
FT                   4442177..4442317,4443272..4443422,4446326..4446559,
FT                   4448242..4448427,4449901..4450062,4451553..4451778,
FT                   4451879..4451958,4452506..4452658,4453462..4453588,
FT                   4454300..4454489,4455487..4455631,4455816..>4455990)
FT                   /codon_start=1
FT                   /gene="Smc4"
FT                   /locus_tag="mCG_120372"
FT                   /product="structural maintenance of chromosomes 4"
FT                   /note="gene_id=mCG120372.0 transcript_id=mCT121561.0
FT                   protein_id=mCP65482.1"
FT                   /protein_id="EDL15499.1"
FT                   /translation="MRRKGTKPSTACHQEEGPPPSQDGAHSDEEMEQPAGEAESAAPAK
FT                   PPGEELDNRSLEEILNSIPPPPPPAMASEAGAPRLMITHIVNQNFKSYAGEKVLGPFHK
FT                   RFSCIIGPNGSGKSNVIDSMLFVFGYRAQKIRSKKLSVLIHNSDEHKDIQSCTVEVHFQ
FT                   KIIDKEGDDYEVLPNSNFYVSRTAYRDSTSVYHISGKKKTFKDVGNLLRSHGIDLDHNR
FT                   FLILQGEVEQIAMMKPKGQTEHDEGMLEYLEDIIGCGRLNEPIKVLCRRVEILNEHRGE
FT                   KLNRVKMVEKEKDALEGEKNIAIEFLTLENEMFKKKNHICQYYIYDLQNRIAEITTQKE
FT                   KIHEDTKEITEKSNVLSNEMKAKNSAVKDVEKKLNKVTKFIEQNKEKFTQLDLEDVQVR
FT                   EKLKHATSKAKKLEKQLQKDKEKIQEKELMGFNKSVNEARSKMEVAQSELDIYLSRHNT
FT                   AVSQLSKAKEALITASETLKERKAAIKDINTKLPQTQQELKEKEKELQKLTQEEINLKS
FT                   LVHDLFQKVEEAKSSLAMNRSRGKVLDAIIQEKKSGRIPGIYGRLGDLGAIDEKYDIAI
FT                   SSCCHALDYIVVDSIDTAQECVNFLKKHNIGIATFIGLDKMTVWAKKMSKIQTPENTPR
FT                   LFDLVKVKNEEIRQAFYFALRDTLVANNLDQATRVAYQRDRRWRVVTLQGQIIEQSGTM
FT                   SGGGSKVMRGRMGSSVIDEISVEEVNKMESQLERHSKQAMQIQEQKVQHEEAVVKLRHS
FT                   ERDMRNTLEKFAASIQGLSEQEEYLCVQIKELEANVLTTAPDRKQQKLLEENVSVFKKE
FT                   YDAVAEKAGKVEAEIKRLHNTIIDINNRKLKAQQNKLDTINKQLDECASAITKAQVAIK
FT                   TADRNLKKAQDSVCRTEKEIKDTEKEINDLKTELKNIEDKAEEVINNTKTAETSLPEIQ
FT                   KEHRNLLQELKVIQENEHALQKDALSIKLKLEQIDGHISEHNSKIKYWQKE"
FT   gene            complement(4494726..4549973)
FT                   /gene="Kpna4"
FT                   /locus_tag="mCG_4359"
FT                   /note="gene_id=mCG4359.2"
FT   mRNA            complement(join(4494726..4496696,4499287..4499381,
FT                   4502368..4502530,4504148..4504219,4507039..4507143,
FT                   4508678..4508806,4510450..4510581,4512769..4512813,
FT                   4512901..4513070,4515809..4515895,4517651..4517736,
FT                   4518381..4518476,4523915..4523967,4524065..4524094,
FT                   4524204..4524293,4525067..4525111,4549612..4549973))
FT                   /gene="Kpna4"
FT                   /locus_tag="mCG_4359"
FT                   /product="karyopherin (importin) alpha 4"
FT                   /note="gene_id=mCG4359.2 transcript_id=mCT3111.2 created on
FT                   29-NOV-2004"
FT   CDS             complement(join(4496598..4496696,4499287..4499381,
FT                   4502368..4502530,4504148..4504219,4507039..4507143,
FT                   4508678..4508806,4510450..4510581,4512769..4512813,
FT                   4512901..4513070,4515809..4515895,4517651..4517736,
FT                   4518381..4518476,4523915..4523967,4524065..4524094,
FT                   4524204..4524293,4525067..4525111,4549612..4549680))
FT                   /codon_start=1
FT                   /gene="Kpna4"
FT                   /locus_tag="mCG_4359"
FT                   /product="karyopherin (importin) alpha 4"
FT                   /note="gene_id=mCG4359.2 transcript_id=mCT3111.2
FT                   protein_id=mCP18393.1"
FT                   /db_xref="GOA:Q4FJX1"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR002652"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR024931"
FT                   /db_xref="MGI:MGI:1100848"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJX1"
FT                   /protein_id="EDL15498.1"
FT                   /translation="MADNEKLDNQRLKNFKNKGRDLETMRRQRNEVVVELRKNKRDEHL
FT                   LKRRNVPQEDICEDSDIDGDYRVQNTSLEAIVQNASSDNQGIQLSAVQAARKLLSSDRN
FT                   PPIDDLIKSGILPILVHCLERDDNPSLQFEAAWALTNIASGTSEQTQAVVQSNAVPLFL
FT                   RLLHSPHQNVCEQAVWALGNIIGDGPQCRDYVISLGVVKPLLSFISPSIPITFLRNVTW
FT                   VMVNLCRHKDPPPPMETIQEILPALCVLIHHTDVNILVDTVWALSYLTDAGNEQIQMVI
FT                   DSGIVPHLVPLLSHQEVKVQTAALRAVGNIVTGTDEQTQVVLNCDALSHFPALLTHPKE
FT                   KINKEAVWFLSNITAGNQQQVQAVIDANLVPMIIHLLDKGDFGTQKEAAWAISNLTISG
FT                   RKDQVAYLIQQNVIPPFCNLLTVKDAQVVQVVLDGLSNILKMAEDQAETIANLIEECGG
FT                   LEKIEQLQNHENEDIYKLAYEIIDQFFSSDDIDEDPSLVPESVQGGTFGFNSSTNVPTE
FT                   GFQF"
FT   gene            complement(4854498..4855861)
FT                   /pseudo
FT                   /locus_tag="mCG_1032236"
FT                   /note="gene_id=mCG1032236.1"
FT   mRNA            complement(4854498..4855861)
FT                   /pseudo
FT                   /locus_tag="mCG_1032236"
FT                   /note="gene_id=mCG1032236.1 transcript_id=mCT149940.1
FT                   created on 28-MAR-2003"
FT   gene            4921238..4979458
FT                   /gene="Ppm1l"
FT                   /locus_tag="mCG_4352"
FT                   /note="gene_id=mCG4352.1"
FT   mRNA            join(4921238..4921414,4973414..4973575,4976890..4978088,
FT                   4978440..4979458)
FT                   /gene="Ppm1l"
FT                   /locus_tag="mCG_4352"
FT                   /product="protein phosphatase 1 (formerly 2C)-like"
FT                   /note="gene_id=mCG4352.1 transcript_id=mCT3121.1 created on
FT                   18-NOV-2002"
FT   CDS             join(4921378..4921414,4973414..4973575,4976890..4977236)
FT                   /codon_start=1
FT                   /gene="Ppm1l"
FT                   /locus_tag="mCG_4352"
FT                   /product="protein phosphatase 1 (formerly 2C)-like"
FT                   /note="gene_id=mCG4352.1 transcript_id=mCT3121.1
FT                   protein_id=mCP18375.2"
FT                   /protein_id="EDL15497.1"
FT                   /translation="MLEKLTVSYDEAGTTCLIALLSDKDLTVANVGDSRGVLCDKDGNA
FT                   IPLSHDHKPYQLKERKRIKRAGGFISFNGSWRVQGILAMSRSLGDYPLKNLNVVIPDPD
FT                   ILTFDLDKLQPEFMILASDGLWDAFSNEEAVRFIKERLDEPHFGAKSIVLQSFYRGCPD
FT                   NITVMVVKFRNSSKTEEH"
FT   gene            complement(4990544..4991638)
FT                   /pseudo
FT                   /locus_tag="mCG_4354"
FT                   /note="gene_id=mCG4354.2"
FT   mRNA            complement(4990544..4991638)
FT                   /pseudo
FT                   /locus_tag="mCG_4354"
FT                   /note="gene_id=mCG4354.2 transcript_id=mCT3116.2 created on
FT                   26-JUN-2003"
FT   gene            complement(<4998019..5019393)
FT                   /gene="B3galnt1"
FT                   /locus_tag="mCG_4357"
FT                   /note="gene_id=mCG4357.1"
FT   mRNA            complement(join(<4998019..4999048,5002427..5002492,
FT                   5019220..5019393))
FT                   /gene="B3galnt1"
FT                   /locus_tag="mCG_4357"
FT                   /product="UDP-GalNAc:betaGlcNAc beta
FT                   1,3-galactosaminyltransferase, polypeptide 1"
FT                   /note="gene_id=mCG4357.1 transcript_id=mCT3114.1 created on
FT                   30-AUG-2002"
FT   CDS             complement(4998019..4999014)
FT                   /codon_start=1
FT                   /gene="B3galnt1"
FT                   /locus_tag="mCG_4357"
FT                   /product="UDP-GalNAc:betaGlcNAc beta
FT                   1,3-galactosaminyltransferase, polypeptide 1"
FT                   /note="gene_id=mCG4357.1 transcript_id=mCT3114.1
FT                   protein_id=mCP18392.0"
FT                   /protein_id="EDL15496.1"
FT                   /translation="MAPAVLTALPNRMSLRSLKWSLLLLSLLSFLVIWYLSLPHYNVIE
FT                   RVNWMYFYEYEPIYRQDFRFTLREHSNCSHQNPFLVILVTSRPSDVKARQAIRVTWGEK
FT                   KSWWGYEVLTFFLLGQQAEREDKTLALSLEDEHVLYGDIIRQDFLDTYNNLTLKTIMAF
FT                   RWVMEFCPNAKYIMKTDTDVFINTGNLVKYLLNLNHSEKFFTGYPLIDNYSYRGFFHKN
FT                   HISYQEYPFKVFPPYCSGLGYIMSGDLVPRVYEMMSHVKPIKFEDVYVGICLNLLKVDI
FT                   HIPEDTNLFFLYRIHLDVCQLRRVIAAHGFSSKEIITFWQVMLRNTTCHY"
FT   gene            complement(5092458..5092984)
FT                   /locus_tag="mCG_4355"
FT                   /note="gene_id=mCG4355.0"
FT   mRNA            complement(5092458..5092984)
FT                   /locus_tag="mCG_4355"
FT                   /product="mCG4355"
FT                   /note="gene_id=mCG4355.0 transcript_id=mCT3112.0 created on
FT                   18-NOV-2002"
FT   CDS             complement(5092473..5092901)
FT                   /codon_start=1
FT                   /locus_tag="mCG_4355"
FT                   /product="mCG4355"
FT                   /note="gene_id=mCG4355.0 transcript_id=mCT3112.0
FT                   protein_id=mCP18391.1"
FT                   /protein_id="EDL15495.1"
FT                   /translation="MGGGEIAFAITAIKGVGRSYAPVVLGKADIDLTKRAGEPTEDEVE
FT                   RVITIMQNPRQYKIPDWFLTRQKDVKDGKCSQVLANGLDNKLRDDLERLKKIRAHRGLR
FT                   YFWGPLCPRSAHQDHWPQGPCCGGIQEEMSLWAFAVNK"
FT   gene            5147051..5173659
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /note="gene_id=mCG4358.2"
FT   mRNA            join(5147051..5147118,5147405..5147462,5149254..5149388,
FT                   5151358..5151454,5154336..5154416,5155403..5155531,
FT                   5156560..5156650,5160041..5160119,5160988..5161084,
FT                   5164918..5165035,5166506..5166651,5168512..5168624,
FT                   5170194..5170266,5171705..5171811,5172909..5172979,
FT                   5173383..5173655)
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /product="NMD3 homolog (S. cerevisiae), transcript variant
FT                   mCT181554"
FT                   /note="gene_id=mCG4358.2 transcript_id=mCT181554.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(<5147251..5147462,5149254..5149388,5151358..5151454,
FT                   5154336..5154416,5155403..5155531,5156560..5156650,
FT                   5160041..5160119,5160988..5161084,5164918..5165035,
FT                   5166506..5166651,5168512..5168624,5170194..5170266,
FT                   5171705..5171811,5172909..5172979,5173383..5173659)
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /product="NMD3 homolog (S. cerevisiae), transcript variant
FT                   mCT3115"
FT                   /note="gene_id=mCG4358.2 transcript_id=mCT3115.2 created on
FT                   26-MAR-2003"
FT   CDS             join(5147251..5147462,5149254..5149388,5151358..5151454,
FT                   5154336..5154416,5155403..5155531,5156560..5156650,
FT                   5160041..5160119,5160988..5161084,5164918..5165035,
FT                   5166506..5166651,5168512..5168624,5170194..5170266,
FT                   5171705..5171811,5172909..5172979,5173383..5173513)
FT                   /codon_start=1
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /product="NMD3 homolog (S. cerevisiae), isoform CRA_b"
FT                   /note="gene_id=mCG4358.2 transcript_id=mCT3115.2
FT                   protein_id=mCP18397.2 isoform=CRA_b"
FT                   /protein_id="EDL15494.1"
FT                   /translation="MRSRGAEEGGRAVLGGGSRPPGLCAARMAVPELRRLDLMDPSLTG
FT                   PSLPLIGRARTMEYMAESIEHSPGHILCCECGVPISPNPANICVACLRSKVDISQGVPK
FT                   QVSISFCKQCQRYFQPPASWVQCALESRELLALCLKKIKAPLSKVRLVDAGFVWTEPHS
FT                   KRLKVKLTIQKEVMNGAILQQVFVVDYVVQSQMCGDCHRVEAKDFWKAVIQVRQKTLHK
FT                   KTFYYLEQLILKYGMHQNTLRIKEIHDGLDFYYSSKQHAQKMVEFLQGIVPCRYKASQR
FT                   LISQDIHSNTYNYKSTFSVEIVPICKDNVVCLSPKLAQSLGNMSQICICIRVTSAIHLI
FT                   DPNTLQVADIDGNTFWSHPFNSLCHPKQLEEFIVIECSTVRDLKRSAGAGVISKKHTLG
FT                   EVWIQKTSEMNTDKQYFCRTHLGHLLNPGDLVLGFDLANCNLNDEYVNKMNSDRVPDVV
FT                   LIKKSYDRTKRQRRRNWKLKELARDRENMDTDDERQYQDFLEDLEEDEAIRKHVNIYRD
FT                   ATIPVESDTDDEGAPRISLAEMLEDLHISQDATGEEGASMMS"
FT   CDS             join(5147419..5147462,5149254..5149388,5151358..5151454,
FT                   5154336..5154416,5155403..5155531,5156560..5156650,
FT                   5160041..5160119,5160988..5161084,5164918..5165035,
FT                   5166506..5166651,5168512..5168624,5170194..5170266,
FT                   5171705..5171811,5172909..5172979,5173383..5173513)
FT                   /codon_start=1
FT                   /gene="Nmd3"
FT                   /locus_tag="mCG_4358"
FT                   /product="NMD3 homolog (S. cerevisiae), isoform CRA_a"
FT                   /note="gene_id=mCG4358.2 transcript_id=mCT181554.0
FT                   protein_id=mCP104476.0 isoform=CRA_a"
FT                   /protein_id="EDL15493.1"
FT                   /translation="MEYMAESIEHSPGHILCCECGVPISPNPANICVACLRSKVDISQG
FT                   VPKQVSISFCKQCQRYFQPPASWVQCALESRELLALCLKKIKAPLSKVRLVDAGFVWTE
FT                   PHSKRLKVKLTIQKEVMNGAILQQVFVVDYVVQSQMCGDCHRVEAKDFWKAVIQVRQKT
FT                   LHKKTFYYLEQLILKYGMHQNTLRIKEIHDGLDFYYSSKQHAQKMVEFLQGIVPCRYKA
FT                   SQRLISQDIHSNTYNYKSTFSVEIVPICKDNVVCLSPKLAQSLGNMSQICICIRVTSAI
FT                   HLIDPNTLQVADIDGNTFWSHPFNSLCHPKQLEEFIVIECSTVRDLKRSAGAGVISKKH
FT                   TLGEVWIQKTSEMNTDKQYFCRTHLGHLLNPGDLVLGFDLANCNLNDEYVNKMNSDRVP
FT                   DVVLIKKSYDRTKRQRRRNWKLKELARDRENMDTDDERQYQDFLEDLEEDEAIRKHVNI
FT                   YRDATIPVESDTDDEGAPRISLAEMLEDLHISQDATGEEGASMMS"
FT   gene            complement(5243841..>5277493)
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /note="gene_id=mCG67056.2"
FT   mRNA            complement(join(5243841..5245425,5262726..5262820,
FT                   5277429..>5277493))
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /product="RIKEN cDNA 1110032A04, transcript variant
FT                   mCT190984"
FT                   /note="gene_id=mCG67056.2 transcript_id=mCT190984.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(5243841..5245425,5262726..5262820,
FT                   5277017..5277047,5277429..>5277493))
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /product="RIKEN cDNA 1110032A04, transcript variant
FT                   mCT67239"
FT                   /note="gene_id=mCG67056.2 transcript_id=mCT67239.2 created
FT                   on 28-MAR-2003"
FT   CDS             complement(join(5245185..5245425,5262726..>5262808))
FT                   /codon_start=1
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /product="RIKEN cDNA 1110032A04, isoform CRA_a"
FT                   /note="gene_id=mCG67056.2 transcript_id=mCT190984.0
FT                   protein_id=mCP111952.0 isoform=CRA_a"
FT                   /protein_id="EDL15491.1"
FT                   /translation="SPERRNNLHQIVQRKSITEYQAWILLHRQTFPSLRKSHGFQAREG
FT                   VFCLALLSIPDHHLLCCHGALGTIDAQHHHTDHCGYGGIHCLCLHPHPHPPGLGIFLQN
FT                   MWL"
FT   CDS             complement(join(5245185..5245425,5262726..>5262808))
FT                   /codon_start=1
FT                   /gene="1110032A04Rik"
FT                   /locus_tag="mCG_67056"
FT                   /product="RIKEN cDNA 1110032A04, isoform CRA_a"
FT                   /note="gene_id=mCG67056.2 transcript_id=mCT67239.2
FT                   protein_id=mCP39037.2 isoform=CRA_a"
FT                   /protein_id="EDL15492.1"
FT                   /translation="SPERRNNLHQIVQRKSITEYQAWILLHRQTFPSLRKSHGFQAREG
FT                   VFCLALLSIPDHHLLCCHGALGTIDAQHHHTDHCGYGGIHCLCLHPHPHPPGLGIFLQN
FT                   MWL"
FT   gene            complement(5377694..5378554)
FT                   /pseudo
FT                   /locus_tag="mCG_1032233"
FT                   /note="gene_id=mCG1032233.1"
FT   mRNA            complement(5377694..5378554)
FT                   /pseudo
FT                   /locus_tag="mCG_1032233"
FT                   /note="gene_id=mCG1032233.1 transcript_id=mCT149937.1
FT                   created on 28-MAR-2003"
FT   gene            <5445181..>5450086
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /note="gene_id=mCG61659.2"
FT   mRNA            join(<5445181..5445271,5449202..>5450067)
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /product="gene model 414, (NCBI), transcript variant
FT                   mCT181558"
FT                   /note="gene_id=mCG61659.2 transcript_id=mCT181558.0 created
FT                   on 28-MAR-2003"
FT   CDS             join(<5445181..5445271,5449202..>5450067)
FT                   /codon_start=1
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /product="gene model 414, (NCBI), isoform CRA_a"
FT                   /note="gene_id=mCG61659.2 transcript_id=mCT181558.0
FT                   protein_id=mCP104480.0 isoform=CRA_a"
FT                   /protein_id="EDL15489.1"
FT                   /translation="GPKGETGDTGSPGHPGTTGPQGPKGQKGEKGALGPKGDKGTIGPA
FT                   GTKGQKGSKGELCGNGTKGEKGDPGASGAHGFIGEPGAKGEKGGVGEKGYRGDLGERGE
FT                   KGQKGEKGMEGEKGSRGDVGSEGKRGSDGLPGLRGDSGPKGEKGEIGSPGFTGPAGPKG
FT                   ELGSKGVRGPTGKKGSRGVKGSKGEATQVPQSAFSALLSKPFPPPNVPIKFDKILSNDQ
FT                   GDYSPVTGKFNCSVPGTYIFSYHVTVRGRPARISLVARNRKQFKSRETLYGQQVDQASL
FT                   LLILKLSAGDQVWLEVSKDWNGLYVGPEDDSIFSGFLL"
FT   mRNA            join(<5445182..5445271,5448550..5448621,5449202..>5450086)
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /product="gene model 414, (NCBI), transcript variant
FT                   mCT61842"
FT                   /note="gene_id=mCG61659.2 transcript_id=mCT61842.1 created
FT                   on 28-MAR-2003"
FT   CDS             join(<5445184..5445271,5448550..5448621,5449202..>5450086)
FT                   /codon_start=1
FT                   /gene="Gm414"
FT                   /locus_tag="mCG_61659"
FT                   /product="gene model 414, (NCBI), isoform CRA_b"
FT                   /note="gene_id=mCG61659.2 transcript_id=mCT61842.1
FT                   protein_id=mCP31451.1 isoform=CRA_b"
FT                   /protein_id="EDL15490.1"
FT                   /translation="PKGETGDTGSPGHPGTTGPQGPKGQKGEKGLKGDRGDQGAGGIPG
FT                   YPGKPGEQGALGPKGDKGTIGPAGTKGQKGSKGELCGNGTKGEKGDPGASGAHGFIGEP
FT                   GAKGEKGGVGEKGYRGDLGERGEKGQKGEKGMEGEKGSRGDVGSEGKRGSDGLPGLRGD
FT                   SGPKGEKGEIGSPGFTGPAGPKGELGSKGVRGPTGKKGSRGVKGSKGEATQVPQSAFSA
FT                   LLSKPFPPPNVPIKFDKILSNDQGDYSPVTGKFNCSVPGTYIFSYHVTVRGRPARISLV
FT                   ARNRKQFKSRETLYGQQVDQASLLLILKLSAGDQVWLEVSKDWNGLYVGPEDDSIFSGF
FT                   LLYPEETF"
FT   gene            complement(6155837..6156963)
FT                   /locus_tag="mCG_19960"
FT                   /note="gene_id=mCG19960.0"
FT   mRNA            complement(6155837..6156963)
FT                   /locus_tag="mCG_19960"
FT                   /product="mCG19960"
FT                   /note="gene_id=mCG19960.0 transcript_id=mCT17852.0 created
FT                   on 18-NOV-2002"
FT   CDS             complement(6155931..6156914)
FT                   /codon_start=1
FT                   /locus_tag="mCG_19960"
FT                   /product="mCG19960"
FT                   /note="gene_id=mCG19960.0 transcript_id=mCT17852.0
FT                   protein_id=mCP9312.1"
FT                   /protein_id="EDL15488.1"
FT                   /translation="MKPGFSPRGGGFGGRGGFGDRGGRGGGRGGRGGFGGGRGGFGGGG
FT                   RGRGGGGGGFRGRGGGGGRGGGFQSGGNRGRGGGRGGKRGNQSGKNVMVEPHRHEGVFI
FT                   CRGKEDALVTKNLVPGESVYGEKRVSISEGDDKIEYRAWNPFRSKLAAAILGGVDQIHI
FT                   KPGAKVLYLGAASGTTVSHVSDIVGPDGLVYAVEFSHRSGRDLINLAKKRTNIIPVIED
FT                   ARHPHKYRMLIAMVDVIFADVAQPDQTRIVALNAHTFLRNGGHFVISIKANCIDSTASA
FT                   EAVFASEVKKMQQENMKPQEQLTLEPYERDHAVVVGVYRPPPKVKN"
FT   gene            complement(6846984..6847431)
FT                   /pseudo
FT                   /locus_tag="mCG_1032301"
FT                   /note="gene_id=mCG1032301.1"
FT   mRNA            complement(6846984..6847431)
FT                   /pseudo
FT                   /locus_tag="mCG_1032301"
FT                   /note="gene_id=mCG1032301.1 transcript_id=mCT150005.1
FT                   created on 28-MAR-2003"
FT   gene            complement(8328807..>8403182)
FT                   /locus_tag="mCG_120052"
FT                   /note="gene_id=mCG120052.1"
FT   mRNA            complement(join(8328807..8329305,8332273..8332440,
FT                   8332645..8332694,8334807..8334895,8337956..8338080,
FT                   8338627..8338683,8338766..8338850,8341435..8341583,
FT                   8343258..8343374,8343459..8343493,8346249..8346382,
FT                   8347726..8347864,8349073..8349160,8350458..8350574,
FT                   8351832..8351894,8353196..8353306,8354174..8354302,
FT                   8355604..8355729,8355817..8355929,8356034..8356130,
FT                   8357503..8357671,8359630..8359784,8361656..8361862,
FT                   8364426..8364584,8364812..8364982,8365645..8365694,
FT                   8368321..8368397,8370347..8370471,8372122..8372178,
FT                   8373449..8373533,8374860..8375014,8377227..8377343,
FT                   8379808..8379979,8381414..8381531,8382877..8382961,
FT                   8383726..8383839,8385823..8385942,8386030..8386161,
FT                   8387875..8388000,8388725..8388837,8389410..8389509,
FT                   8392447..8392618,8394429..8394580,8396574..8396683,
FT                   8397329..8397446,8401895..8402001,8403065..>8403182))
FT                   /locus_tag="mCG_120052"
FT                   /product="mCG120052"
FT                   /note="gene_id=mCG120052.1 transcript_id=mCT121233.1
FT                   created on 15-NOV-2002"
FT   CDS             complement(join(8329237..8329305,8332273..8332440,
FT                   8332645..8332694,8334807..8334895,8337956..8338080,
FT                   8338627..8338683,8338766..8338850,8341435..8341583,
FT                   8343258..8343374,8343459..8343493,8346249..8346382,
FT                   8347726..8347864,8349073..8349160,8350458..8350574,
FT                   8351832..8351894,8353196..8353306,8354174..8354302,
FT                   8355604..8355729,8355817..8355929,8356034..8356130,
FT                   8357503..8357671,8359630..8359784,8361656..8361862,
FT                   8364426..8364584,8364812..8364982,8365645..8365694,
FT                   8368321..8368397,8370347..8370471,8372122..8372178,
FT                   8373449..8373533,8374860..8375014,8377227..8377343,
FT                   8379808..8379979,8381414..8381531,8382877..8382961,
FT                   8383726..8383839,8385823..8385942,8386030..8386161,
FT                   8387875..8388000,8388725..8388837,8389410..8389509,
FT                   8392447..8392618,8394429..8394580,8396574..8396683,
FT                   8397329..8397446,8401895..8402001,8403065..8403182))
FT                   /codon_start=1
FT                   /locus_tag="mCG_120052"
FT                   /product="mCG120052"
FT                   /note="gene_id=mCG120052.1 transcript_id=mCT121233.1
FT                   protein_id=mCP65947.1"
FT                   /protein_id="EDL15487.1"
FT                   /translation="MAKKKFSGLEISLIVLFIIVTIIAIALVVVLATKVPAVEEVKSPT
FT                   STPSPGRCPPEQGEPLNERINCIPEQHPTKAKCEERGCCWRPWNNTIIPWCFFADNHGY
FT                   TAASVTNDNSGLKATLSRIPSPTLFGEDIKSVLLTTQSQTRNRFRFKLTDPNNKRYEVP
FT                   HQFVKDGNGIPAADTLYDVKVSENPFSIKVIRKSNNKVLFDTSIGPLVYSNQYLQISTR
FT                   LPSEYIYGFGEHIHKRFRHDLYWKTWPIFTRDEIPGDNNHNLYGHQTFFMGIEDNSGKS
FT                   YGVFLMNSNAMEVFIQPTPIITYRVTGGVLDFYIFLGDTPEQVVQQYQELIGRPAMPAY
FT                   WNLGFQLSRWNYVSLDKVKEVVRRNREAGIPYDAQVTDIDYMEDKKDFTYDEVAFKGLP
FT                   EFAQDLHNHGQKYIIILDPAISINKRANGAEYQTYVRGNEQNVWVKESDGTTSLIGEVW
FT                   PGLTVYPDFTNPRTWEWWANECNLFHQQVEYDGLWIDMNEVSSFIHGSQKGCAPNLLNY
FT                   PPFTPGILDKIMYSKTLCMDAVQHWGNQYDVHSLYGYSMAIATEKAVEKVFPNKRSFIL
FT                   TRSTFAGSGHHAAHWLGDNTASWEQMEWSITGMLEFGMFGMPLVGADICGFLANTTEEL
FT                   CRRWMQLGAFYPFSRNHNAEGYAEQDPAFWGADSLLVNTSRHYLTIRYTLLPFLYTLFY
FT                   RAHAFGETVARPFLHEFYEDPNSWIEDTQFLWGPALLITPVLRPETKYVSAYIPDATWY
FT                   DYETGEKRPWRKQRVDMYLPEDKIGLHLRGGYIIPTQQPDVTTTASRKNPLGLIVALDE
FT                   NQAAKGELFWDDDTIEKKIYILYEFSVSNNNLIVNCTHSSYPEGNTLVFKTIKVLGLSA
FT                   TVTAVTVGENDQQMNPHLAFTFDAFNKILSITDLTFNLGKTFIVRWTTQSFSDNEKFTC
FT                   YPDVGTATEKTCVERGCIWEPVSGLANVPPCYFPSNHNPYLLTSTQKLATGITAELQLN
FT                   PASARIKLPSNPISTLRVEVKYHKNDMLQFKIYDAHHKRYEVPVPLNIPDTPTSSEENR
FT                   LYDVEIKENPFGIQVRRRSTGKLIWDSCLPGFAFNDQFIQISTRLPSQYLYGFGEAEHT
FT                   AFKRNLNWHTWGMFTRDQPPGYKLNSYGFHPYYMALEDEGNAHGVLLQNSNGMDVTFQP
FT                   TPALTYRTIGGILDFYMFLGPTPEGATKQYHEVIGFPVMPPYWALGFQLCRYGYRNTSE
FT                   IEQLYNDMKAAQIPYDVQYTDINYMERQLDFTIGERFKTLPQFVEKIRKEGMKYIVILD
FT                   PAISGNETQPYPAFERGIQKDVFVKWPNTNDICWAKVWPDLPNITIDETITEDEAVNAS
FT                   RAHVAFPDFFRNSTSEWWTREIYDFYNEKMKFDGLWIDMNEPSSFVNGTVTNKCRNDTL
FT                   NYPPYFPELTKRNEGLHFRTMCMETEHILSDGSSVLHYDVHNLYGWSQVKPTLDALRNT
FT                   TGLRGIVISRSTYPTAGRWGGHWLGDNYANWENLEKSLIGMLEFNLFGIPYVGADICGF
FT                   FNDSEYHLCARWMQVGAFYPYSRNHNIQFTRRQDPVSWNETFAQMSKKVLEIRYTLLPY
FT                   FYTQMHEAHIHGGTVIRPLMHEFFDDKETWEIYKQFLWGPAFMVTPVIGPFQTAVNGYV
FT                   PKARWFDYHTGEDIKVRGKLQTFSAPFDTINLHVRGGYILPCQEPAQNTYYSRQNYMKL
FT                   IVAADDNQTAKGSLFWDDGESIDTYEKNQYTLIEFNLNQKNLTSTVLKDGYRNKSEMKL
FT                   GSIYVWGKGTTSISQVNLTYGGNEQQLSFTQDEAKEILTIDLKNVTVTLDEPIQISWS"
FT   gene            complement(8477810..8486179)
FT                   /gene="Slitrk3"
FT                   /locus_tag="mCG_52101"
FT                   /note="gene_id=mCG52101.1"
FT   mRNA            complement(join(8477810..8480812,8485862..8486179))
FT                   /gene="Slitrk3"
FT                   /locus_tag="mCG_52101"
FT                   /product="SLIT and NTRK-like family, member 3"
FT                   /note="gene_id=mCG52101.1 transcript_id=mCT52284.1 created
FT                   on 15-NOV-2002"
FT   CDS             complement(8477852..8480794)
FT                   /codon_start=1
FT                   /gene="Slitrk3"
FT                   /locus_tag="mCG_52101"
FT                   /product="SLIT and NTRK-like family, member 3"
FT                   /note="gene_id=mCG52101.1 transcript_id=mCT52284.1
FT                   protein_id=mCP38006.2"
FT                   /db_xref="GOA:Q810B9"
FT                   /db_xref="InterPro:IPR000372"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="MGI:MGI:2679447"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q810B9"
FT                   /protein_id="EDL15486.1"
FT                   /translation="MMKPSIAEMLHRGRMLWIILLSTIALGWTTPIPLIEDSEEIDEPC
FT                   FDPCYCEVKESLFHIHCDSKGFTNISQITEFWSRPFKLYLQRNSMRRLYTNSFLHLNNA
FT                   VSINLGNNALQDIQTGAFNGLKILKRLYLHENKLDVFRNDTFLGLESLEYLQADYNVIK
FT                   RIESGAFRNLSKLRVLILNDNLIPVLPTNLFKAVSLTHLDLRGNRLKVLFYRGMLDHIG
FT                   RSLMELQLEENPWNCTCEIVQLKSWLERIPYTALVGDITCETPFHFHGKDLREIKKTEL
FT                   CPLLSDSEVEASLGIPHLSSSKENAWPTKPSSMLSSVHFTASSVEYKSSNKQPKPTKQP
FT                   RTPRPPSTSQALYPGPNQPPIAPYQTRPPIPIICPTGCTCNLHINDLGLTVNCKERGFN
FT                   NISELLPRPLNAKKLYLSSNLIQKIYRSDFWNFSSLDLLHLGNNRISYVQDGAFINLPN
FT                   LKSLFLNGNDIEKLTPGMFRGLQSLHYLYFEFNVIREIQPAAFSLMPNLKLLFLNNNLL
FT                   RTLPTDAFAGTSLARLNLRKNYFLYLPVAGVLEHLNAIVQIDLNENPWDCTCDLVPFKQ
FT                   WIETISSVSVVGDVLCRTPENLTHRDVRTIELEVLCPEMLHIAQPGPSPPQPGDYHPNG
FT                   GPTSASPYEFSPPGGPVPLSVLILSLLVLFFSAVFVAAGLFAYVLRRRRKKLPFRSKRQ
FT                   EGVDLTGIQMQCHRLFEDSGGNSGGSGGGGRPTLSSPEKAPPVGHVYEYIPHPVTQMCN
FT                   NPIYKPREEEEVAASAAQDTGATDRGGPGTQPTGMAEVLLGSEQFAETPKENHSNYRTL
FT                   LEKEKEWALAVSNSQLNTIVTVNHHHPHPHHSAVGGVSGVGGGTGGDLAGFRHHEKNGG
FT                   VVLFPPGGGCGGGSLLLDRERPQPAPCTVGFVDCLYGTVPKLKELHVHPPGMQYPDLQQ
FT                   DARLKETLLFSAGKGFTDHQTPKSDYLDLRAKLQTKPDYLEVLEKTAYRF"
FT   gene            <8495715..9016664
FT                   /locus_tag="mCG_145240"
FT                   /note="gene_id=mCG145240.0"
FT   mRNA            join(<8495715..8495947,8668874..8668987,8981440..8981517,
FT                   8986705..8987149,9016177..9016664)
FT                   /locus_tag="mCG_145240"
FT                   /product="mCG145240"
FT                   /note="gene_id=mCG145240.0 transcript_id=mCT184664.0
FT                   created on 05-JUN-2003"
FT   gene            8750098..8891198
FT                   /locus_tag="mCG_1050990"
FT                   /note="gene_id=mCG1050990.0"
FT   mRNA            join(8750098..8750178,8752313..8752383,8753662..8753761,
FT                   8759607..8759720,8890946..8891198)
FT                   /locus_tag="mCG_1050990"
FT                   /product="mCG1050990"
FT                   /note="gene_id=mCG1050990.0 transcript_id=mCT194779.0
FT                   created on 27-JAN-2005"
FT   CDS             join(8752358..8752383,8753662..8753761,8759607..8759612)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1050990"
FT                   /product="mCG1050990"
FT                   /note="gene_id=mCG1050990.0 transcript_id=mCT194779.0
FT                   protein_id=mCP115808.0"
FT                   /protein_id="EDL15485.1"
FT                   /translation="MAERNAKTGCPKLKDFQKFKRNFGFLKRHDFIKETTFNVFELK"
FT   gene            complement(8771782..>8902919)
FT                   /locus_tag="mCG_1032438"
FT                   /note="gene_id=mCG1032438.0"
FT   mRNA            complement(join(8771782..8772402,8780565..8780706,
FT                   8782548..8782728,8783757..8783874,8812668..8812855,
FT                   8813735..8813833,8899548..8899612,8902776..>8902919))
FT                   /locus_tag="mCG_1032438"
FT                   /product="mCG1032438"
FT                   /note="gene_id=mCG1032438.0 transcript_id=mCT150142.0
FT                   created on 27-MAR-2003"
FT   CDS             complement(join(8772184..8772402,8780565..>8780576))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032438"
FT                   /product="mCG1032438"
FT                   /note="gene_id=mCG1032438.0 transcript_id=mCT150142.0
FT                   protein_id=mCP65445.0"
FT                   /protein_id="EDL15484.1"
FT                   /translation="VCTKAATRKFEPNVRKIFPPQVSNQEKSSHIYTATWLWLFPGVVK
FT                   LTSKNGHHDFHYYGSQKSLRPVVSKHEFHKW"
FT   CDS             join(<8987135..8987149,9016177..9016473)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145240"
FT                   /product="mCG145240"
FT                   /note="gene_id=mCG145240.0 transcript_id=mCT184664.0
FT                   protein_id=mCP105807.0"
FT                   /protein_id="EDL15483.1"
FT                   /translation="DKCSQDLSPNIEKIGSQKDLDIPPPLPTALWLQHEAITGSLVLCH
FT                   EIQLSFSCLCTNPKSIIFPNGYFVFCICKYLFSFLNGVCRPISYFYSILSFRYDSFMF"
FT   gene            complement(9068138..9127772)
FT                   /gene="Bche"
FT                   /locus_tag="mCG_9776"
FT                   /note="gene_id=mCG9776.2"
FT   mRNA            complement(join(9068138..9068567,9077163..9077329,
FT                   9126236..9127772))
FT                   /gene="Bche"
FT                   /locus_tag="mCG_9776"
FT                   /product="butyrylcholinesterase"
FT                   /note="gene_id=mCG9776.2 transcript_id=mCT9665.1 created on
FT                   30-AUG-2002"
FT   CDS             complement(join(9068443..9068567,9077163..9077329,
FT                   9126236..9127755))
FT                   /codon_start=1
FT                   /gene="Bche"
FT                   /locus_tag="mCG_9776"
FT                   /product="butyrylcholinesterase"
FT                   /note="gene_id=mCG9776.2 transcript_id=mCT9665.1
FT                   protein_id=mCP17190.1"
FT                   /db_xref="GOA:Q03311"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR014788"
FT                   /db_xref="InterPro:IPR019819"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="MGI:MGI:894278"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q03311"
FT                   /protein_id="EDL15482.1"
FT                   /translation="MQTQHTKVTQTHFLLWILLLCMPFGKSHTEEDFIITTKTGRVRGL
FT                   SMPVLGGTVTAFLGIPYAQPPLGSLRFKKPQPLNKWPDIHNATQYANSCYQNIDQAFPG
FT                   FQGSEMWNPNTNLSEDCLYLNVWIPVPKPKNATVMVWIYGGGFQTGTSSLPVYDGKFLA
FT                   RVERVIVVSMNYRVGALGFLAFPGNPDAPGNMGLFDQQLALQWVQRNIAAFGGNPKSIT
FT                   IFGESAGAASVSLHLLCPQSYPLFTRAILESGSSNAPWAVKHPEEARNRTLTLAKFTGC
FT                   SKENEMEMIKCLRSKDPQEILRNERFVLPSDSILSINFGPTVDGDFLTDMPHTLLQLGK
FT                   VKKAQILVGVNKDEGTAFLVYGAPGFSKDNDSLITRKEFQEGLNMYFPGVSRLGKEAVL
FT                   FYYVDWLGEQSPEVYRDALDDVIGDYNIICPALEFTKKFAELENNAFFYFFEHRSSKLP
FT                   WPEWMGVMHGYEIEFVFGLPLGRRVNYTRAEEIFSRSIMKTWANFAKYGHPNGTQGNST
FT                   MWPVFTSTEQKYLTLNTEKSKIYSKLRAPQCQFWRLFFPKVLEMTGDIDETEQEWKAGF
FT                   HRWSNYMMDWQNQFNDYTSKKESCTAL"
FT   gene            complement(10428809..10534754)
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /note="gene_id=mCG21990.3"
FT   mRNA            complement(join(10428809..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10469466..10469755,10472807..10472946,10474697..10474776,
FT                   10476085..10476185,10476529..10476638,10484149..10484284,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..>10534702))
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, transcript variant
FT                   mCT190918"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT190918.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(10428810..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10476085..10476185,10476529..10476638,10484149..10484269,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..10534754))
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, transcript variant
FT                   mCT22292"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT22292.2 created
FT                   on 15-NOV-2002"
FT   mRNA            complement(join(10428818..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10469466..10469755,10472807..10472946,10474697..10474776,
FT                   10476085..10476185,10476529..10476638,10484149..10484269,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..>10534711))
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, transcript variant
FT                   mCT190917"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT190917.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(10428863..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10469466..10469755,10472807..10472946,10474697..10474776,
FT                   10476085..10476185,10476529..10476638,10484149..10484269,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..>10534590))
FT                   /codon_start=1
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, isoform CRA_a"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT190917.0
FT                   protein_id=mCP111899.0 isoform=CRA_a"
FT                   /protein_id="EDL15479.1"
FT                   /translation="RIFRAGCQLSAGKVKLKLLKEEIQVPAKQLSYKMAHSTGSENPKT
FT                   KRKVCGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIA
FT                   AHQFIKEENPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCKVMWEM
FT                   PFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPDSVEECEVQTNLKMWTEPINIEF
FT                   TEDSLSYMETLWLKKYRRTPQEQLRTMLPNTFTHPHQATAEAQCTQNENESDSDVEEIK
FT                   IKSPPLFMPVEKLNIERPPPSLTIVELDDTHGAEFEDPGIAVPYRVELADSESQLSSTF
FT                   TDYQTCFPCENEIHHHLIFNKGKADLLSLCLRTNSRYHKDDIKDFGNTVESCTYSDEFK
FT                   KIGETTSFEKNETEKNIDPQNNRDSVDSCMSLGSKGSLPTIDSSTSFIEENSSQDTNTS
FT                   LKCSNQNERSNLGNSKTAKEPLFQKVTIRKKLIKERYQGPKKFYSVDKNERLDVFPSSS
FT                   IKGSHSCSEITSTVSEDKMWIPLSSLSGYAGSADALCDQQSDENPLPNMQQQKSGQKSQ
FT                   RPSTANIPISNPDQKDTSCLLFSYTRSKSAAAQMPSRAASEISEIEYIDVTDQSELFGG
FT                   NTADRQALDTLEKELNILRKPADPSEDPHSLPSEELQAFNDNFLTLSQMSKDLLEMSRE
FT                   SDPHGAESSSSGRNPEIQPLLSLGDYSTDEEEDEFLDKQHVIKLPWEKRA"
FT   CDS             complement(join(10428863..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10469466..10469755,10472807..10472946,10474697..10474776,
FT                   10476085..10476185,10476529..10476638,10484149..10484284,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530615,10532061..10532109,10534567..>10534590))
FT                   /codon_start=1
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, isoform CRA_b"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT190918.0
FT                   protein_id=mCP111900.0 isoform=CRA_b"
FT                   /protein_id="EDL15480.1"
FT                   /translation="RIFRAGCQLSAGKVKLKLLKEEIQVPAKQLSYKMAHSTGSENPKT
FT                   KRKVCGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIA
FT                   AHQFIKEENPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCKVMWEM
FT                   PFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPVFIFLDSVEECEVQTNLKMWTEP
FT                   INIEFTEDSLSYMETLWLKKYRRTPQEQLRTMLPNTFTHPHQATAEAQCTQNENESDSD
FT                   VEEIKIKSPPLFMPVEKLNIERPPPSLTIVELDDTHGAEFEDPGIAVPYRVELADSESQ
FT                   LSSTFTDYQTCFPCENEIHHHLIFNKGKADLLSLCLRTNSRYHKDDIKDFGNTVESCTY
FT                   SDEFKKIGETTSFEKNETEKNIDPQNNRDSVDSCMSLGSKGSLPTIDSSTSFIEENSSQ
FT                   DTNTSLKCSNQNERSNLGNSKTAKEPLFQKVTIRKKLIKERYQGPKKFYSVDKNERLDV
FT                   FPSSSIKGSHSCSEITSTVSEDKMWIPLSSLSGYAGSADALCDQQSDENPLPNMQQQKS
FT                   GQKSQRPSTANIPISNPDQKDTSCLLFSYTRSKSAAAQMPSRAASEISEIEYIDVTDQS
FT                   ELFGGNTADRQALDTLEKELNILRKPADPSEDPHSLPSEELQAFNDNFLTLSQMSKDLL
FT                   EMSRESDPHGAESSSSGRNPEIQPLLSLGDYSTDEEEDEFLDKQHVIKLPWEKRA"
FT   CDS             complement(join(10428863..10428989,10430786..10430921,
FT                   10443249..10443506,10452606..10452728,10462710..10462860,
FT                   10476085..10476185,10476529..10476638,10484149..10484269,
FT                   10496589..10496763,10503040..10503186,10527392..10527487,
FT                   10530509..10530589))
FT                   /codon_start=1
FT                   /gene="BC050789"
FT                   /locus_tag="mCG_21990"
FT                   /product="cDNA sequence BC050789, isoform CRA_c"
FT                   /note="gene_id=mCG21990.3 transcript_id=mCT22292.2
FT                   protein_id=mCP17203.2 isoform=CRA_c"
FT                   /protein_id="EDL15481.1"
FT                   /translation="MAHSTGSENPKTKRKVCGQCENKAALLVCLECGEDYCSGCFAKMH
FT                   QKGALKFHRTTLLQPKSQILSNILIAAHQFIKEENPPNEGNHPAEASSKSQQKPKALLQ
FT                   NSSEVGATASEGGEGENPRCKVMWEMPFDEEASAQSFREALTQWRAGHQEENKEEEVHA
FT                   KKPDSVEECEVQTNLKMWTEPINIEFTEDSLSYMETLWLKKYRRTPQEQLRTMLPNTFT
FT                   HPHQATAEAQCTQNENESDSDVEEIKIKSPPLFMPVEKLNIERPPPSLTIVELDDFQKV
FT                   TIRKKLIKERYQGPKKFYSVDKNERLDVFPSSSIKGSHSCSEITSTVSEDKMWIPLSSL
FT                   SGYAGSADALCDQQSDENPLPNMQQQKSGQKSQRPSTANIPISNPDQKDTSCLLFSYTR
FT                   SKSAAAQMPSRAASEISEIEYIDVTDQSELFGGNTADRQALDTLEKELNILRKPADPSE
FT                   DPHSLPSEELQAFNDNFLTLSQMSKDLLEMSRESDPHGAESSSSGRNPEIQPLLSLGDY
FT                   STDEEEDEFLDKQHVIKLPWEKRA"
FT   gene            complement(10640004..10667749)
FT                   /gene="Serpini2"
FT                   /locus_tag="mCG_21987"
FT                   /note="gene_id=mCG21987.2"
FT   mRNA            complement(join(10640004..10640363,10644289..10644378,
FT                   10646948..10647034,10650317..10650414,10655415..10655607,
FT                   10655686..10655880,10657159..10657389,10665418..10665679,
FT                   10667708..10667749))
FT                   /gene="Serpini2"
FT                   /locus_tag="mCG_21987"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   I, member 2"
FT                   /note="gene_id=mCG21987.2 transcript_id=mCT22289.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(10640287..10640363,10644289..10644378,
FT                   10646948..10647034,10650317..10650414,10655415..10655607,
FT                   10655686..10655880,10657159..10657389,10665418..10665664))
FT                   /codon_start=1
FT                   /gene="Serpini2"
FT                   /locus_tag="mCG_21987"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   I, member 2"
FT                   /note="gene_id=mCG21987.2 transcript_id=mCT22289.2
FT                   protein_id=mCP17197.2"
FT                   /db_xref="GOA:Q4G0D3"
FT                   /db_xref="InterPro:IPR000215"
FT                   /db_xref="InterPro:IPR023795"
FT                   /db_xref="InterPro:IPR023796"
FT                   /db_xref="MGI:MGI:1915181"
FT                   /db_xref="UniProtKB/TrEMBL:Q4G0D3"
FT                   /protein_id="EDL15478.1"
FT                   /translation="MNKTILWSFLLFFSGSQTSRATDQKIADFAVDLYKAISLSHKNNI
FT                   IFSPLGTTMLLGMVQLGAKGKAQQQILKTLRMRGTPAGEEFSVLKSLFSAISKKKQEFT
FT                   FNLASALYLQEGFIVKETYLHSNKEFFQSATKLVDFLDAKTSAQAISTWVESKTDGKIK
FT                   NMFSEEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTEMTDFTKKDGSTVKVPMMKALLRA
FT                   QYGYFSQSSMTCQVLELPYKADEFSLVIILPTEDTSIEEVENQVTAPHVRRWFSELHEE
FT                   EVEVSLPRFKIEQKLDLKEALYSLNVTEIFSGGCDLSGITDSSEVYVSRVMQKVFFEIN
FT                   EDGSEAAASTGINIPAIMSLTQTQFLANHPFLFILKHIRTESILFMGKVTDPDIQTTKG
FT                   RDLDSL"
FT   gene            complement(10787112..10829333)
FT                   /locus_tag="mCG_57300"
FT                   /note="gene_id=mCG57300.2"
FT   mRNA            complement(join(10787112..10787999,10806698..10806846,
FT                   10808490..10808657,10827408..10827582,10828334..10828510,
FT                   10828893..10829333))
FT                   /locus_tag="mCG_57300"
FT                   /product="mCG57300"
FT                   /note="gene_id=mCG57300.2 transcript_id=mCT57483.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(10787673..10787999,10806698..10806846,
FT                   10808490..10808657,10827408..10827582,10828334..10828510,
FT                   10828893..10829306))
FT                   /codon_start=1
FT                   /locus_tag="mCG_57300"
FT                   /product="mCG57300"
FT                   /note="gene_id=mCG57300.2 transcript_id=mCT57483.2
FT                   protein_id=mCP38041.2"
FT                   /protein_id="EDL15477.1"
FT                   /translation="MPREEFVQKMAETVGWGTKEEYGELFDKVDVARDGFIDWDKLTSF
FT                   ILLLLYERDERAKATVVPQWKDLEFLPGKHKDTIQKVVFLKSSSRYLTVSKEGLLGIWG
FT                   ENLKLQESLPITSDAIKLKHLWVTSLVSLENVNKIAVAFTSREICFYDLLSKEEFPCQY
FT                   KLQGLQGAPICMDYWYDPIDPKDSILSFGDITGKVQAVAFTAAMISLFERPANACDNEE
FT                   ATMTIDWAELVSGCHKCCHVLQHTLHHGDWVRQVTYNASLDAFISSTMSGINTVVLAWR
FT                   EKSKKLLKMTSFNIAQGIHAFDYHSRLNLIATAGINNKVCLWNPYVLSKPVGVLWGHSA
FT                   SVIAVQFFAERKQLFSFSRDKVLRLWDIQHQLSIQRITCSFPKSQDFRCLFQFDETHGR
FT                   LFISFNNQLALLAIKNEASKRVKSHLKAVSCVLYNSLLKQVNTSSSLLLSWRFPKVRVS
FT                   FPLLNQKQNQR"
FT   gene            complement(10860914..10863673)
FT                   /locus_tag="mCG_147528"
FT                   /note="gene_id=mCG147528.0"
FT   mRNA            complement(join(10860914..10863333,10863543..10863673))
FT                   /locus_tag="mCG_147528"
FT                   /product="mCG147528"
FT                   /note="gene_id=mCG147528.0 transcript_id=mCT187791.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(10862964..10863206)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147528"
FT                   /product="mCG147528"
FT                   /note="gene_id=mCG147528.0 transcript_id=mCT187791.0
FT                   protein_id=mCP109372.0"
FT                   /protein_id="EDL15476.1"
FT                   /translation="MMQRGEVIRSYPEAALGLTVGPQSEPTRLEKTEGFTASEDYGTDL
FT                   FENKLSVEDFVKIQQVFEVSARFTDQRLWAVHKGQ"
FT   gene            complement(10898580..10938215)
FT                   /locus_tag="mCG_113365"
FT                   /note="gene_id=mCG113365.0"
FT   mRNA            complement(join(10898580..10899059,10902160..10902242,
FT                   10902489..10902567,10909046..10909172,10910268..10910385,
FT                   10914996..10915049,10922617..10922835,10938182..10938215))
FT                   /locus_tag="mCG_113365"
FT                   /product="mCG113365"
FT                   /note="gene_id=mCG113365.0 transcript_id=mCT114447.0
FT                   created on 03-SEP-2002"
FT   CDS             complement(join(10898978..10899059,10902160..10902242,
FT                   10902489..10902567,10909046..10909172,10910268..10910385,
FT                   10914996..10915049,10922617..10922712))
FT                   /codon_start=1
FT                   /locus_tag="mCG_113365"
FT                   /product="mCG113365"
FT                   /note="gene_id=mCG113365.0 transcript_id=mCT114447.0
FT                   protein_id=mCP65874.0"
FT                   /protein_id="EDL15475.1"
FT                   /translation="MRMTMEEMKNEAETTSMVSMPLYAVMYPVFNELERVNLSAAQTLR
FT                   AAFIKAEKENPGLTQDIIMKILEKKSVEVNFTESLLRMAADDVEEYMIERPEPEFQDLN
FT                   EKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQ
FT                   KKEFVKYSKSFSDTLKTYFKDGKAINVFISANRLIHQTNLILQTFKTVA"
FT   gene            10939025..11023828
FT                   /gene="Serpini1"
FT                   /locus_tag="mCG_9822"
FT                   /note="gene_id=mCG9822.1"
FT   mRNA            join(10939025..10939102,10994557..10994824,
FT                   10995931..10996161,10998045..10998239,11000596..11000800,
FT                   11005337..11005434,11019391..11019477,11021723..11021812,
FT                   11022149..11023828)
FT                   /gene="Serpini1"
FT                   /locus_tag="mCG_9822"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   I, member 1"
FT                   /note="gene_id=mCG9822.1 transcript_id=mCT9793.1 created on
FT                   30-AUG-2002"
FT   CDS             join(10994575..10994824,10995931..10996161,
FT                   10998045..10998239,11000596..11000800,11005337..11005434,
FT                   11019391..11019477,11021723..11021812,11022149..11022225)
FT                   /codon_start=1
FT                   /gene="Serpini1"
FT                   /locus_tag="mCG_9822"
FT                   /product="serine (or cysteine) peptidase inhibitor, clade
FT                   I, member 1"
FT                   /note="gene_id=mCG9822.1 transcript_id=mCT9793.1
FT                   protein_id=mCP17199.1"
FT                   /protein_id="EDL15474.1"
FT                   /translation="MTYLELLALLALQSVVTGATFPDETITEWSVNMYNHLRGTGEDEN
FT                   ILFSPLSIALAMGMMELGAQGSTRKEIRHSMGYEGLKGGEEFSFLRDFSNMASAEENQY
FT                   VMKLANSLFVQNGFHVNEEFLQMLKMYFNAEVNHVDFSQNVAVANSINKWVENYTNSLL
FT                   KDLVSPEDFDGVTNLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGE
FT                   FYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLALSRQEVPLATLEPLLKAQLIEEWAN
FT                   SVKKQKVEVYLPRFTVEQEIDLKDILKALGVTEIFIKDANLTAMSDKKELFLSKAVHKS
FT                   CIEVNEEGSEAAAASGMIAISRMAVLYPQVIVDHPFLYLIRNRKSGIILFMGRVMNPET
FT                   MNTSGHDFEEL"
FT   gene            complement(11028925..>11037215)
FT                   /locus_tag="mCG_145237"
FT                   /note="gene_id=mCG145237.0"
FT   mRNA            complement(join(11028925..11029415,11030275..11030465,
FT                   11036874..>11037215))
FT                   /locus_tag="mCG_145237"
FT                   /product="mCG145237"
FT                   /note="gene_id=mCG145237.0 transcript_id=mCT184661.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(11028981..>11029343)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145237"
FT                   /product="mCG145237"
FT                   /note="gene_id=mCG145237.0 transcript_id=mCT184661.0
FT                   protein_id=mCP105804.0"
FT                   /protein_id="EDL15473.1"
FT                   /translation="QLKEKIIYGELLPNSLLWLLEHFCVSVEPGSCPVMQTECLSALWL
FT                   ALVVCMKIAFVGSFGVAKLEEVCHYWGVGFEVSNAQAKPSQVSLFLPAACQSKCRSLSY
FT                   LSSIMSAFMLPCFLPW"
FT   gene            complement(11259601..11343129)
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /note="gene_id=mCG9823.3"
FT   mRNA            complement(join(11259601..11261587,11262028..11262099,
FT                   11269664..11269732,11270062..11270229,11274490..11274599,
FT                   11275856..11275938,11276750..11277003,11281536..11281838,
FT                   11284534..11284695,11288965..11289048,11289819..11289901,
FT                   11292971..11293121,11294703..11294756,11296550..11296599,
FT                   11298116..11298190,11342315..11343063))
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /product="golgi phosphoprotein 4, transcript variant
FT                   mCT9794"
FT                   /note="gene_id=mCG9823.3 transcript_id=mCT9794.2 created on
FT                   09-JUN-2003"
FT   mRNA            complement(join(11259891..11261587,11262028..11262099,
FT                   11269664..11269732,11270062..11270229,11274490..11274599,
FT                   11275856..11275938,11276750..11277003,11281536..11281838,
FT                   11284534..11284695,11289819..11289901,11292971..11293121,
FT                   11294703..11294756,11296550..11296599,11298116..11298190,
FT                   11342315..11342926,11343007..11343063,11343084..11343129))
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /product="golgi phosphoprotein 4, transcript variant
FT                   mCT185530"
FT                   /note="gene_id=mCG9823.3 transcript_id=mCT185530.0 created
FT                   on 09-JUN-2003"
FT   CDS             complement(join(11261441..11261587,11262028..11262099,
FT                   11269664..11269732,11270062..11270229,11274490..11274599,
FT                   11275856..11275938,11276750..11277003,11281536..11281838,
FT                   11284534..11284695,11289819..11289901,11292971..11293121,
FT                   11294703..11294756,11296550..11296599,11298116..11298190,
FT                   11342315..11342501))
FT                   /codon_start=1
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /product="golgi phosphoprotein 4, isoform CRA_a"
FT                   /note="gene_id=mCG9823.3 transcript_id=mCT185530.0
FT                   protein_id=mCP106788.0 isoform=CRA_a"
FT                   /protein_id="EDL15471.1"
FT                   /translation="MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYLELQTQLRKAEA
FT                   VALKYQQHQDSLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGR
FT                   QDSNSRYSALNVQHQMLKSQHEELRKQHSDLEEEHRKQGEDFSRTFNDHKQRYLQLQQE
FT                   KEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKTQVAEYKQLKDTLNRIPSFRNP
FT                   DPVEQQNVTFPHGTHPPQGYNGREKLTGELQEVQPNHEAGPRRMEEKPLSSMQKDAGFQ
FT                   ALEEQNQVEPREPEERQVEEEHRKALEEEEMEQVGQAEHLEEEHDPSPEEQDRDWRDQQ
FT                   GQNAAHLLDGHPQAEVEHSTKAATNFQSPYEEQLEQQRLAARRDEEAQRLREHQEALHQ
FT                   QRLHGQLLRQQQQQQFLAREMAQQKQVAHEDGQQQHQEQLRQQAHYNAVENDIAQGVED
FT                   QGIPEEEGGAYDRDNQRQDEAEGDPGNRQELREPGHQEGDPEVEADRAAVEDINPADDP
FT                   NNQGEDEFEEAEQVREENLPEESEEQKQSEAKQGNVEMDEHLVMAGNPDQQEDNVDEQY
FT                   QDEGEEEVQEDLTEEKKREMEHNVEETYGEHPDDKNNDGEEQGVHNRVHPKGRQEHYEE
FT                   EEDEEDGAAVAEKSHRRAEM"
FT   CDS             complement(join(11261441..11261587,11262028..11262099,
FT                   11269664..11269732,11270062..11270229,11274490..11274599,
FT                   11275856..11275938,11276750..11277003,11281536..11281838,
FT                   11284534..11284695,11288965..11289048,11289819..11289901,
FT                   11292971..11293121,11294703..11294756,11296550..11296599,
FT                   11298116..11298190,11342315..11342501))
FT                   /codon_start=1
FT                   /gene="Golph4"
FT                   /locus_tag="mCG_9823"
FT                   /product="golgi phosphoprotein 4, isoform CRA_b"
FT                   /note="gene_id=mCG9823.3 transcript_id=mCT9794.2
FT                   protein_id=mCP17204.2 isoform=CRA_b"
FT                   /protein_id="EDL15472.1"
FT                   /translation="MGNGMCSRKQKRIFQTLLLLTVVFGFLYGAMLYLELQTQLRKAEA
FT                   VALKYQQHQDSLSAQLQVVYEHRSRLEKSLQKERLEHKKAKEDFLVYKLEAQETLNKGR
FT                   QDSNSRYSALNVQHQMLKSQHEELRKQHSDLEEEHRKQGEDFSRTFNDHKQRYLQLQQE
FT                   KEQELSKLKETVYNLREENRQLRKAHQDIHTQLQDVKQQHKNLLSEHEQLVVTLEDHKS
FT                   ALAAAQTQVAEYKQLKDTLNRIPSFRNPDPVEQQNVTFPHGTHPPQGYNGREKLTGELQ
FT                   EVQPNHEAGPRRMEEKPLSSMQKDAGFQALEEQNQVEPREPEERQVEEEHRKALEEEEM
FT                   EQVGQAEHLEEEHDPSPEEQDRDWRDQQGQNAAHLLDGHPQAEVEHSTKAATNFQSPYE
FT                   EQLEQQRLAARRDEEAQRLREHQEALHQQRLHGQLLRQQQQQQFLAREMAQQKQVAHED
FT                   GQQQHQEQLRQQAHYNAVENDIAQGVEDQGIPEEEGGAYDRDNQRQDEAEGDPGNRQEL
FT                   REPGHQEGDPEVEADRAAVEDINPADDPNNQGEDEFEEAEQVREENLPEESEEQKQSEA
FT                   KQGNVEMDEHLVMAGNPDQQEDNVDEQYQDEGEEEVQEDLTEEKKREMEHNVEETYGEH
FT                   PDDKNNDGEEQGVHNRVHPKGRQEHYEEEEDEEDGAAVAEKSHRRAEM"
FT   gene            11472907..12102033
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /note="gene_id=mCG51205.2"
FT   mRNA            join(11472907..11473338,11530839..11530980,
FT                   11613853..11613886,11712877..11713125,11802300..11802496,
FT                   11821268..11821388,11873356..11873526,11926454..11926573,
FT                   11979958..11980119,11984456..11984590,12009363..12009389,
FT                   12017706..12017824,12036699..12036848,12048101..12048208,
FT                   12050200..12050324,12099504..12102033)
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, transcript variant mCT150123"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT150123.1 created
FT                   on 27-AUG-2002"
FT   mRNA            join(<11472934..11473338,11530839..11530980,
FT                   11613853..11613886,11712877..11713125,11802300..11802496,
FT                   11821268..11821388,11873356..11873522,11926454..11926573,
FT                   11979958..11980119,11984456..11984590,12009363..12009389,
FT                   12017706..12017824,12036699..12036848,12048101..12048208,
FT                   12050200..12050324,12099504..12100666)
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, transcript variant mCT190982"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT190982.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<11473946..11474100,11530839..11530980,
FT                   11613853..11613886,11712877..11713125,11802300..11802496,
FT                   11821268..11821388,11873356..11873522,11926454..11926573,
FT                   11979958..11980119,11984456..11984590,12009363..12009389,
FT                   12017706..12017824,12036699..12036848,12048101..12048208,
FT                   12050200..12050324,12099504..12100665)
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, transcript variant mCT190983"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT190983.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(11473947..11474100,11530839..11530980,
FT                   11613853..11613886,11712877..11713125,11802300..11802496,
FT                   11821268..11821388,11873356..11873526,11926454..11926573,
FT                   11979958..11980119,11984456..11984590,12009363..12009389,
FT                   12017706..12017824,12036699..12036848,12048101..12048208,
FT                   12050200..12050324,12099504..12102033)
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, transcript variant mCT51388"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT51388.2 created
FT                   on 27-AUG-2002"
FT   CDS             join(11530855..11530980,11613853..11613886,
FT                   11712877..11713125,11802300..11802496,11821268..11821388,
FT                   11873356..11873526,11926454..11926573,11979958..11980119,
FT                   11984456..11984590,12009363..12009389,12017706..12017824,
FT                   12036699..12036848,12048101..12048208,12050200..12050324,
FT                   12099504..12100206)
FT                   /codon_start=1
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT150123.1
FT                   protein_id=mCP65648.1 isoform=CRA_a"
FT                   /protein_id="EDL15467.1"
FT                   /translation="MFRCWSAILILGFIFLASEGRPTKESGYGLKSYQPLTRLRHKQEK
FT                   SQESSRIKEFLIHDGPFGSCENKYCGLGRHCVINRETRHAECACMDLCKQHYKPVCGSD
FT                   GEFYENHCEVHRAACLKKQKITIVHNEDCFFEGDNCMAIEYSKMKSMLLDLQNQKYITQ
FT                   ENENPNSDDISRKKPLVDQMFKYFDADSNGLVDINELTQVIKQEELNKDLSDCTLYDLL
FT                   KYDDFNADKHLALEEFYRAFQVIQLSLPEDQRVSITAATVGQSAVLSCAIVGTLRPPII
FT                   WKRNNIVLNNLDLEDINVRFGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNV
FT                   PPVIRVYPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEV
FT                   HISNVRYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVF
FT                   YEDGIKVIQPTECEFQRHIKPSEKLLGYQDEVCPKAEEDEVQRCVWASAVNVKDKFIYV
FT                   AQPTLDRILIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVIT
FT                   LASGNVPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMRFGFILHKDESALHKIDLETM
FT                   SYIKTINLKDSRCIPLSLAYTHLGGYYFISCKADITGATPPQLVVDSVTDSIIGFNSDV
FT                   TGTPYVSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAH
FT                   QYNIYGSSSQQTDVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLM
FT                   TPSKDSLFILDGRLNKLNCEITEVQKGNTVVWVGDA"
FT   CDS             join(11530855..11530980,11613853..11613886,
FT                   11712877..11713125,11802300..11802496,11821268..11821388,
FT                   11873356..11873526,11926454..11926573,11979958..11980119,
FT                   11984456..11984590,12009363..12009389,12017706..12017824,
FT                   12036699..12036848,12048101..12048208,12050200..12050324,
FT                   12099504..12100206)
FT                   /codon_start=1
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT51388.2
FT                   protein_id=mCP38004.2 isoform=CRA_a"
FT                   /protein_id="EDL15470.1"
FT                   /translation="MFRCWSAILILGFIFLASEGRPTKESGYGLKSYQPLTRLRHKQEK
FT                   SQESSRIKEFLIHDGPFGSCENKYCGLGRHCVINRETRHAECACMDLCKQHYKPVCGSD
FT                   GEFYENHCEVHRAACLKKQKITIVHNEDCFFEGDNCMAIEYSKMKSMLLDLQNQKYITQ
FT                   ENENPNSDDISRKKPLVDQMFKYFDADSNGLVDINELTQVIKQEELNKDLSDCTLYDLL
FT                   KYDDFNADKHLALEEFYRAFQVIQLSLPEDQRVSITAATVGQSAVLSCAIVGTLRPPII
FT                   WKRNNIVLNNLDLEDINVRFGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNV
FT                   PPVIRVYPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEV
FT                   HISNVRYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVF
FT                   YEDGIKVIQPTECEFQRHIKPSEKLLGYQDEVCPKAEEDEVQRCVWASAVNVKDKFIYV
FT                   AQPTLDRILIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVIT
FT                   LASGNVPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMRFGFILHKDESALHKIDLETM
FT                   SYIKTINLKDSRCIPLSLAYTHLGGYYFISCKADITGATPPQLVVDSVTDSIIGFNSDV
FT                   TGTPYVSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAH
FT                   QYNIYGSSSQQTDVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLM
FT                   TPSKDSLFILDGRLNKLNCEITEVQKGNTVVWVGDA"
FT   CDS             join(<11926456..11926573,11979958..11980119,
FT                   11984456..11984590,12009363..12009389,12017706..12017824,
FT                   12036699..12036848,12048101..12048208,12050200..12050324,
FT                   12099504..12100206)
FT                   /codon_start=1
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT190982.0
FT                   protein_id=mCP111950.0 isoform=CRA_b"
FT                   /protein_id="EDL15468.1"
FT                   /translation="FGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNVPPVIR
FT                   VYPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNV
FT                   RYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGI
FT                   KVIQPTECEFQRHIKPSEKLLGYQDEVCPKAEEDEVQRCVWASAVNVKDKFIYVAQPTL
FT                   DRILIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVITLASGN
FT                   VPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMRFGFILHKDESALHKIDLETMSYIKT
FT                   INLKDSRCIPLSLAYTHLGGYYFISCKADITGATPPQLVVDSVTDSIIGFNSDVTGTPY
FT                   VSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAHQYNIY
FT                   GSSSQQTDVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLMTPSKD
FT                   SLFILDGRLNKLNCEITEVQKGNTVVWVGDA"
FT   CDS             join(<11926456..11926573,11979958..11980119,
FT                   11984456..11984590,12009363..12009389,12017706..12017824,
FT                   12036699..12036848,12048101..12048208,12050200..12050324,
FT                   12099504..12100206)
FT                   /codon_start=1
FT                   /gene="Fstl5"
FT                   /locus_tag="mCG_51205"
FT                   /product="follistatin-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG51205.2 transcript_id=mCT190983.0
FT                   protein_id=mCP111951.0 isoform=CRA_b"
FT                   /protein_id="EDL15469.1"
FT                   /translation="FGDDGSLYITKVTTVHMGNYTCYADGYENVRQTHIFQVNVPPVIR
FT                   VYPESQAREPGVTASLRCHAEGIPDPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNV
FT                   RYEDTGAYTCIARNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGI
FT                   KVIQPTECEFQRHIKPSEKLLGYQDEVCPKAEEDEVQRCVWASAVNVKDKFIYVAQPTL
FT                   DRILIVDVQSQKVVQAVSTDPVPVKLHYDKSHDQVWVLSWGSMEKTSPTLQVITLASGN
FT                   VPHHTIHTQPVGKQFDRVDDFFIPTPTLIITHMRFGFILHKDESALHKIDLETMSYIKT
FT                   INLKDSRCIPLSLAYTHLGGYYFISCKADITGATPPQLVVDSVTDSIIGFNSDVTGTPY
FT                   VSPDGHYLVSVNDVKGLVRVQYITIRGEILDAFDIHTNLHISDLAFQPSFTEAHQYNIY
FT                   GSSSQQTDVLFVELSSGKVKMIKSLKEPLKTEDWPWSQKNRHIQGSGLFGQYLMTPSKD
FT                   SLFILDGRLNKLNCEITEVQKGNTVVWVGDA"
FT   gene            12214465..12214811
FT                   /pseudo
FT                   /locus_tag="mCG_53463"
FT                   /note="gene_id=mCG53463.2"
FT   mRNA            12214465..12214811
FT                   /pseudo
FT                   /locus_tag="mCG_53463"
FT                   /note="gene_id=mCG53463.2 transcript_id=mCT53646.2 created
FT                   on 28-MAR-2003"
FT   gene            13407157..13407606
FT                   /pseudo
FT                   /locus_tag="mCG_49957"
FT                   /note="gene_id=mCG49957.1"
FT   mRNA            13407157..13407606
FT                   /pseudo
FT                   /locus_tag="mCG_49957"
FT                   /note="gene_id=mCG49957.1 transcript_id=mCT50140.2 created
FT                   on 28-MAR-2003"
FT   gene            13534961..13535735
FT                   /pseudo
FT                   /locus_tag="mCG_51415"
FT                   /note="gene_id=mCG51415.1"
FT   mRNA            13534961..13535735
FT                   /pseudo
FT                   /locus_tag="mCG_51415"
FT                   /note="gene_id=mCG51415.1 transcript_id=mCT51598.2 created
FT                   on 28-MAR-2003"
FT   gene            complement(14211845..14212342)
FT                   /pseudo
FT                   /locus_tag="mCG_1032226"
FT                   /note="gene_id=mCG1032226.1"
FT   mRNA            complement(14211845..14212342)
FT                   /pseudo
FT                   /locus_tag="mCG_1032226"
FT                   /note="gene_id=mCG1032226.1 transcript_id=mCT149930.1
FT                   created on 09-APR-2003"
FT   gene            14270996..14272210
FT                   /pseudo
FT                   /locus_tag="mCG_18108"
FT                   /note="gene_id=mCG18108.1"
FT   mRNA            14270996..14272210
FT                   /pseudo
FT                   /locus_tag="mCG_18108"
FT                   /note="gene_id=mCG18108.1 transcript_id=mCT19815.1 created
FT                   on 28-MAR-2003"
FT   gene            complement(14410801..>14521688)
FT                   /locus_tag="mCG_18109"
FT                   /note="gene_id=mCG18109.1"
FT   mRNA            complement(join(14410801..14412843,14414841..14415140,
FT                   14417145..14417704,14418246..14418471,14422527..14422679,
FT                   14427200..14427406,14429254..14429477,14431393..14431516,
FT                   14431603..14431814,14433923..14434306,14436016..14436256,
FT                   14436816..14436973,14439983..14440229,14440668..14440776,
FT                   14440871..14441074,14441166..14441273,14442456..14442620,
FT                   14442980..14443114,14446363..14446521,14447245..14447381,
FT                   14452884..14453061,14461125..14461256,14521521..>14521688))
FT                   /locus_tag="mCG_18109"
FT                   /product="mCG18109"
FT                   /note="gene_id=mCG18109.1 transcript_id=mCT19889.1 created
FT                   on 09-APR-2003"
FT   CDS             complement(join(14412818..14412843,14414841..14415140,
FT                   14417145..14417704,14418246..14418471,14422527..14422679,
FT                   14427200..14427406,14429254..14429477,14431393..14431516,
FT                   14431603..14431814,14433923..14434306,14436016..14436256,
FT                   14436816..14436973,14439983..14440229,14440668..14440776,
FT                   14440871..14441074,14441166..14441273,14442456..14442620,
FT                   14442980..14443114,14446363..14446521,14447245..14447381,
FT                   14452884..14453061,14461125..14461256,14521521..>14521688))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18109"
FT                   /product="mCG18109"
FT                   /note="gene_id=mCG18109.1 transcript_id=mCT19889.1
FT                   protein_id=mCP17185.3"
FT                   /protein_id="EDL15466.1"
FT                   /translation="VDYMDENEEYFQRQASHRQSRRRFRKINQKGERQTIIDTVDPYPV
FT                   GKPPLPRGYHTLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATES
FT                   EAGDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLL
FT                   EFMHQLPAFANMTMSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYP
FT                   DGKAEILCMGNSFGVSPTMDKEYMKGVMRTKVDDCQQDYCRILNQVEKNMQKVEEEGEI
FT                   VMVKEHRELDRTGTRKGHIVIKGTSERLTMHLVEEHSVVDPTFIEDFLLTYRTFLSSPM
FT                   EVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAMTRFLEEFENNLEREKMGGH
FT                   LRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSCSKATEAGLK
FT                   RGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPH
FT                   LPKIGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILP
FT                   QKPYNDIGIGQSQDDSIVGLRQTKHIPAALPVSGTLSSSNPDLLQSHHRILDFSTTPDL
FT                   PDQVLRVFKADQQSRYIMISKDTTAKEVVIQAIREFAVTATPEQYSLCEVSVTPEGVIK
FT                   QRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDEDAQELLRESQISLLQLSTVEVAT
FT                   QLSMRNFELFRNIEPTEYIDDLFKLKSKTSCANLKKFEEVINQETFWVASEILRETNQL
FT                   KRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDLQ
FT                   DLFDPSRNMAKYRNVLSGQNLQPPVIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMI
FT                   AKEIRHVGRMASVNMDPALMFRTRSLSQGSANATVLDVAQTGGHKKRVRRSSFLNAKKL
FT                   YEDAQMARKVKQYLSNLELEMDEESLQTLSLQCEPATSTLPKNPGDKKPVKSETSPVAP
FT                   RAGPQQKVQPQQPLAQPQPPHKVSQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKK
FT                   ILSLSEEGSLERHRKQAEDTISNASSQLSSPPTSPQSSPRKGYALALSGTVDNFSDSGH
FT                   SEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVESNLGVGRMERRTLMEPDQYSLGS
FT                   YAPVSESRGLYAAATVISSPSTEELSHDQGDRASLDAADSGRGSWTSCSSGSHDNIQTI
FT                   QHQRSWETLPFGHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQS
FT                   RASWASSTGYWGEDSEGDTGTIKRRGGKDVSAEAESSSMVPVTTEEAKPVPMPAHIAVT
FT                   PSTTKGLIARKEGRYREPPPTPPGYVGIPIADFPEGPCHPARKPPDYNVALQRSRMVAR
FT                   PTEAPAPGQTPPAAAASRPGSKPQWHKPSDADPRLAPFQPQGFAGAEEDEDEQVSAV"
FT   gene            <14561341..14603037
FT                   /locus_tag="mCG_1032401"
FT                   /note="gene_id=mCG1032401.1"
FT   mRNA            join(<14561341..14561978,14597287..14597671,
FT                   14602598..14603037)
FT                   /locus_tag="mCG_1032401"
FT                   /product="mCG1032401"
FT                   /note="gene_id=mCG1032401.1 transcript_id=mCT150105.1
FT                   created on 27-MAR-2003"
FT   CDS             <14597365..14597577
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032401"
FT                   /product="mCG1032401"
FT                   /note="gene_id=mCG1032401.1 transcript_id=mCT150105.1
FT                   protein_id=mCP65841.0"
FT                   /protein_id="EDL15465.1"
FT                   /translation="ETCIQRTEAPVRACSERDVTSANSASSHGLHQQCEAGSGFFISVI
FT                   SGAPITTAHRGGKTSEKCQRMDIYH"
FT   gene            complement(<14812819..14922206)
FT                   /locus_tag="mCG_20638"
FT                   /note="gene_id=mCG20638.2"
FT   mRNA            complement(join(<14812819..14812894,14815282..14815397,
FT                   14818701..14818901,14832622..14832778,14833714..14835034,
FT                   14842116..14842285,14842403..14842549,14845985..14846073,
FT                   14846429..14846630,14853494..14853623,14859367..14859438,
FT                   14861003..14861092,14861251..14861351,14865597..14865668,
FT                   14865764..14865864,14868372..14868521,14871334..14871460,
FT                   14921565..14921617,14921656..14921752,14922035..14922206))
FT                   /locus_tag="mCG_20638"
FT                   /product="mCG20638"
FT                   /note="gene_id=mCG20638.2 transcript_id=mCT22063.2 created
FT                   on 15-NOV-2002"
FT   CDS             complement(join(<14812819..14812894,14815282..14815397,
FT                   14818701..14818901,14832622..14832778,14833714..14835034,
FT                   14842116..14842285,14842403..14842549,14845985..14846073,
FT                   14846429..14846630,14853494..14853623,14859367..14859438,
FT                   14861003..14861092,14861251..14861351,14865597..14865668,
FT                   14865764..14865864,14868372..14868521,14871334..14871460,
FT                   14921565..14921617,14921656..14921752,14922035..14922129))
FT                   /codon_start=1
FT                   /locus_tag="mCG_20638"
FT                   /product="mCG20638"
FT                   /note="gene_id=mCG20638.2 transcript_id=mCT22063.2
FT                   protein_id=mCP17206.2"
FT                   /protein_id="EDL15464.1"
FT                   /translation="MAPTLLQKLFNKRGGGAASAQARPPKEEPAFRVSEPRTALSLFYC
FT                   SFWVEPQRRPPSLLSRSPQVPHKISPYAPVSEHVWDRWSCSEFGLSDIRLLVYQDCERR
FT                   GRQVMFDSRAVQKMEEAAAQQKAEDVPIKMSARCCQESSSSSGSSSSGSSSSHGFGGSL
FT                   QHAKQQLPKYQYTRPASDVSMLGEMMFGSVAMSYKGSTLKIHYIRSPPQLMISKVFSAT
FT                   MGSFCGSTNNLQDSFEYINQDPQAGKLNTNQYNLGPFRTGSNLGLLQVCSGKLLQGLSE
FT                   GGPLRLTRSASFFAAHSTPVDMPSRGQNEDRDSGIARSASLSSLLITPFPSPSSSTSSS
FT                   SSYQRRWLRSQTTSLENGIFPRRSTDETFSLAEETCSSNPAMVRRKKIAISIIFSLCER
FT                   EAAQRDFQDFFFSHFPLFESHMNRLKGAIEKAMISCRKISESSLRVQFYVSRLMEALGE
FT                   FRGTIWNLYSVPRIAEPVWLTMMSNTLEKNQLCQRFLKEFILLIEQVNKNQFFAALLTA
FT                   VLTYHLAWVPTVMPVDHPPIKAFSEKRTSQSVNMLAKTHPYNPLWAQLGDLYGAIGSPV
FT                   RLTRTVVIGKQKDLVQRILYVLTYFLRCSELQENQLSWSGNPSEDDQVINGSKIITALE
FT                   KGEVEESEYVVVTVSSEPALVPPILPQGTAERRSPEPTVVAEISEGVNTSELGHKPEKN
FT                   RCKRPEQNSEASSMGFQEAEPDSSWIPQGIFCEDKQNDQEATQDCSSSPPSCEVPRVRR
FT                   RMDQQTLHSKLHGETLKKRAEQSAAWPCPDRHSQEDPPVEKVTFHIGSSISPESDFESR
FT                   TKRMEERLKACGHFHGASASASSSMDTGLTQEQQGSGCSFKADFEKDITPQDHSSGGEG
FT                   VSEDRGLRANMTHAVGQLSQVDGPLAHSLCAAESGRRLLEQTRDVQLKGYKGPSSEPVP
FT                   NRCRQQGGLLIAADVPYGDASGKGNYRSEGDIPRNESLDSALGDSDDEACVLALLELGH
FT                   SCDRTEESLEVELPLPRSQSTSKANVRNFGRSLLAGYCATYMPDLVLHGTSSDEKLKQC
FT                   LAADLVHTVHHPVLDEPIAEAVCIIADTDKWTVQVATSQRKVTDTMKLGQDVLVSSQVS
FT                   SLLQSILQLYKLHLPADFCIMHLEDRLQEMYLKSKMLSEYLRGHTRVHVKELSVVLGIE
FT                   SNDLPLLTAIASTHSPYVAQILL"
FT   gene            14922717..>14927346
FT                   /locus_tag="mCG_1032285"
FT                   /note="gene_id=mCG1032285.0"
FT   mRNA            join(14922717..14923721,14926777..>14927346)
FT                   /locus_tag="mCG_1032285"
FT                   /product="mCG1032285"
FT                   /note="gene_id=mCG1032285.0 transcript_id=mCT149989.0
FT                   created on 01-OCT-2002"
FT   CDS             join(14923569..14923721,14926777..14927346)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032285"
FT                   /product="mCG1032285"
FT                   /note="gene_id=mCG1032285.0 transcript_id=mCT149989.0
FT                   protein_id=mCP65595.1"
FT                   /protein_id="EDL15463.1"
FT                   /translation="MTHQDFLDLIKGKLRMEKHGSAVTNISCVCTGLEISSQQVDQKAH
FT                   NQVQLQKPTCILAWCWFERERDSCWIPRSFAAEDNLGLPMPQPLLLRLQCVPPFLAQNL
FT                   KAWQTRLNSELTLKEGREKKLHKLPNQHTYHTCIFCFIGYSLKVLPFPPPSPSYFGGVV
FT                   IKQCFCLLSYLMTLSSFLFRNRIFCVPHTGLKFKILLTSPPSYQGLQMCSIMPHHSFIL
FT                   VLCVHDFCVCVCGCVVEG"
FT   gene            14937108..14937687
FT                   /pseudo
FT                   /locus_tag="mCG_1032223"
FT                   /note="gene_id=mCG1032223.1"
FT   mRNA            14937108..14937687
FT                   /pseudo
FT                   /locus_tag="mCG_1032223"
FT                   /note="gene_id=mCG1032223.1 transcript_id=mCT149927.1
FT                   created on 28-MAR-2003"
FT   gene            14945634..14958114
FT                   /locus_tag="mCG_20642"
FT                   /note="gene_id=mCG20642.1"
FT   mRNA            join(14945634..14945759,14947843..14947982,
FT                   14951782..14951973,14952892..14953014,14953152..14953258,
FT                   14954724..14954865,14956738..14956824,14956909..14956951,
FT                   14957497..14958114)
FT                   /locus_tag="mCG_20642"
FT                   /product="mCG20642"
FT                   /note="gene_id=mCG20642.1 transcript_id=mCT22067.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(14945675..14945759,14947843..14947982,
FT                   14951782..14951973,14952892..14953014,14953152..14953258,
FT                   14954724..14954865,14956738..14956824,14956909..14956951,
FT                   14957497..14957585)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20642"
FT                   /product="mCG20642"
FT                   /note="gene_id=mCG20642.1 transcript_id=mCT22067.2
FT                   protein_id=mCP17194.2"
FT                   /protein_id="EDL15462.1"
FT                   /translation="MSHASPAAKPSNSKNPRVFFDVDIGGERVGRIVLELFADIVPKTA
FT                   ENFRALCTGEKGTGSTTGKPLHFKGCPFHRQHDREGLLSMANAGPNTNGSQFFITTVPT
FT                   PHLDGKHVVFGQVIKGLGVARTLENVEVNGEKPAKLCVIAECGELKEGDDWGIFPKDGS
FT                   GDSHPDFPEDADIDLKDVDKILLISEDLKNIGNTFFKSQNWEMAIKKYAKVLRYVDSSK
FT                   AVIEKADRSRLQPIALSCVLNIGACKLKMSNWQGAIDSCLEALEMDPSNTKALYRKAQG
FT                   WQGLKEYDQALADLKKAQEIAPGDKAIQAELLKVKQMIKAQKDKEKAVYAKMFA"
FT   gene            complement(14957819..14983356)
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /note="gene_id=mCG20640.1"
FT   mRNA            complement(join(14957819..14958631,14959371..14959592,
FT                   14960096..14960278,14964263..14964431,14966376..14966519,
FT                   14968085..14968225,14969463..14969609,14970386..14970463,
FT                   14972744..14972862,14973276..14973357,14977172..14977401,
FT                   14977975..14978112,14982953..14983356))
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /product="electron transferring flavoprotein,
FT                   dehydrogenase, transcript variant mCT22065"
FT                   /note="gene_id=mCG20640.1 transcript_id=mCT22065.2 created
FT                   on 01-OCT-2002"
FT   mRNA            complement(join(14958278..14958631,14959371..14959592,
FT                   14960096..14960278,14964263..14964431,14966376..14966519,
FT                   14968085..14968225,14969463..14969609,14970386..14970463,
FT                   14972744..14972862,14973276..14973357,14977172..14977401,
FT                   14977975..14978112,14982916..>14983132))
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /product="electron transferring flavoprotein,
FT                   dehydrogenase, transcript variant mCT190975"
FT                   /note="gene_id=mCG20640.1 transcript_id=mCT190975.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(14958468..14958631,14959371..14959592,
FT                   14960096..14960278,14964263..14964431,14966376..14966519,
FT                   14968085..14968225,14969463..14969609,14970386..14970463,
FT                   14972744..14972862,14973276..14973357,14977172..14977401,
FT                   14977975..14978112,14982953..14982986))
FT                   /codon_start=1
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /product="electron transferring flavoprotein,
FT                   dehydrogenase, isoform CRA_b"
FT                   /note="gene_id=mCG20640.1 transcript_id=mCT22065.2
FT                   protein_id=mCP17187.2 isoform=CRA_b"
FT                   /protein_id="EDL15461.1"
FT                   /translation="MLVRLTKLSCPAYHWFHALKIKKCLPLCAPRCSSTSAVPQITTHY
FT                   TVHPREKDKRWEGVNMERFAEEADVVIVGAGPAGLSAAIRLKQLAAEQGKDIRVCLVEK
FT                   AAQIGAHTLSGACLDPAAFKELFPDWKEKGAPLNTPVTEDRFAILTEKHRIPVPILPGL
FT                   PMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLYHEDGSVKGIATNDVGIQK
FT                   DGAPKTTFERGLELHAKVTVFAEGCHGHLAKQLYKKFDLRASCDAQTYGIGLKELWIID
FT                   EKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYLSPFREFQ
FT                   RWKHHPSIQPTLEGGKRIAYGARALNEGGLQSIPKLTFPGGLLIGCSPGFMNVPKIKGT
FT                   HTAMKSGSLAAESIFKQLTSENLQSKTTGLHVTEYEDNLKQSWVWKELHAVRNIRPSCH
FT                   GILGVYGGMIYTGIFYWILRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPDGQISFDL
FT                   LSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLSIYDGPEQRFCPAGVYEFVPLEQGDGF
FT                   RLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM"
FT   CDS             complement(join(14958468..14958631,14959371..14959592,
FT                   14960096..14960278,14964263..14964431,14966376..14966519,
FT                   14968085..14968225,14969463..14969609,14970386..14970463,
FT                   14972744..14972862,14973276..14973357,14977172..14977401,
FT                   14977975..14978112,14982916..>14982970))
FT                   /codon_start=1
FT                   /gene="Etfdh"
FT                   /locus_tag="mCG_20640"
FT                   /product="electron transferring flavoprotein,
FT                   dehydrogenase, isoform CRA_a"
FT                   /note="gene_id=mCG20640.1 transcript_id=mCT190975.0
FT                   protein_id=mCP111944.0 isoform=CRA_a"
FT                   /protein_id="EDL15460.1"
FT                   /translation="PSCPALVRRNSWWGQKEQAYHWFHALKIKKCLPLCAPRCSSTSAV
FT                   PQITTHYTVHPREKDKRWEGVNMERFAEEADVVIVGAGPAGLSAAIRLKQLAAEQGKDI
FT                   RVCLVEKAAQIGAHTLSGACLDPAAFKELFPDWKEKGAPLNTPVTEDRFAILTEKHRIP
FT                   VPILPGLPMNNHGNYIVRLGHLVSWMGEQAEALGVEVYPGYAAAEVLYHEDGSVKGIAT
FT                   NDVGIQKDGAPKTTFERGLELHAKVTVFAEGCHGHLAKQLYKKFDLRASCDAQTYGIGL
FT                   KELWIIDEKKWKPGRVDHTVGWPLDRHTYGGSFLYHLNEGEPLVAVGFVVGLDYQNPYL
FT                   SPFREFQRWKHHPSIQPTLEGGKRIAYGARALNEGGLQSIPKLTFPGGLLIGCSPGFMN
FT                   VPKIKGTHTAMKSGSLAAESIFKQLTSENLQSKTTGLHVTEYEDNLKQSWVWKELHAVR
FT                   NIRPSCHGILGVYGGMIYTGIFYWILRGMEPWTLKHKGSDSDQLKPAKDCTPIEYPKPD
FT                   GQISFDLLSSVALSGTNHEHDQPAHLTLKDDSIPVNRNLSIYDGPEQRFCPAGVYEFVP
FT                   LEQGDGFRLQINAQNCVHCKTCDIKDPSQNINWVVPEGGGGPAYNGM"
FT   gene            14983534..14987253
FT                   /locus_tag="mCG_20639"
FT                   /note="gene_id=mCG20639.2"
FT   mRNA            join(14983534..14983791,14985564..14987253)
FT                   /locus_tag="mCG_20639"
FT                   /product="mCG20639"
FT                   /note="gene_id=mCG20639.2 transcript_id=mCT22064.2 created
FT                   on 01-OCT-2002"
FT   CDS             join(14983612..14983791,14985564..14985719)
FT                   /codon_start=1
FT                   /locus_tag="mCG_20639"
FT                   /product="mCG20639"
FT                   /note="gene_id=mCG20639.2 transcript_id=mCT22064.2
FT                   protein_id=mCP17207.1"
FT                   /protein_id="EDL15459.1"
FT                   /translation="MADSEEFRASSPPPPPPSSPSSGASSSSLSMPVSLGWRDPSRSPG
FT                   PTVDPLEQVELQIGDAAFSLTKLLEATSAVSAQVEELALKCTENARFLKTWRDLLKEGY
FT                   DSLKPDN"
FT   gene            complement(14989395..15086416)
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /note="gene_id=mCG20641.3"
FT   mRNA            complement(join(14989395..14992802,14996275..14996493,
FT                   14998616..14999026,15000868..15001097,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15035641..15035739,15054325..15054462,15086285..15086416))
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   transcript variant mCT22066"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT22066.3 created
FT                   on 17-APR-2003"
FT   mRNA            complement(join(<14992501..14992802,14996275..14996493,
FT                   14998616..14999026,15000868..15001097,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15031050..15031155,15035641..15035739,15054325..15054462,
FT                   15086285..>15086333))
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   transcript variant mCT190976"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT190976.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(14992501..14992802,14996275..14996493,
FT                   14998616..14999026,15000868..15001097,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15031050..15031155,15035641..15035739,15054325..15054462,
FT                   15086285..15086333))
FT                   /codon_start=1
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT190976.0
FT                   protein_id=mCP111945.0 isoform=CRA_b"
FT                   /protein_id="EDL15457.1"
FT                   /translation="MTSGPFFFCIFIIGKYFTLGSAQDVSCPLGSFPCGNMSRCLPQLL
FT                   HCNGVDDCGNRADEDHCGDNNGWSLQLDKYFANYYKLASTNSFEAETSECLVGSVPMHC
FT                   LCRDLELDCDEANLRAVPSVSSNVTVMSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIH
FT                   SVSVSAFRGLRSLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLN
FT                   SLILLVLMNNALTRLPDKPLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKN
FT                   KINYLNEHAFTHLQKLDELDLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFD
FT                   CLAKLKSLSLEGIEISNIQQRMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSL
FT                   ENLLASIIQRVFVWVVSAITCFGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGVYL
FT                   FVIGAFDLKFRGEYNKHAQPWMESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIVYP
FT                   FRCLRPRKCRTITVLIFIWIIGFIVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGA
FT                   QIYSVVIFLGINLVAFIIIVFSYGSMFYSVHQSSVTVTEIQKQVKKEVVLAKRFFFIVF
FT                   TDALCWIPIFILKFLSLLQVEIPDSITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQ
FT                   LWHNYRQRRSVDRKETQKAYAPSFIWVEMWPLQEMSSGFMKPGAFTDPCDLSLVSQSSR
FT                   LNSYS"
FT   CDS             complement(join(14992501..14992802,14996275..14996493,
FT                   14998616..14999026,15000868..15001097,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15035641..15035645))
FT                   /codon_start=1
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT22066.3
FT                   protein_id=mCP17193.3 isoform=CRA_c"
FT                   /protein_id="EDL15458.1"
FT                   /translation="MLSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIHSVSVSAFRGLR
FT                   SLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNA
FT                   LTRLPDKPLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINYLNEHAFT
FT                   HLQKLDELDLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDCLAKLKSLSLE
FT                   GIEISNIQQRMFRPLINLSHIYFKKFQYCGYAPHVRSCKPNTDGISSLENLLASIIQRV
FT                   FVWVVSAITCFGNIFVICMRPYIRSENKLHAMSIISLCCADCLMGVYLFVIGAFDLKFR
FT                   GEYNKHAQPWMESVHCQFMGSLAILSTEVSVLLLTFLTLEKYICIVYPFRCLRPRKCRT
FT                   ITVLIFIWIIGFIVAFAPLGNKEFFKNYYGTNGVCFPLHSEDTGSTGAQIYSVVIFLGI
FT                   NLVAFIIIVFSYGSMFYSVHQSSVTVTEIQKQVKKEVVLAKRFFFIVFTDALCWIPIFI
FT                   LKFLSLLQVEIPDSITSWVVIFILPINSALNPIIYTLTTRPFKEMIHQLWHNYRQRRSV
FT                   DRKETQKAYAPSFIWVEMWPLQEMSSGFMKPGAFTDPCDLSLVSQSSRLNSYS"
FT   mRNA            complement(join(15003993..15004801,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15035641..15035739,15054325..15054462,15086285..15086416))
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   transcript variant mCT181988"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT181988.0 created
FT                   on 17-APR-2003"
FT   CDS             complement(join(15004795..15004801,15004943..15005014,
FT                   15006086..15006157,15008745..15008816,15009942..15010013,
FT                   15011932..15012003,15015059..15015133,15016249..15016320,
FT                   15016408..15016479,15019500..15019571,15027285..15027356,
FT                   15035641..15035645))
FT                   /codon_start=1
FT                   /gene="Rxfp1"
FT                   /locus_tag="mCG_20641"
FT                   /product="relaxin/insulin-like family peptide receptor 1,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG20641.3 transcript_id=mCT181988.0
FT                   protein_id=mCP104910.0 isoform=CRA_a"
FT                   /protein_id="EDL15456.1"
FT                   /translation="MLSLQRNFIRTLPPNGFRKYHELQKLCLQNNRIHSVSVSAFRGLR
FT                   SLTKLYLSHNRITFLKPGVFEDLHRLEWLIIEDNHLSRISPLTFYGLNSLILLVLMNNA
FT                   LTRLPDKPLCQHMPRLHWLDFEGNRIHNLRNLTFISCNNLTVLVMRKNKINYLNEHAFT
FT                   HLQKLDELDLGSNKIENLPPNIFKDLKELSQLNISYNPIQKIEVNQFDCLAKLKSLSLE
FT                   GIEISNIQQRMFRPLINLSHIL"
FT   gene            complement(15156956..15186564)
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /note="gene_id=mCG20643.2"
FT   mRNA            complement(join(15156956..15157954,15160825..15160878,
FT                   15165071..15165168,15166480..15166599,15169148..15169266,
FT                   15170692..15170768,15171484..15171565,15175892..15175972,
FT                   15177739..15177838,15180084..15180206,15182987..15183155,
FT                   15186271..15186564))
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /product="transmembrane protein 144, transcript variant
FT                   mCT22068"
FT                   /note="gene_id=mCG20643.2 transcript_id=mCT22068.2 created
FT                   on 28-OCT-2002"
FT   mRNA            complement(join(15156956..15157954,15160825..15160878,
FT                   15165071..15165168,15166480..15166599,15169148..15169266,
FT                   15170692..15170768,15171484..15171565,15175892..15175972,
FT                   15177739..15177838,15180084..15180206,15182987..15183155,
FT                   15185406..>15185588))
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /product="transmembrane protein 144, transcript variant
FT                   mCT190980"
FT                   /note="gene_id=mCG20643.2 transcript_id=mCT190980.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(15157871..15157954,15160825..15160878,
FT                   15165071..15165168,15166480..15166599,15169148..15169266,
FT                   15170692..15170768,15171484..15171565,15175892..15175972,
FT                   15177739..15177838,15180084..15180206,15182987..>15183143))
FT                   /codon_start=1
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /product="transmembrane protein 144, isoform CRA_a"
FT                   /note="gene_id=mCG20643.2 transcript_id=mCT190980.0
FT                   protein_id=mCP111946.0 isoform=CRA_a"
FT                   /protein_id="EDL15454.1"
FT                   /translation="KHRSKVRRAAVCYPATMSSNATDLTTGYLSSAAAILLFGSNFVPL
FT                   KKYDTGDGMFLQWVLCAAIWLVALVVNLILHCPKFWPFAMLGGCIWATGNIAVVPIIKT
FT                   IGLGLGILIWGSFNTLTGWASSRFGWFGMDAEEVSKPMLNYVGAGLSVVSALTFLFIKS
FT                   EIPNNPGSSDTTPLMTEPVINRTEDRSADSSWVDRLSTTYHRIVGCSLAVISGILYGST
FT                   FVPIIYIKDHSRRNDSMYAGASQYDLDYVFAHSSGIFLTSTVYFVAYCVAMKNRPKLYP
FT                   EAVLPGLLSGVLWAIATCCWFIANHSLSAVISFPIITAGPGLIAALWGILIFKEIQGLR
FT                   NYLLMMLAFCIILAGALCTAFSKV"
FT   CDS             complement(join(15157871..15157954,15160825..15160878,
FT                   15165071..15165168,15166480..15166599,15169148..15169266,
FT                   15170692..15170768,15171484..15171565,15175892..15175972,
FT                   15177739..15177838,15180084..15180206,15182987..15183095))
FT                   /codon_start=1
FT                   /gene="Tmem144"
FT                   /locus_tag="mCG_20643"
FT                   /product="transmembrane protein 144, isoform CRA_b"
FT                   /note="gene_id=mCG20643.2 transcript_id=mCT22068.2
FT                   protein_id=mCP17200.2 isoform=CRA_b"
FT                   /protein_id="EDL15455.1"
FT                   /translation="MSSNATDLTTGYLSSAAAILLFGSNFVPLKKYDTGDGMFLQWVLC
FT                   AAIWLVALVVNLILHCPKFWPFAMLGGCIWATGNIAVVPIIKTIGLGLGILIWGSFNTL
FT                   TGWASSRFGWFGMDAEEVSKPMLNYVGAGLSVVSALTFLFIKSEIPNNPGSSDTTPLMT
FT                   EPVINRTEDRSADSSWVDRLSTTYHRIVGCSLAVISGILYGSTFVPIIYIKDHSRRNDS
FT                   MYAGASQYDLDYVFAHSSGIFLTSTVYFVAYCVAMKNRPKLYPEAVLPGLLSGVLWAIA
FT                   TCCWFIANHSLSAVISFPIITAGPGLIAALWGILIFKEIQGLRNYLLMMLAFCIILAGA
FT                   LCTAFSKV"
FT   gene            15230169..15290267
FT                   /gene="1110032E23Rik"
FT                   /locus_tag="mCG_20644"
FT                   /note="gene_id=mCG20644.1"
FT   mRNA            join(15230169..15231350,15254591..15254805,
FT                   15283478..15283704,15288177..15290267)
FT                   /gene="1110032E23Rik"
FT                   /locus_tag="mCG_20644"
FT                   /product="RIKEN cDNA 1110032E23"
FT                   /note="gene_id=mCG20644.1 transcript_id=mCT22069.2 created
FT                   on 30-AUG-2002"
FT   CDS             join(15230447..15231350,15254591..15254805,
FT                   15283478..15283704,15288177..15288384)
FT                   /codon_start=1
FT                   /gene="1110032E23Rik"
FT                   /locus_tag="mCG_20644"
FT                   /product="RIKEN cDNA 1110032E23"
FT                   /note="gene_id=mCG20644.1 transcript_id=mCT22069.2
FT                   protein_id=mCP17205.1"
FT                   /protein_id="EDL15453.1"
FT                   /translation="MTCPDKPGQLVNWFVCSLCAPRVCKLWSSRRPRTRRNLLLGTACA
FT                   IYLGFLVSQVGRGSFQHGQATDRGPPNGHDIFKVPFSEIPLDGTLAPPELQGNGSTLQP
FT                   NVVYITLRSKRSKPANIRGTVKPKRRKKYAVASAAPDQEVLVRPSLIQQEAARAADAEV
FT                   PGYVQGYLTKVGERPWRVLRGPGVRTRGSNLQQPRARESNIRIYSESAPSWLSKEDIRR
FT                   MRLLADSEVASILPISKSGTRLLVLEGSTSGSVPGCGPSPCGLLKQPLDMSEVFAFHLD
FT                   RILGLNRTLPSVSRKLEFIQDGRPRPIILWDSSLASASNDSHSSVKITWGTYQRLLKQK
FT                   CWLNGRVPRPEWDCTEIHHHEWSKMALFDFLLQIYNRLDTNCCGFRPRKEDACIQNGLR
FT                   SNCEDQTSVTLAHIIQRKNDPRHLVFINNKGFFDRSEDNLNFKLLEGIREFPESAVSVL
FT                   KSQHLRQKLLQSLFLDQVYWESQGGRQGIEKLIDVIERRARILITYINAHGARVLPMNE
FT                   "
FT   gene            15544193..15545819
FT                   /locus_tag="mCG_147526"
FT                   /note="gene_id=mCG147526.0"
FT   mRNA            join(15544193..15544291,15545134..15545819)
FT                   /locus_tag="mCG_147526"
FT                   /product="mCG147526"
FT                   /note="gene_id=mCG147526.0 transcript_id=mCT187789.0
FT                   created on 13-JAN-2004"
FT   CDS             join(15544252..15544291,15545134..15545330)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147526"
FT                   /product="mCG147526"
FT                   /note="gene_id=mCG147526.0 transcript_id=mCT187789.0
FT                   protein_id=mCP109370.0"
FT                   /protein_id="EDL15452.1"
FT                   /translation="MEWEAGADHVNKSAQRQAATIAATTTATRTTATTGTTKTATTATR
FT                   TTKTTATTKTATTTRAPTFYEYLKPPFKTPYIA"
FT   gene            complement(15619801..>15667317)
FT                   /locus_tag="mCG_145239"
FT                   /note="gene_id=mCG145239.0"
FT   mRNA            complement(join(15619801..15622884,15623945..15624048,
FT                   15667114..>15667317))
FT                   /locus_tag="mCG_145239"
FT                   /product="mCG145239"
FT                   /note="gene_id=mCG145239.0 transcript_id=mCT184663.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(15621051..>15621308)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145239"
FT                   /product="mCG145239"
FT                   /note="gene_id=mCG145239.0 transcript_id=mCT184663.0
FT                   protein_id=mCP105806.0"
FT                   /protein_id="EDL15451.1"
FT                   /translation="SCIILLHRNSILVSIFKRIPKRLRQFLTTKDTVHCIFLCPASLLY
FT                   NGCEILKASRSKLTVIPAQNRTINKTKQTKNSSYFDSQAE"
FT   gene            complement(16015619..>16123635)
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /note="gene_id=mCG21475.2"
FT   mRNA            complement(join(16015619..16015886,16016275..16016523,
FT                   16019035..16019149,16020001..16020248,16030174..16030372,
FT                   16034599..16034969,16035410..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..16123385))
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   transcript variant mCT21979"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT21979.1 created
FT                   on 28-AUG-2002"
FT   CDS             complement(join(16016278..16016523,16019035..16019149,
FT                   16020001..16020248,16030174..16030372,16034599..16034969,
FT                   16035410..16035616,16037089..16037199,16038001..16038105,
FT                   16038388..16038555,16049742..16049903,16054542..16054595,
FT                   16059743..16059939,16068664..16068903,16122444..16122584,
FT                   16123096..16123183))
FT                   /codon_start=1
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   isoform CRA_d"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT21979.1
FT                   protein_id=mCP11548.2 isoform=CRA_d"
FT                   /db_xref="GOA:G5E8H1"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001508"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR019594"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:95809"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8H1"
FT                   /protein_id="EDL15450.1"
FT                   /translation="MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFR
FT                   VGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFC
FT                   GTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQA
FT                   VLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQDLELKKERRVILDCERDKVNDIVDQ
FT                   VITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLE
FT                   EKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQ
FT                   GVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTL
FT                   TELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCG
FT                   FKYKLTIVGDGKYGARDADTKIWNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFM
FT                   SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEE
FT                   FEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIIS
FT                   SYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTY
FT                   MRSAEPSVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGY
FT                   GIATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSN
FT                   VAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMKVAKNAQNINPSSSQNSQNFATYKE
FT                   GYNVYGIESVKI"
FT   mRNA            complement(join(16019237..16020248,16030174..16030372,
FT                   16034599..16034969,16035410..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..>16123635))
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   transcript variant mCT190947"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190947.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16019988..16020248,16030174..16030372,
FT                   16034599..16034969,16035410..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..>16123258))
FT                   /codon_start=1
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190947.0
FT                   protein_id=mCP111895.0 isoform=CRA_b"
FT                   /protein_id="EDL15448.1"
FT                   /translation="GKRSKKEKEERETRGYFVDALLFLEMQKIMHISVLLSPVLWGLIF
FT                   GVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCS
FT                   QFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLS
FT                   LIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQ
FT                   DLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAN
FT                   VSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLR
FT                   KQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTIN
FT                   IMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNH
FT                   EMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGK
FT                   ADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV
FT                   FAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGC
FT                   DISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYG
FT                   TLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGKYAYLLEST
FT                   MNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRWVE"
FT   mRNA            complement(join(16032402..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..>16123449))
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   transcript variant mCT190946"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190946.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(16034064..16034969,16035410..16035616,
FT                   16037089..16037199,16038001..16038105,16038388..16038555,
FT                   16049742..16049903,16054542..16054595,16059743..16059939,
FT                   16068664..16068903,16122444..16122584,16123096..>16123523))
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   transcript variant mCT190948"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190948.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(16034562..16034969,16035410..16035616,
FT                   16037089..16037199,16038001..16038105,16038388..16038555,
FT                   16049742..16049903,16054542..16054595,16059743..16059939,
FT                   16068664..16068903,16122444..16122584,16123096..>16123258))
FT                   /codon_start=1
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190948.0
FT                   protein_id=mCP111896.0 isoform=CRA_c"
FT                   /protein_id="EDL15449.1"
FT                   /translation="GKRSKKEKEERETRGYFVDALLFLEMQKIMHISVLLSPVLWGLIF
FT                   GVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCS
FT                   QFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLS
FT                   LIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQ
FT                   DLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAN
FT                   VSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLR
FT                   KQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTIN
FT                   IMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNH
FT                   EMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGK
FT                   ADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV
FT                   FAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGC
FT                   DISPRLVTHLLQLCAF"
FT   CDS             complement(join(16035398..16035616,16037089..16037199,
FT                   16038001..16038105,16038388..16038555,16049742..16049903,
FT                   16054542..16054595,16059743..16059939,16068664..16068903,
FT                   16122444..16122584,16123096..>16123258))
FT                   /codon_start=1
FT                   /gene="Gria2"
FT                   /locus_tag="mCG_21475"
FT                   /product="glutamate receptor, ionotropic, AMPA2 (alpha 2),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21475.2 transcript_id=mCT190946.0
FT                   protein_id=mCP111894.0 isoform=CRA_a"
FT                   /protein_id="EDL15447.1"
FT                   /translation="GKRSKKEKEERETRGYFVDALLFLEMQKIMHISVLLSPVLWGLIF
FT                   GVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCS
FT                   QFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLS
FT                   LIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDETYRSLFQ
FT                   DLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGAN
FT                   VSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTATIKYTSALTYDAVQVMTEAFRNLR
FT                   KQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTIN
FT                   IMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNH
FT                   EMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVYGV
FT                   SF"
FT   gene            complement(16164296..>16234561)
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /note="gene_id=mCG114236.1"
FT   mRNA            complement(join(16164296..16165946,16171508..16171800,
FT                   16176380..16176532,16180756..16180896,16182298..16182380,
FT                   16182487..16182716,16198985..16199052,16200602..16200704,
FT                   16232914..16233064,16234460..>16234561))
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /product="glycine receptor, beta subunit, transcript
FT                   variant mCT190979"
FT                   /note="gene_id=mCG114236.1 transcript_id=mCT190979.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(16164820..16165946,16171508..16171800,
FT                   16176380..16176532,16180756..16180896,16182298..16182380,
FT                   16182487..16182716,16198985..16199052,16200602..16200708,
FT                   16232914..16233064,16234460..16234480))
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /product="glycine receptor, beta subunit, transcript
FT                   variant mCT115327"
FT                   /note="gene_id=mCG114236.1 transcript_id=mCT115327.0
FT                   created on 03-SEP-2002"
FT   CDS             complement(join(16165653..16165946,16171508..16171800,
FT                   16176380..16176532,16180756..16180896,16182298..16182380,
FT                   16182487..16182716,16198985..16199052,16200602..16200708,
FT                   16232914..16233035))
FT                   /codon_start=1
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /product="glycine receptor, beta subunit, isoform CRA_a"
FT                   /note="gene_id=mCG114236.1 transcript_id=mCT115327.0
FT                   protein_id=mCP65858.1 isoform=CRA_a"
FT                   /db_xref="GOA:P48168"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR008060"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="MGI:MGI:95751"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48168"
FT                   /protein_id="EDL15445.1"
FT                   /translation="MKFSLAISFFILMSLLFEDACAKEKSSKKGKGKKKQYLCPSQQSP
FT                   EDLARVPPNSTSNILNRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVN
FT                   IFLRQKWNDPRLKLPSDFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILL
FT                   FIFRDGDVLVSMRLSITLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQ
FT                   LEKIALPQFDIKKEDIEYGNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIV
FT                   VLSWLSFWINPDASAARVPLGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFG
FT                   FASLVEYAVVQVMLNNPKRVEAEKARIAKAEQADGKGGNAAKKNTVNGTGTPVHISTLQ
FT                   VGETRCKKVCTSKSDLRSNDFSIVGSLPRDFELSNYDCYGKPIEVNNGLGKPQAKNKKP
FT                   PPAKPVIPTAAKRIDLYARALFPFCFLFFNVIYWSIYL"
FT   CDS             complement(join(16165653..16165946,16171508..16171800,
FT                   16176380..16176532,16180756..16180896,16182298..16182380,
FT                   16182487..16182716,16198985..16199052,16200602..16200704,
FT                   16232914..>16232967))
FT                   /codon_start=1
FT                   /gene="Glrb"
FT                   /locus_tag="mCG_114236"
FT                   /product="glycine receptor, beta subunit, isoform CRA_b"
FT                   /note="gene_id=mCG114236.1 transcript_id=mCT190979.0
FT                   protein_id=mCP111934.0 isoform=CRA_b"
FT                   /protein_id="EDL15446.1"
FT                   /translation="RKVFQEREGEKEAVLVPIQSPEDLARVPPNSTSNILNRLLVSYDP
FT                   RIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPSDFRGSDAL
FT                   TVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSITLSCPLDL
FT                   TLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEYGNCTKY
FT                   YKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVPLGIFS
FT                   VLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPKRVEAEK
FT                   ARIAKAEQADGKGGNAAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDFSIV
FT                   GSLPRDFELSNYDCYGKPIEVNNGLGKPQAKNKKPPPAKPVIPTAAKRIDLYARALFPF
FT                   CFLFFNVIYWSIYL"
FT   gene            16347783..16348312
FT                   /pseudo
FT                   /locus_tag="mCG_49849"
FT                   /note="gene_id=mCG49849.2"
FT   mRNA            16347783..16348312
FT                   /pseudo
FT                   /locus_tag="mCG_49849"
FT                   /note="gene_id=mCG49849.2 transcript_id=mCT50032.2 created
FT                   on 28-MAR-2003"
FT   gene            <16383936..16558723
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /note="gene_id=mCG21610.3"
FT   mRNA            join(<16383936..16384318,16475819..16475877,
FT                   16486212..16486407,16519641..16519821,16548922..16549129,
FT                   16553729..16553946,16557151..16558719)
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   transcript variant mCT190931"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT190931.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(16384004..16384318,16486212..16486407,
FT                   16519641..16519821,16548922..16549129,16553729..16553946,
FT                   16557151..16558723)
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   transcript variant mCT19557"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT19557.2 created
FT                   on 28-AUG-2002"
FT   mRNA            join(<16384186..16384318,16475819..16475877,
FT                   16486212..16486407,16519641..16519821,16548922..16549129,
FT                   16553729..16555459)
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   transcript variant mCT190930"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT190930.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(16384201..16384318,16486212..16486407,
FT                   16519641..16519821,16548922..16549129,16553729..16553946,
FT                   16557151..16557267)
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT19557.2
FT                   protein_id=mCP11555.2 isoform=CRA_c"
FT                   /protein_id="EDL15444.1"
FT                   /translation="MLLLGLLLLTSALAGQRTGTRAESNLSSKLQLSSDKEQNGVQDPR
FT                   HERVVTISGNGSIHSPKFPHTYPRNMVLVWRLVAVDENVRIQLTFDERFGLEDPEDDIC
FT                   KYDFVEVEEPSDGSVLGRWCGSGTVPGKQTSKGNHIRIRFVSDEYFPSEPGFCIHYSII
FT                   MPQVTETTSPSVLPPSSLSLDLLNNAVTAFSTLEELIRYLEPDRWQVDLDSLYKPTWQL
FT                   LGKAFLYGKKSKVVNLNLLKEEVKLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCG
FT                   GNCACCLHNCNECQCVPRKVTKKYHEVLQLRPKTGVKGLHKSLTDVALEHHEECDCVCR
FT                   GNAGG"
FT   CDS             join(<16475853..16475877,16486212..16486407,
FT                   16519641..16519821,16548922..16549129,16553729..16553946,
FT                   16557151..16557267)
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT190931.0
FT                   protein_id=mCP111898.0 isoform=CRA_b"
FT                   /protein_id="EDL15443.1"
FT                   /translation="KRGERTLKGVQDPRHERVVTISGNGSIHSPKFPHTYPRNMVLVWR
FT                   LVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVLGRWCGSGTVPGKQTS
FT                   KGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSSLSLDLLNNAVTAFS
FT                   TLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNLLKEEVKLYSCTPR
FT                   NFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVLQLR
FT                   PKTGVKGLHKSLTDVALEHHEECDCVCRGNAGG"
FT   CDS             join(<16475853..16475877,16486212..16486407,
FT                   16519641..16519821,16548922..16549129,16553729..16554135)
FT                   /codon_start=1
FT                   /gene="Pdgfc"
FT                   /locus_tag="mCG_21610"
FT                   /product="platelet-derived growth factor, C polypeptide,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG21610.3 transcript_id=mCT190930.0
FT                   protein_id=mCP111897.0 isoform=CRA_a"
FT                   /protein_id="EDL15442.1"
FT                   /translation="KRGERTLKGVQDPRHERVVTISGNGSIHSPKFPHTYPRNMVLVWR
FT                   LVAVDENVRIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGSVLGRWCGSGTVPGKQTS
FT                   KGNHIRIRFVSDEYFPSEPGFCIHYSIIMPQVTETTSPSVLPPSSLSLDLLNNAVTAFS
FT                   TLEELIRYLEPDRWQVDLDSLYKPTWQLLGKAFLYGKKSKVVNLNLLKEEVKLYSCTPR
FT                   NFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPRKVTKKYHEVRTSF
FT                   STQFLWDVFFPNNKRMNLKYSGDYNPVPVLEIQASHLEGVPMFLFSLLRAFHLRHKH"
FT   gene            17143996..17147090
FT                   /locus_tag="mCG_147522"
FT                   /note="gene_id=mCG147522.0"
FT   mRNA            join(17143996..17144375,17146319..17147090)
FT                   /locus_tag="mCG_147522"
FT                   /product="mCG147522"
FT                   /note="gene_id=mCG147522.0 transcript_id=mCT187785.0
FT                   created on 13-JAN-2004"
FT   CDS             17144080..17144292
FT                   /codon_start=1
FT                   /locus_tag="mCG_147522"
FT                   /product="mCG147522"
FT                   /note="gene_id=mCG147522.0 transcript_id=mCT187785.0
FT                   protein_id=mCP109366.0"
FT                   /protein_id="EDL15441.1"
FT                   /translation="MTGIHHGENVSHREEAFSMFEHGHEIVITTSVMHIKQNVAVLLWM
FT                   CSLILDWIITWKACASLSLENDLHQ"
FT   gene            17274155..17297145
FT                   /gene="Ctso"
FT                   /locus_tag="mCG_21957"
FT                   /note="gene_id=mCG21957.2"
FT   mRNA            join(17274155..17274337,17283098..17283203,
FT                   17283759..17283898,17286424..17286591,17287874..17287995,
FT                   17292946..17293109,17293770..17293862,17295797..17297145)
FT                   /gene="Ctso"
FT                   /locus_tag="mCG_21957"
FT                   /product="cathepsin O"
FT                   /note="gene_id=mCG21957.2 transcript_id=mCT22155.2 created
FT                   on 25-OCT-2002"
FT   CDS             join(17274227..17274337,17283098..17283203,
FT                   17283759..17283898,17286424..17286591,17287874..17287995,
FT                   17292946..17293109,17293770..17293862,17295797..17295831)
FT                   /codon_start=1
FT                   /gene="Ctso"
FT                   /locus_tag="mCG_21957"
FT                   /product="cathepsin O"
FT                   /note="gene_id=mCG21957.2 transcript_id=mCT22155.2
FT                   protein_id=mCP11550.2"
FT                   /protein_id="EDL15440.1"
FT                   /translation="MKPQLVNLLLLCCCCLGRRGVAGTWSWSHQREAAALRESLHRHRY
FT                   LNSFPHENSTAFYGVNQFSYLFPEEFKALYLGSKYAWAPRYPAEGQRPIPNVSLPLRFD
FT                   WRDKHVVNPVRNQEMCGGCWAFSVVSAIESARAIQGKSLDYLSVQQVIDCSFNNSGCLG
FT                   GSPLCALRWLNETQLKLVADSQYPFKAVNGQCRHFPQSQAGVSVKDFSAYNFRGQEDEM
FT                   ARALLSFGPLVVIVDAMSWQDYLGGIIQHHCSSGEANHAVLITGFDRTGNTPYWMVRNS
FT                   WGSSWGVEGYAHVKMGGNVCGIADSVAAVFV"
FT   gene            complement(17299959..17317356)
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /note="gene_id=mCG21956.2"
FT   mRNA            complement(join(17299959..17300538,17302060..17302150,
FT                   17303030..17303109,17304322..17304379,17305518..17305629,
FT                   17308582..17308689,17309683..17309869,17311082..17311209,
FT                   17313253..17313323,17315925..17316015,17316929..17317034,
FT                   17317264..17317356))
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /product="tryptophan 2,3-dioxygenase, transcript variant
FT                   mCT22151"
FT                   /note="gene_id=mCG21956.2 transcript_id=mCT22151.1 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(17300385..17300538,17302060..17302150,
FT                   17303030..17303109,17304322..17304379,17305518..17305629,
FT                   17308582..17308689,17309683..17309869,17311082..17311209,
FT                   17313253..17313323,17315925..17316015,17316929..17317034,
FT                   17317264..17317298))
FT                   /codon_start=1
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /product="tryptophan 2,3-dioxygenase, isoform CRA_b"
FT                   /note="gene_id=mCG21956.2 transcript_id=mCT22151.1
FT                   protein_id=mCP11540.1 isoform=CRA_b"
FT                   /protein_id="EDL15439.1"
FT                   /translation="MSGCPFAGNSVGYTLKNLSMEDNEEDRAQTGVNRASKGGLIYGNY
FT                   LQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRD
FT                   ERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFREYLSPASGFQSLQFRLLEN
FT                   KIGVLQSLRVPYNRKHYRDNFGGDYNELLLKSEQEQTLLQLVEAWLERTPGLEPNGFNF
FT                   WGKFEKNILKGLEEEFLRIQAKTDSEEKEEQMAEFRKQKEVLLCLFDEKRHDYLLSKGE
FT                   RRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDTLMTKWRYNHVCMVHRMLGTKA
FT                   GTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLVPRHWVPKMNPIIHKFLYTAEYSDSSY
FT                   FSSDESD"
FT   mRNA            complement(join(17302091..17302150,17303030..17303078,
FT                   17311078..17311209,17313253..17313323,17315925..17316015,
FT                   17316929..17317034,17317264..17317355))
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /product="tryptophan 2,3-dioxygenase, transcript variant
FT                   mCT181548"
FT                   /note="gene_id=mCG21956.2 transcript_id=mCT181548.0 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(17311078..17311209,17313253..17313323,
FT                   17315925..17316015,17316929..17317034,17317264..17317298))
FT                   /codon_start=1
FT                   /gene="Tdo2"
FT                   /locus_tag="mCG_21956"
FT                   /product="tryptophan 2,3-dioxygenase, isoform CRA_a"
FT                   /note="gene_id=mCG21956.2 transcript_id=mCT181548.0
FT                   protein_id=mCP104470.0 isoform=CRA_a"
FT                   /protein_id="EDL15438.1"
FT                   /translation="MSGCPFAGNSVGYTLKNLSMEDNEEDRAQTGVNRASKGGLIYGNY
FT                   LQLEKILNAQELQSEVKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRD
FT                   ERNMLKVIARMHRVVVIFKLLVQQFSVLETMTALDFNDFR"
FT   gene            17323908..17362423
FT                   /gene="Accn5"
FT                   /locus_tag="mCG_21955"
FT                   /note="gene_id=mCG21955.2"
FT   mRNA            join(17323908..17324051,17332075..17332169,
FT                   17338595..17338794,17341385..17341691,17346224..17346461,
FT                   17348259..17348384,17350236..17350385,17351246..17351393,
FT                   17353157..17353213,17355468..17355636,17360605..17360696,
FT                   17362123..17362423)
FT                   /gene="Accn5"
FT                   /locus_tag="mCG_21955"
FT                   /product="amiloride-sensitive cation channel 5, intestinal"
FT                   /note="gene_id=mCG21955.2 transcript_id=mCT22154.1 created
FT                   on 22-AUG-2002"
FT   CDS             join(17338755..17338794,17341385..17341691,
FT                   17346224..17346461,17348259..17348384,17350236..17350385,
FT                   17351246..17351393,17353157..17353213,17355468..17355636,
FT                   17360605..17360696,17362123..17362283)
FT                   /codon_start=1
FT                   /gene="Accn5"
FT                   /locus_tag="mCG_21955"
FT                   /product="amiloride-sensitive cation channel 5, intestinal"
FT                   /note="gene_id=mCG21955.2 transcript_id=mCT22154.1
FT                   protein_id=mCP11538.1"
FT                   /protein_id="EDL15437.1"
FT                   /translation="MEHTEKSQVHAEKGLLGKIKRYLSKRPLPSPTDRKKFDQDFAMST
FT                   SFHGIHNIAQNQNKVRKVIWLAVVLGSVSLLVWQIYSRLVNYFTWPTTTSIEVQYVEKI
FT                   EFPAVTLCNLNRFQTEAVSRFGIIFFLWDIVSKVLRLQEISANNTGSPETLDFVTNHQN
FT                   FSITEFVKNNGFYLNNDTLVHCEFFGKTCSPKDFKHVFTEYGNCFTFNYGENIQNKNKV
FT                   SVSGRGLKLLLDVHQEEFTDNPVPGFADAGVIFVIHSPKKEPQFDGLGLSSPVGMHARV
FT                   TIRQLKTVHQEYPWGECNPNIKLRNFITYSTYGCLKECKARHIQRLCGCLPFLLPGNGV
FT                   ECDLLEYYNCVSPILDHIERKGLCTMGTHNSSCPVSCEETEYPATVSYSTFPSQRATRF
FT                   LAKKLNQSQEYIRENLVNIEINYSDLNYKITQQQKAVSVPELLADVGGQLGLFCGASLI
FT                   TIIEIIEYFFTNFYWVLIFFLLKILETIQRTSPPQAV"
FT   gene            complement(17373212..>17415838)
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /note="gene_id=mCG21954.2"
FT   mRNA            complement(join(17373212..17374448,17375479..17375588,
FT                   17375909..17376063,17376447..17376587,17379082..17379319,
FT                   17380891..17381088,17384284..17384417,17385293..17385409,
FT                   17386555..17386785,17387669..17387866,17399369..17399487,
FT                   17402147..17402247,17415148..17415221,17415721..>17415838))
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /product="guanylate cyclase 1, soluble, beta 3, transcript
FT                   variant mCT190996"
FT                   /note="gene_id=mCG21954.2 transcript_id=mCT190996.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(17374094..17374448,17375479..17375605,
FT                   17375909..17376063,17376447..17376587,17379082..17379319,
FT                   17380891..17381088,17384284..17384417,17385293..17385409,
FT                   17386555..17386785,17387669..17387866,17399369..17399487,
FT                   17402147..17402247,17415148..17415221,17415721..17415834))
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /product="guanylate cyclase 1, soluble, beta 3, transcript
FT                   variant mCT22153"
FT                   /note="gene_id=mCG21954.2 transcript_id=mCT22153.2 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(17374422..17374448,17375479..17375605,
FT                   17375909..17376063,17376447..17376587,17379082..17379319,
FT                   17380891..17381088,17384284..17384417,17385293..17385409,
FT                   17386555..17386785,17387669..17387866,17399369..17399487,
FT                   17402147..17402247,17415148..17415221,17415721..17415723))
FT                   /codon_start=1
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /product="guanylate cyclase 1, soluble, beta 3, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG21954.2 transcript_id=mCT22153.2
FT                   protein_id=mCP11566.2 isoform=CRA_b"
FT                   /protein_id="EDL15436.1"
FT                   /translation="MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDD
FT                   SKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDAL
FT                   HDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQIHGTEID
FT                   MKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKAFPFHII
FT                   FDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTVFVLRSK
FT                   EGLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYL
FT                   SDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLYSVLP
FT                   PSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFD
FT                   TLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVDGESV
FT                   QITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPE
FT                   NSDPLFHLEHRGPVSMKGKKEPMQVWFLSRKNTGTEETNEEDEN"
FT   CDS             complement(join(17374438..17374448,17375479..17375588,
FT                   17375909..17376063,17376447..17376587,17379082..17379319,
FT                   17380891..17381088,17384284..17384417,17385293..17385409,
FT                   17386555..17386785,17387669..17387866,17399369..17399487,
FT                   17402147..17402247,17415148..17415221,17415721..>17415741))
FT                   /codon_start=1
FT                   /gene="Gucy1b3"
FT                   /locus_tag="mCG_21954"
FT                   /product="guanylate cyclase 1, soluble, beta 3, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG21954.2 transcript_id=mCT190996.0
FT                   protein_id=mCP111947.0 isoform=CRA_a"
FT                   /protein_id="EDL15435.1"
FT                   /translation="APGADTMYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLV
FT                   RIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFL
FT                   QNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLILHYYSEREGLQDIVIGIIKTVAQQI
FT                   HGTEIDMKVIQQRNEECDHTQFLIEEKESKEEDFYEDLDRFEENGTQESRISPYTFCKA
FT                   FPFHIIFDRNLVVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRPHIDISFHGILSHINTV
FT                   FVLRSKEGLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLT
FT                   RRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTL
FT                   LYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLND
FT                   LYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQ
FT                   VDGESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYR
FT                   KLGSTVPFGAQRPSVYEGQEGTNASLVPIQEKYRHGGNK"
FT   gene            complement(17435788..17487103)
FT                   /gene="Gucy1a3"
FT                   /locus_tag="mCG_21953"
FT                   /note="gene_id=mCG21953.1"
FT   mRNA            complement(join(17435788..17436061,17438771..17438925,
FT                   17443113..17443256,17446891..17447376,17449737..17450446,
FT                   17452296..17452354,17454417..17454478,17460036..17460394,
FT                   17486923..17487103))
FT                   /gene="Gucy1a3"
FT                   /locus_tag="mCG_21953"
FT                   /product="guanylate cyclase 1, soluble, alpha 3"
FT                   /note="gene_id=mCG21953.1 transcript_id=mCT22152.1 created
FT                   on 20-AUG-2002"
FT   CDS             complement(join(17435857..17436061,17438771..17438925,
FT                   17443113..17443256,17446891..17447376,17449737..17450446,
FT                   17452296..17452354,17454417..17454478,17460036..17460290))
FT                   /codon_start=1
FT                   /gene="Gucy1a3"
FT                   /locus_tag="mCG_21953"
FT                   /product="guanylate cyclase 1, soluble, alpha 3"
FT                   /note="gene_id=mCG21953.1 transcript_id=mCT22152.1
FT                   protein_id=mCP11557.2"
FT                   /protein_id="EDL15434.1"
FT                   /translation="MFCRKFKDLKITGECPFSLLAPGQVPKEPTEEVAGGSEGCQATLP
FT                   ICQYFPEKNAEGSLPQRKTSRNRVYLHTLAESICKLIFPECERLNLALQRTLAKHKIEE
FT                   NRKSSEKEDLEKIIAEEAIAAGAPVEALKDSLGEELFKICYEEDEHILGVVGGTLKDFL
FT                   NSFSTLLKQSSHCQEAERRGRLEDASILCLDKDQDFLNVYYFFPKRTTALLLPGIIKAA
FT                   ARILYESHVEVSLMPPCFRSDCTEFVNQPYLLYSVHVKSTKPSLSPGKPQSSLVIPASL
FT                   FCKTFPFHFMLDRDLAILQLGNGIRRLVNKRDFQGKPSFEEFFEILTPKINQTFSGIMT
FT                   MLNMQFVIRVRRWDNSVKKSSRVMDLKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLY
FT                   LSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEHAHQALEEEKKRTVDLLCSIF
FT                   PSEVAQQLWQGQIVQAKKFSEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQC
FT                   GELDVYKVETIGDAYCVAGGLHRESDTHAVQIALMALKMMELSNEVMSPHGEPIKMRIG
FT                   LHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLLKDCPGFVFT
FT                   PRSREELPPNFPSDIPGICHFLDAYHHQGPNSKPWFQDKDVEDGNANFLGKASGVD"
FT   gene            17698467..17723961
FT                   /locus_tag="mCG_113722"
FT                   /note="gene_id=mCG113722.1"
FT   mRNA            join(17698467..17698526,17699246..17699395,
FT                   17700161..17700245,17703562..17703885,17711450..17711673,
FT                   17714412..17714505,17717225..17717469,17719239..17719309,
FT                   17720380..17720555,17721978..17722067,17723292..17723453,
FT                   17723600..17723745,17723929..17723961)
FT                   /locus_tag="mCG_113722"
FT                   /product="mCG113722, transcript variant mCT114808"
FT                   /note="gene_id=mCG113722.1 transcript_id=mCT114808.1
FT                   created on 14-NOV-2002"
FT   mRNA            join(<17698487..17698526,17699246..17699395,
FT                   17700161..17700245,17703562..17703885,17711450..17711673,
FT                   17714412..17714505,17717225..17717469,17719239..17719309,
FT                   17720380..17720548,17721978..17722067,17723292..>17723394)
FT                   /locus_tag="mCG_113722"
FT                   /product="mCG113722, transcript variant mCT190987"
FT                   /note="gene_id=mCG113722.1 transcript_id=mCT190987.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<17699288..17699395,17700161..17700245,
FT                   17703562..17703885,17711450..17711673,17714412..17714505,
FT                   17717225..17717469,17719239..17719309,17720380..17720548,
FT                   17721978..17722067,17723292..>17723394)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113722"
FT                   /product="mCG113722, isoform CRA_b"
FT                   /note="gene_id=mCG113722.1 transcript_id=mCT190987.0
FT                   protein_id=mCP111932.0 isoform=CRA_b"
FT                   /protein_id="EDL15433.1"
FT                   /translation="LLYKSREKGHTMSDEIFSTTLAYTKSPKATKRTSFQDELIRAITA
FT                   RSARQRSSEYSDDFDSDEIVSLGEFSDTSTDESLVRKKMNDFHISDDEEKNSPRLSFLK
FT                   TKKVNRAISNDALDSSTPGSEGSSPDAQEDVTGDSLPKSQNDDREVGREIITVKPTPRM
FT                   HPVKRSTSSGETSSGLDADGHFKPSPQPRSMLKKSSHTEEGVRPGVDKEHSISEASAPT
FT                   PSLPRQNGTELQTEEKIYSENLDLEDSLLQSLTSSSFKESPGGCTSPGSQEKAPMKDHD
FT                   GEPTEIWDSLLSNENEGSSVLVNCVTPELEQPKDGQVAADDLEEEREKGGFTEDDLTTD
FT                   PLLSTSPSVITPTEPAEPAKKANEDRNTKNKKTTNNRVSSASGRLMTSEFLKRSGPTKR
FT                   SPSAATSSHYLGSLKVLDQKQPRKQSLEPDKADHIRAAVYQEWLEKKNVYLHEMHRIKR
FT                   IESENLRIQNEQKKAAKREEALASFEAWKAMKEKEAKRIAAKKRLE"
FT   CDS             join(17699321..17699395,17700161..17700245,
FT                   17703562..17703885,17711450..17711673,17714412..17714505,
FT                   17717225..17717469,17719239..17719309,17720380..17720555,
FT                   17721978..17722012)
FT                   /codon_start=1
FT                   /locus_tag="mCG_113722"
FT                   /product="mCG113722, isoform CRA_a"
FT                   /note="gene_id=mCG113722.1 transcript_id=mCT114808.1
FT                   protein_id=mCP65888.1 isoform=CRA_a"
FT                   /protein_id="EDL15432.1"
FT                   /translation="MSDEIFSTTLAYTKSPKATKRTSFQDELIRAITARSARQRSSEYS
FT                   DDFDSDEIVSLGEFSDTSTDESLVRKKMNDFHISDDEEKNSPRLSFLKTKKVNRAISND
FT                   ALDSSTPGSEGSSPDAQEDVTGDSLPKSQNDDREVGREIITVKPTPRMHPVKRSTSSGE
FT                   TSSGLDADGHFKPSPQPRSMLKKSSHTEEGVRPGVDKEHSISEASAPTPSLPRQNGTEL
FT                   QTEEKIYSENLDLEDSLLQSLTSSSFKESPGGCTSPGSQEKAPMKDHDGEPTEIWDSLL
FT                   SNENEGSSVLVNCVTPELEQPKDGQVAADDLEEEREKGGFTEDDLTTDPLLSTSPSVIT
FT                   PTEPAEPAKKANEDRNTKNKKTTNNRVSSASGRLMTSEFLKRSGPTKRSPSAATSSHYL
FT                   GSLKVLDQKQPRKQSLEPDKADHIRAAVYQVKGVVRKEKCVFT"
FT   gene            complement(17873745..17883404)
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /note="gene_id=mCG21952.1"
FT   mRNA            complement(join(17873745..17876856,17883150..17883404))
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /product="neuropeptide Y receptor Y2, transcript variant
FT                   mCT22150"
FT                   /note="gene_id=mCG21952.1 transcript_id=mCT22150.1 created
FT                   on 26-MAR-2003"
FT   mRNA            complement(join(17873748..17876856,17883154..17883369))
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /product="neuropeptide Y receptor Y2, transcript variant
FT                   mCT181547"
FT                   /note="gene_id=mCG21952.1 transcript_id=mCT181547.0 created
FT                   on 26-MAR-2003"
FT   CDS             complement(17875683..17876828)
FT                   /codon_start=1
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /product="neuropeptide Y receptor Y2, isoform CRA_a"
FT                   /note="gene_id=mCG21952.1 transcript_id=mCT181547.0
FT                   protein_id=mCP104469.0 isoform=CRA_a"
FT                   /db_xref="GOA:P97295"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR001358"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:108418"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97295"
FT                   /protein_id="EDL15430.1"
FT                   /translation="MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTK
FT                   LVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCL
FT                   PFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKR
FT                   ISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLS
FT                   TLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSW
FT                   LPLHAFQLAVDIDSHVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAF
FT                   RCEQRLDAIHSEVSMTFKAKKNLEVKKNNGPTDSFSEATNV"
FT   CDS             complement(17875683..17876828)
FT                   /codon_start=1
FT                   /gene="Npy2r"
FT                   /locus_tag="mCG_21952"
FT                   /product="neuropeptide Y receptor Y2, isoform CRA_a"
FT                   /note="gene_id=mCG21952.1 transcript_id=mCT22150.1
FT                   protein_id=mCP11556.2 isoform=CRA_a"
FT                   /db_xref="GOA:P97295"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000611"
FT                   /db_xref="InterPro:IPR001358"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:108418"
FT                   /db_xref="UniProtKB/Swiss-Prot:P97295"
FT                   /protein_id="EDL15431.1"
FT                   /translation="MGPVGAEADENQTVEVKVEPYGPGHTTPRGELPPDPEPELIDSTK
FT                   LVEVQVILILAYCSIILLGVVGNSLVIHVVIKFKSMRTVTNFFIANLAVADLLVNTLCL
FT                   PFTLTYTLMGEWKMGPVLCHLVPYAQGLAVQVSTITLTVIALDRHRCIVYHLESKISKR
FT                   ISFLIIGLAWGISALLASPLAIFREYSLIEIIPDFEIVACTEKWPGEEKSVYGTVYSLS
FT                   TLLILYVLPLGIISFSYTRIWSKLRNHVSPGAASDHYHQRRHKMTKMLVCVVVVFAVSW
FT                   LPLHAFQLAVDIDSHVLDLKEYKLIFTVFHIIAMCSTFANPLLYGWMNSNYRKAFLSAF
FT                   RCEQRLDAIHSEVSMTFKAKKNLEVKKNNGPTDSFSEATNV"
FT   gene            complement(17879375..17932926)
FT                   /locus_tag="mCG_147523"
FT                   /note="gene_id=mCG147523.0"
FT   mRNA            complement(join(17879375..17881527,17932909..17932926))
FT                   /locus_tag="mCG_147523"
FT                   /product="mCG147523"
FT                   /note="gene_id=mCG147523.0 transcript_id=mCT187786.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(17880750..17880929)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147523"
FT                   /product="mCG147523"
FT                   /note="gene_id=mCG147523.0 transcript_id=mCT187786.0
FT                   protein_id=mCP109368.0"
FT                   /protein_id="EDL15429.1"
FT                   /translation="MSASLECHSKELRFTLVRKQIKMCFEHIMNQKIPFRAVDAKESTN
FT                   RDGYIRGGGMKTES"
FT   gene            complement(<18190971..18193716)
FT                   /locus_tag="mCG_21951"
FT                   /note="gene_id=mCG21951.1"
FT   mRNA            complement(join(<18190971..18191755,18192273..18192740,
FT                   18193554..18193716))
FT                   /locus_tag="mCG_21951"
FT                   /product="mCG21951"
FT                   /note="gene_id=mCG21951.1 transcript_id=mCT22149.1 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(<18190971..18191755,18192273..18192740,
FT                   18193554..18193704))
FT                   /codon_start=1
FT                   /locus_tag="mCG_21951"
FT                   /product="mCG21951"
FT                   /note="gene_id=mCG21951.1 transcript_id=mCT22149.1
FT                   protein_id=mCP11545.1"
FT                   /protein_id="EDL15428.1"
FT                   /translation="MNEENTDGTNGCSKVRTGTQNEAALLALMEKTGYNMVQENGQRKF
FT                   GGPPPGWEGPPPPRGCEVFVGKIPRDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYA
FT                   FVMYTTKEEAQLAIRILNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKK
FT                   VTEGVVDVIVYPSATDKTKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWAD
FT                   PEKEVDEETMQRVKVLYVRNLMISTTEETIKAEFSKFKPGAVERVKKLRDYAFVHFFHR
FT                   EDAVAAMSVMNGKCIDGASIEVTLAKPVNKENTWRQHLNGQISPNSENLLVYANKEESH
FT                   SKSLGKPPTLPTRLNGQHSPSPPEIERCTYPFFPGTKLTPISMYSLKSNHFNSAVMHLD
FT                   YYCNKNNWAPPEYYLYSTTSQDGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKEL
FT                   AAQFTLLHLG"
FT   gene            <18203761..18270685
FT                   /locus_tag="mCG_1032384"
FT                   /note="gene_id=mCG1032384.1"
FT   mRNA            join(<18203761..18203817,18205755..18205884,
FT                   18267780..18268027,18269723..18270685)
FT                   /locus_tag="mCG_1032384"
FT                   /product="mCG1032384"
FT                   /note="gene_id=mCG1032384.1 transcript_id=mCT150088.1
FT                   created on 28-MAR-2003"
FT   gene            complement(18222334..18230892)
FT                   /gene="Lrat"
FT                   /locus_tag="mCG_113718"
FT                   /note="gene_id=mCG113718.0"
FT   mRNA            complement(join(18222334..18224064,18230086..18230892))
FT                   /gene="Lrat"
FT                   /locus_tag="mCG_113718"
FT                   /product="lecithin-retinol acyltransferase
FT                   (phosphatidylcholine-retinol-O-acyltransferase)"
FT                   /note="gene_id=mCG113718.0 transcript_id=mCT114804.0
FT                   created on 03-SEP-2002"
FT   CDS             complement(join(18223909..18224064,18230086..18230625))
FT                   /codon_start=1
FT                   /gene="Lrat"
FT                   /locus_tag="mCG_113718"
FT                   /product="lecithin-retinol acyltransferase
FT                   (phosphatidylcholine-retinol-O-acyltransferase)"
FT                   /note="gene_id=mCG113718.0 transcript_id=mCT114804.0
FT                   protein_id=mCP65865.1"
FT                   /db_xref="GOA:B2RUR5"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="MGI:MGI:1891259"
FT                   /db_xref="UniProtKB/TrEMBL:B2RUR5"
FT                   /protein_id="EDL15427.1"
FT                   /translation="MKNPMLEAASLLLEKLLLISNFKLFSVSVPGGGTGKNRPYEISSF
FT                   VRGDVLEVSRTHFIHYGIYLGENRVAHLMPDILLALTNDKERTQKVVSNKRLLLGVICK
FT                   VASIRVDTVEDFAYGADILVNHLDGTLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEH
FT                   FVTYCRYGSRISPQAEKFYDTVKIIIRDQRSSLASAVLGLASIVYTGLASYMTLPAICI
FT                   PFCLWMMSG"
FT   CDS             join(<18267847..18268027,18269723..18270036)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032384"
FT                   /product="mCG1032384"
FT                   /note="gene_id=mCG1032384.1 transcript_id=mCT150088.1
FT                   protein_id=mCP65869.1"
FT                   /protein_id="EDL15426.1"
FT                   /translation="KMIIEHWVWQLCRKTWKQLKVFLPLLVCFWKPSEAIRQTNLACLL
FT                   CCHTGLEHVGRINVPEIQLLEKRRLDLFSENFVENLPGIGEMAQQFKALTALPEDVSSI
FT                   PSTHMRFTTVCDSSSKGFYALIILQAFTWYINIHEGKPPIHINNKSVHLSSSQTAHPDR
FT                   F"
FT   gene            18328159..18335415
FT                   /gene="Fgg"
FT                   /locus_tag="mCG_141536"
FT                   /note="gene_id=mCG141536.0"
FT   mRNA            join(18328159..18328400,18328535..18328579,
FT                   18328756..18328939,18329030..18329123,18330445..18330575,
FT                   18330837..18330970,18331714..18331898,18333133..18333410,
FT                   18334507..18334676,18335204..18335415)
FT                   /gene="Fgg"
FT                   /locus_tag="mCG_141536"
FT                   /product="fibrinogen, gamma polypeptide"
FT                   /note="gene_id=mCG141536.0 transcript_id=mCT175884.0
FT                   created on 15-NOV-2002"
FT   CDS             join(18328326..18328400,18328535..18328579,
FT                   18328756..18328939,18329030..18329123,18330445..18330575,
FT                   18330837..18330970,18331714..18331898,18333133..18333410,
FT                   18334507..18334676,18335204..18335218)
FT                   /codon_start=1
FT                   /gene="Fgg"
FT                   /locus_tag="mCG_141536"
FT                   /product="fibrinogen, gamma polypeptide"
FT                   /note="gene_id=mCG141536.0 transcript_id=mCT175884.0
FT                   protein_id=mCP98805.0"
FT                   /protein_id="EDL15425.1"
FT                   /translation="MSWSLQPPSFLLCCVLLLFSPTGLAYVATRDNCCILDERFGSFCP
FT                   TTCGIADFLSSYQTDVDNDLRTLEDILFRAENRTTEAKELIKAIQVYYNPDQPPKPGMI
FT                   DSATQKSKKMVEEIVKYEALLLTHETSIRYLQEIYNSNNQKITNLKQKVAQLEAQCQEP
FT                   CKDSVQIHDTTGKDCQEIANKGAKESGLYFIRPLKAKQQFLVYCEIDGSGNGWTVLQKR
FT                   IDGSLDFKKNWIQYKEGFGHLSPTGTTEFWLGNEKIHLISMQSTIPYALRIQLKDWNGR
FT                   TSTADYAMFRVGPESDKYRLTYAYFIGGDAGDAFDGYDFGDDPSDKFFTSHNGMQFSTW
FT                   DNDNDKFEGNCAEQDGSGWWMNKCHAGHLNGVYHQGGTYSKSSTTNGFDDGIIWATWKS
FT                   RWYSMKETTMKIIPFNRLSIGEGQQHHMGGSKQAGDV"
FT   gene            18346595..18354052
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /note="gene_id=mCG141537.0"
FT   mRNA            join(18346595..18346709,18348968..18349096,
FT                   18349528..18349711,18350631..18350776,18351279..18352425,
FT                   18353137..18354052)
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /product="fibrinogen, alpha polypeptide, transcript variant
FT                   mCT175883"
FT                   /note="gene_id=mCG141537.0 transcript_id=mCT175883.0
FT                   created on 15-NOV-2002"
FT   mRNA            join(<18346604..18346709,18348968..18349096,
FT                   18349528..18349711,18350631..18350776,18351279..18352706)
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /product="fibrinogen, alpha polypeptide, transcript variant
FT                   mCT190950"
FT                   /note="gene_id=mCG141537.0 transcript_id=mCT190950.0
FT                   created on 08-MAR-2004"
FT   CDS             join(<18346605..18346709,18348968..18349096,
FT                   18349528..18349711,18350631..18350776,18351279..18352439)
FT                   /codon_start=1
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /product="fibrinogen, alpha polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG141537.0 transcript_id=mCT190950.0
FT                   protein_id=mCP111877.0 isoform=CRA_b"
FT                   /protein_id="EDL15424.1"
FT                   /translation="LRFSSSSPHEPSLSADTMLSLRVACLILSVASTVWTTDTEDKGEF
FT                   LSEGGGVRGPRVVERHQSQCKDSDWPFCSDDDWNHKCPSGCRMKGLIDEANQDFTNRIN
FT                   KLKNSLFDFQRNNKDSNSLTRNIMEYLRGDFANANNFDNTYGQVSEDLRRRIEILRRKV
FT                   IEKAQQIQALQSNVRAQLIDMKRLEVDIDIKIRSCKGSCSRAVNREINLQDYEGHQKQL
FT                   QQVIAKELLPTKDRQYLPALKMSPVPDLVPGSFKSQLQEAPPEWKALTEMRQMRMELER
FT                   PGKDGGSRGDSPGDSRGDSRGDFATRGPGSKAENPTNPGPGGSGYWRPGNSGSGSDGNR
FT                   NPGTTGSDGTGDWGTGSPRPGSDSGNFRPANPNWGVFSEFGDSSSPATRKEYHTGKAVT
FT                   SKGDKELLIGKEKVTSSGTSTTHRSCSKTITKTVTGPDGRREVVKEVITSDDGSDCGDA
FT                   TELDISHSFSGSLDELSERHPDLSGFFDNHFGLISPNFKEFGSKTHSDSDILTNIEDPS
FT                   SHVPEFSSSSKTSTVKKQVTKTYKMADEAGSEAHREGETRNTKRGRARARPTRGIDT"
FT   CDS             join(18346656..18346709,18348968..18349096,
FT                   18349528..18349711,18350631..18350776,18351279..18352425,
FT                   18353137..18353846)
FT                   /codon_start=1
FT                   /gene="Fga"
FT                   /locus_tag="mCG_141537"
FT                   /product="fibrinogen, alpha polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG141537.0 transcript_id=mCT175883.0
FT                   protein_id=mCP98806.0 isoform=CRA_a"
FT                   /protein_id="EDL15423.1"
FT                   /translation="MLSLRVACLILSVASTVWTTDTEDKGEFLSEGGGVRGPRVVERHQ
FT                   SQCKDSDWPFCSDDDWNHKCPSGCRMKGLIDEANQDFTNRINKLKNSLFDFQRNNKDSN
FT                   SLTRNIMEYLRGDFANANNFDNTYGQVSEDLRRRIEILRRKVIEKAQQIQALQSNVRAQ
FT                   LIDMKRLEVDIDIKIRSCKGSCSRAVNREINLQDYEGHQKQLQQVIAKELLPTKDRQYL
FT                   PALKMSPVPDLVPGSFKSQLQEAPPEWKALTEMRQMRMELERPGKDGGSRGDSPGDSRG
FT                   DSRGDFATRGPGSKAENPTNPGPGGSGYWRPGNSGSGSDGNRNPGTTGSDGTGDWGTGS
FT                   PRPGSDSGNFRPANPNWGVFSEFGDSSSPATRKEYHTGKAVTSKGDKELLIGKEKVTSS
FT                   GTSTTHRSCSKTITKTVTGPDGRREVVKEVITSDDGSDCGDATELDISHSFSGSLDELS
FT                   ERHPDLSGFFDNHFGLISPNFKEFGSKTHSDSDILTNIEDPSSHVPEFSSSSKTSTVKK
FT                   QVTKTYKMADEAGSEAHREGETRNTKRGRARARPTRDCDDVLQTQTSGAQNGIFSIKPP
FT                   GSSKVFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLNDKGEGEFWLGND
FT                   YLHLLTLRGSVLRVELEDWAGKEAYAEYHFRVGSEAEGYALQVSSYRGTAGDALVQGSV
FT                   EEGTEYTSHSNMQFSTFDRDADQWEENCAEVYGGGWWYNSCQAANLNGIYYPGGTYDPR
FT                   NNSPYEIENGVVWVPFRGADYSLRAVRMKIRPLVGQ"
FT   gene            complement(18362285..18370275)
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /note="gene_id=mCG17068.1"
FT   mRNA            complement(join(18362285..18363058,18363656..18363941,
FT                   18364201..18364326,18364643..18364756,18365339..18365566,
FT                   18366466..18366649,18367118..18367312,18370145..18370275))
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /product="fibrinogen, B beta polypeptide, transcript
FT                   variant mCT16021"
FT                   /note="gene_id=mCG17068.1 transcript_id=mCT16021.1 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(18362827..18363058,18363656..18363941,
FT                   18364201..18364326,18364643..18364756,18365339..18365566,
FT                   18366466..18366649,18367118..18367312,18370145..18370225))
FT                   /codon_start=1
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /product="fibrinogen, B beta polypeptide, isoform CRA_a"
FT                   /note="gene_id=mCG17068.1 transcript_id=mCT16021.1
FT                   protein_id=mCP11543.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q3TGR2"
FT                   /db_xref="InterPro:IPR002181"
FT                   /db_xref="InterPro:IPR012290"
FT                   /db_xref="InterPro:IPR014715"
FT                   /db_xref="InterPro:IPR014716"
FT                   /db_xref="InterPro:IPR020837"
FT                   /db_xref="MGI:MGI:99501"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TGR2"
FT                   /protein_id="EDL15421.1"
FT                   /translation="MRHLWLLLLLCVFSVQTQAADDDYDEPTDSLDARGHRPVDRRKEE
FT                   PPSLRPAPPPISGGGYRARPAKATANQKKVERRPPDAGGCLHADTDMGVLCPTGCTLQQ
FT                   TLLNQERPIKSSIAELNNNIQSVSDTSSVTFQYLTLLKDMWKKKQAQVKENENVINEYS
FT                   SILEDQRLYIDETVNDNIPLNLRVLRSILEDLRSKIQKLESDISAQMEYCRTPCTVSCN
FT                   IPVVSGKECEEIIRKGGETSEMYLIQPDTSIKPYRVYCDMKTENGGWTVIQNRQDGSVD
FT                   FGRKWDPYKKGFGNIATNEDAKKYCGLPGEYWLGNDKISQLTRMGPTELLIEMEDWKGD
FT                   KVKAHYGGFTVQNEASKYQVSVNKYKGTAGNALMDGASQLVGENRTMTIHNGMFFSTYD
FT                   RDNDGWVTTDPRKQCSKEDGGGWWYNRCHAANPNGRYYWGGLYSWDMSKHGTDDGVVWM
FT                   NWKGSWYSMRRMSMKIRPFFPQQ"
FT   mRNA            complement(join(18363770..18363941,18364201..18364326,
FT                   18364643..18364756,18367172..18367312,18370145..18370272))
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /product="fibrinogen, B beta polypeptide, transcript
FT                   variant mCT181522"
FT                   /note="gene_id=mCG17068.1 transcript_id=mCT181522.0 created
FT                   on 27-MAR-2003"
FT   CDS             complement(join(18364658..18364756,18367172..18367312,
FT                   18370145..18370225))
FT                   /codon_start=1
FT                   /gene="Fgb"
FT                   /locus_tag="mCG_17068"
FT                   /product="fibrinogen, B beta polypeptide, isoform CRA_b"
FT                   /note="gene_id=mCG17068.1 transcript_id=mCT181522.0
FT                   protein_id=mCP104444.0 isoform=CRA_b"
FT                   /protein_id="EDL15422.1"
FT                   /translation="MRHLWLLLLLCVFSVQTQAADDDYDEPTDSLDARGHRPVDRRKEE
FT                   PPSLRPAPPPISGGGYRARPAKATANQKKSVRRSLGREVRHPKCISSSLTPPSSRTEYT
FT                   VT"
FT   gene            <18376015..18392737
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /note="gene_id=mCG17066.3"
FT   mRNA            join(<18376015..18376138,18377255..18377361,
FT                   18379092..18379234,18379766..18379819,18380276..18380366,
FT                   18381474..18381561,18386323..18386421,18387120..18387212,
FT                   18388440..18388589,18388701..18388802,18389404..18389506,
FT                   18390130..18390238,18391059..18391172,18391638..18391831,
FT                   18392559..18392737)
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /product="pleiotropic regulator 1, PRL1 homolog
FT                   (Arabidopsis), transcript variant mCT190990"
FT                   /note="gene_id=mCG17066.3 transcript_id=mCT190990.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(18376052..18376138,18377255..18377361,
FT                   18379092..18379234,18379766..18379819,18380276..18380366,
FT                   18381474..18381561,18386323..18386421,18387120..18387212,
FT                   18388440..18388589,18388701..18388802,18389404..18389506,
FT                   18390130..18390238,18391033..18391172,18391638..18391831,
FT                   18392559..>18392618)
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /product="pleiotropic regulator 1, PRL1 homolog
FT                   (Arabidopsis), transcript variant mCT16019"
FT                   /note="gene_id=mCG17066.3 transcript_id=mCT16019.1 created
FT                   on 20-AUG-2002"
FT   CDS             join(<18376061..18376138,18377255..18377361,
FT                   18379092..18379234,18379766..18379819,18380276..18380366,
FT                   18381474..18381561,18386323..18386421,18387120..18387212,
FT                   18388440..18388589,18388701..18388802,18389404..18389506,
FT                   18390130..18390238,18391059..18391062)
FT                   /codon_start=1
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /product="pleiotropic regulator 1, PRL1 homolog
FT                   (Arabidopsis), isoform CRA_a"
FT                   /note="gene_id=mCG17066.3 transcript_id=mCT190990.0
FT                   protein_id=mCP111943.0 isoform=CRA_a"
FT                   /protein_id="EDL15419.1"
FT                   /translation="WRRFLRRLFEFLRCWRGRLNGGDMVEEVQKHSVHTLVFRSLKRTH
FT                   DMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPTSKENLKEKGPQNATDSYPHKQ
FT                   YPANQGQDVEYLVTGTHPYPPGPGVALTADTKIQRMPSESAAQSLAVALPSQTRVDANR
FT                   TGPAGSEYRHPGASDRSQPTAMNSIMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVI
FT                   SGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSP
FT                   YLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVR
FT                   TKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRA
FT                   VVLHPLL"
FT   CDS             join(18376130..18376138,18377255..18377361,
FT                   18379092..18379234,18379766..18379819,18380276..18380366,
FT                   18381474..18381561,18386323..18386421,18387120..18387212,
FT                   18388440..18388589,18388701..18388802,18389404..18389506,
FT                   18390130..18390238,18391033..18391172,18391638..18391831,
FT                   18392559..18392618)
FT                   /codon_start=1
FT                   /gene="Plrg1"
FT                   /locus_tag="mCG_17066"
FT                   /product="pleiotropic regulator 1, PRL1 homolog
FT                   (Arabidopsis), isoform CRA_b"
FT                   /note="gene_id=mCG17066.3 transcript_id=mCT16019.1
FT                   protein_id=mCP11565.1 isoform=CRA_b"
FT                   /protein_id="EDL15420.1"
FT                   /translation="MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMA
FT                   IKLRNEYGPVLHMPTSKENLKEKGPQNATDSYPHKQYPANQGQDVEYLVTGTHPYPPGP
FT                   GVALTADTKIQRMPSESAAQSLAVALPSQTRVDANRTGPAGSEYRHPGASDRSQPTAMN
FT                   SIMETGNTKNSALMAKKAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGS
FT                   ADRTIKIWDLASGKLKLSLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIR
FT                   HYHGHLSAVYGLDLHPTLDVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAA
FT                   EPQIITGSHDTTIRLWDLVAGKTRVTLTNHKKSVRAVVLHPLLYTFASGSPDNIKQWKF
FT                   PDGGFIQNLSGHNAIINTLAVNADGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSL
FT                   DSESGIFACAFDRSESRLLTAEADKTIKVYREDETATEETHPVSWKPEIIKRKRF"
FT   gene            18591401..>18678586
FT                   /locus_tag="mCG_114390"
FT                   /note="gene_id=mCG114390.1"
FT   mRNA            join(18591401..18592411,18594836..18595023,
FT                   18602514..18603357,18605652..18606476,18609382..18609621,
FT                   18624786..18624920,18625339..18625548,18628807..18629664,
FT                   18655631..18655842,18657540..18657691,18668280..18668410,
FT                   18670126..18670412,18673812..18673944,18675978..>18678586)
FT                   /locus_tag="mCG_114390"
FT                   /product="mCG114390"
FT                   /note="gene_id=mCG114390.1 transcript_id=mCT115482.1
FT                   created on 14-NOV-2002"
FT   CDS             join(18591520..18592411,18594836..18595023,
FT                   18602514..18603357,18605652..18606476,18609382..18609621,
FT                   18624786..18624920,18625339..18625548,18628807..18629664,
FT                   18655631..18655842,18657540..18657691,18668280..18668410,
FT                   18670126..18670412,18673812..18673944,18675978..>18678586)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114390"
FT                   /product="mCG114390"
FT                   /note="gene_id=mCG114390.1 transcript_id=mCT115482.1
FT                   protein_id=mCP65567.1"
FT                   /protein_id="EDL15418.1"
FT                   /translation="MVVLTVQAQLGSSPACSSTEVNITVMDVNDNRPEFPTASDEIRIS
FT                   QTTPPGTALYLAHAQDRDSGLNGLVRYSIASPQPSEFSMDQGRGVLYLRESLGSKADFR
FT                   LILVAKDQGVPPQVSQLVLTVVIESQERIPAVAFENLVYQVEVSESLPLTTQILQVQAY
FT                   PLYPWRPTSKTFYSLDVSVDSAVFGIHPHTGWIYLRRQLDYESTQTYKFRVYVHTSEDR
FT                   LLQNVSTSVIVHVLDENDHSPAFLQNRVFLNVEESPIPLGVIGKMTAIDADSGKNGQLS
FT                   YFLLTDGKFFKMNPNTGELINWLALDREHQGHHQITVLVTDHGSPPRNATMLVYVTITD
FT                   INDNWPFFPQCLPGKEFHFKVIPLSKGRVLMSQNIRHLVIPENTKPSKIMSLMKSPDPL
FT                   QQDHGGKLHFSIAAEDKDDHFEIDSSTGDLFLTKELDYEMTSHYLIRVISKDHSQSPAW
FT                   NSTVFLSIDVEDQNEHSPSFQDEFIVISIEENVPVGTLVYVFNAKDGDGSFLNSRIQYF
FT                   AESSSVGVNPFLIHPSSGALVTASPLDRENVPTFILTVTASDQAVNVTDRRWRTLVAEV
FT                   VILDVNDHSPTFVSYPITYVREDAEVGAVVHRITAQDPDAEMNGEVAYSILSGNEDMVF
FT                   VLDSSSGRVLMSQNIRHLVIPENTKPSKIMSLMKSPDPLQQDHGGKLHFSIAAEDKDDH
FT                   FEIDSSTGDLFLTKELDYEMTSHYLIRVISKDHSQSPAWNSTVFLSIDVEDQNEHSPSF
FT                   QDEFIVISIEENVPVGTLVYVFNAKDGDGSFLNSRIQYFAESSSVGVNPFLIHPSSGAL
FT                   VTASPLDRENVPTFILTVTASDQAVNVTDRRWRTLVAEVVILDVNDHSPTFVSYPITYV
FT                   REDAEVGAVVHRITAQDPDAEMNGEVAYSILSGNEDMVFVLDSSSGLLRIACPLDYEVK
FT                   TQHILTLVAHDGGMPARSSSQTLTITVLDVNDETPAFKQLLYETSVKENQSPGVFVTRV
FT                   EAEDTDSGVNSKHQFEIMPGPAFGLFEINPDTGEVVTAVTFDREAQGIFRLRVLVRDGG
FT                   VPSLSSTADIICTIEDENDHAPEFIVLHHDIEILENRDPEVVYTVLAFDMDAGNNGAVT
FT                   YHIAEGNTDEYFAIHTTSGELSTTRALDREQISNFTLTILCSDLGNPPRSSAMQLHVRV
FT                   LDDNDHSPAFPMLHYQSSIREDAEVGTVVLVLSAVDRDEGLNGQVEYFLMEEVSGAFTI
FT                   DHVTGILRTSHALDREARSQHTFQAVARDCSTQGAKSSVLSILISVTDANDNDPVWEEN
FT                   PVDAFISPMLALNQTVVHLRASDPDAGPNGTVTFSFADRQSVFSIDGYTGEVKLQQNLS
FT                   SEHFPIWLQLLATDQGTPARTTMGLLVVHKEGEGMKLSFSRYLYTGLVTENCEPGQLIV
FT                   EEPGLLDFEVRSEVRLIILAESNGHQAFTQVTVAIQDWNDNPPRFAQSVYQASVSEGQF
FT                   YSVHVIQVSATDLDQGLNSQIEYSIVSGNQAGAFRIDELNGVILTNSILDYESSGSYSL
FT                   IVQATDRGVPRLSGTALVKIQVTDINDNAPVFLPSEAVEIAENSLPGVIVARVSVHDAD
FT                   LNPAFTFSLVKESSSAAKFAISQDTGVVVLAQTLDFEEVTEYELIVRVSDSVHHTEGSV
FT                   IIRVLDVNDNPPVFTQDFYQAAVPELTPGGYLVLTLSATDLESSGDISYRILSPPEGFT
FT                   IDPRNGTIFTTNSVSVLEKIPTLRFLVEANDGGIPSLTALTLVEIEIQDVNNYAPEFPA
FT                   GCYNLSLSEDTPIGSTLMTFSTIDGDYSFENTHTEYSIISGNLHNYFHIETSLLGSEHP
FT                   HQQRGALVLLHALDREASASHKLVILASDHSCPPLSSTSVIAIDILDINDNAPTFSSRR
FT                   YQAHVKESTPVGSHITMVSADDPDKGSHAEIIYGIISGNEKEHFYLEDRTGVLYLVKPL
FT                   DYEETVAFTLTIQATDEEEKHVSFAAVHISVLDDNDHSPQFLSSTLACITPENLPPLSI
FT                   ICSVHALDFDTGPYGEVTYSIVSPCLVTHGMHPYQDLFAIDPLTGDIHTEQMLDYESVR
FT                   EYCLLVQAKDRGDASASLEVWVEVEGIDEFEPIFTQDQYFFSLREKGQGQQLIGRVEAS
FT                   DADAGVDGEVLYSLRTPSTVFSVNKTNGNIYWVRAPLLGSSQLVKEDTLEVKIIAHSPK
FT                   PGSKSTSCSVFVNVSLPAEGHHRTVLVHSFSISLVVSLLVFLSLVCTLIVLILRHKQKD
FT                   PLHSYEEKKTPSSPDADPKLTGAASELKAGQETAEYRGVTGPGEVMPAEWLNLMSVMEK
FT                   DIIHLFRHSNYSGHCSVDGETAEDKEIQRINENPYRKDSDYALSDQGSRVPDSGIPRDS
FT                   DQLSCLSGETDVMTSSEVMEASHMFEEGVGGEGCDIIYVQNNALSLRREATAGVLAESR
FT                   RESFTSGSQEGRCVAPSTQMTSSDDVRGSYAWDYFLSWEPKFQHLASVFNDIARLKDEH
FT                   MQVPGIPKDTSFVFPPPLITAVAQPGIKAVPPRMPAITLGQVLPKFPRSPLPYHGGSLP
FT                   EVMTPNFSPSLSLLTMQTPARSPMLPDGESRGTHMLGPWHDRKAEDEVQ"
FT   gene            complement(18883090..18902130)
FT                   /locus_tag="mCG_1032281"
FT                   /note="gene_id=mCG1032281.0"
FT   mRNA            complement(join(18883090..18883165,18883885..18883927,
FT                   18888257..18888518,18902098..18902130))
FT                   /locus_tag="mCG_1032281"
FT                   /product="mCG1032281"
FT                   /note="gene_id=mCG1032281.0 transcript_id=mCT149985.0
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(18883145..18883165,18883885..18883927,
FT                   18888257..18888387))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032281"
FT                   /product="mCG1032281"
FT                   /note="gene_id=mCG1032281.0 transcript_id=mCT149985.0
FT                   protein_id=mCP65568.1"
FT                   /protein_id="EDL15417.1"
FT                   /translation="MNTPLASSLQVDGLGSNTELFAPLTLHELPCEWLLEGSPEHVHSS
FT                   RESFALLWSSCLQNLLWNT"
FT   gene            19015850..19016543
FT                   /pseudo
FT                   /locus_tag="mCG_49333"
FT                   /note="gene_id=mCG49333.2"
FT   mRNA            19015850..19016543
FT                   /pseudo
FT                   /locus_tag="mCG_49333"
FT                   /note="gene_id=mCG49333.2 transcript_id=mCT49516.1 created
FT                   on 28-MAR-2003"
FT   gene            19095239..19103243
FT                   /gene="Sfrp2"
FT                   /locus_tag="mCG_17072"
FT                   /note="gene_id=mCG17072.1"
FT   mRNA            join(19095239..19095967,19098250..19098330,
FT                   19102046..19103243)
FT                   /gene="Sfrp2"
FT                   /locus_tag="mCG_17072"
FT                   /product="secreted frizzled-related protein 2"
FT                   /note="gene_id=mCG17072.1 transcript_id=mCT16025.1 created
FT                   on 19-AUG-2002"
FT   CDS             join(19095466..19095967,19098250..19098330,
FT                   19102046..19102350)
FT                   /codon_start=1
FT                   /gene="Sfrp2"
FT                   /locus_tag="mCG_17072"
FT                   /product="secreted frizzled-related protein 2"
FT                   /note="gene_id=mCG17072.1 transcript_id=mCT16025.1
FT                   protein_id=mCP11563.1"
FT                   /db_xref="GOA:Q3UI35"
FT                   /db_xref="InterPro:IPR001134"
FT                   /db_xref="InterPro:IPR008993"
FT                   /db_xref="InterPro:IPR015526"
FT                   /db_xref="InterPro:IPR018933"
FT                   /db_xref="InterPro:IPR020067"
FT                   /db_xref="InterPro:IPR026558"
FT                   /db_xref="MGI:MGI:108078"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UI35"
FT                   /protein_id="EDL15416.1"
FT                   /translation="MPRGPASLLLLVLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPA
FT                   NLQLCHGIEYQNMRLPNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCL
FT                   DDLDETIQPCHSLCVQVKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLP
FT                   ATEEAPKVCEACKTKNEDDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIY
FT                   KLNGVSERDLKKSVLWLKDSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQR
FT                   EFKRISRSIRKLQC"
FT   gene            complement(19168382..19173672)
FT                   /gene="Tlr2"
FT                   /locus_tag="mCG_17071"
FT                   /note="gene_id=mCG17071.1"
FT   mRNA            complement(join(19168382..19170900,19173000..19173247,
FT                   19173631..19173672))
FT                   /gene="Tlr2"
FT                   /locus_tag="mCG_17071"
FT                   /product="toll-like receptor 2"
FT                   /note="gene_id=mCG17071.1 transcript_id=mCT16024.0 created
FT                   on 19-AUG-2002"
FT   CDS             complement(19168531..19170885)
FT                   /codon_start=1
FT                   /gene="Tlr2"
FT                   /locus_tag="mCG_17071"
FT                   /product="toll-like receptor 2"
FT                   /note="gene_id=mCG17071.1 transcript_id=mCT16024.0
FT                   protein_id=mCP11558.1"
FT                   /db_xref="GOA:G3X8Y8"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR000483"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR017241"
FT                   /db_xref="InterPro:IPR027185"
FT                   /db_xref="MGI:MGI:1346060"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Y8"
FT                   /protein_id="EDL15415.1"
FT                   /translation="MLRALWLFWILVAITVLFSKRCSAQESLSCDASGVCDGRSRSFTS
FT                   IPSGLTAAMKSLDLSFNKITYIGHGDLRACANLQVLMLKSSRINTIEGDAFYSLGSLEH
FT                   LDLSDNHLSSLSSSWFGPLSSLKYLNLMGNPYQTLGVTSLFPNLTNLQTLRIGNVETFS
FT                   EIRRIDFAGLTSLNELEIKALSLRNYQSQSLKSIRDIHHLTLHLSESAFLLEIFADILS
FT                   SVRYLELRDTNLARFQFSPLPVDEVSSPMKKLAFRGSVLTDESFNELLKLLRYILELSE
FT                   VEFDDCTLNGLGDFNPSESDVVSELGKVETVTIRRLHIPQFYLFYDLSTVYSLLEKVKR
FT                   ITVENSKVFLVPCSFSQHLKSLEFLDLSENLMVEEYLKNSACKGAWPSLQTLVLSQNHL
FT                   RSMQKTGEILLTLKNLTSLDISRNTFHPMPDSCQWPEKMRFLNLSSTGIRVVKTCIPQT
FT                   LEVLDVSNNNLDSFSLFLPRLQELYISRNKLKTLPDASLFPVLLVMKIRENAVSTFSKD
FT                   QLGSFPKLETLEAGDNHFVCSCELLSFTMETPALAQILVDWPDSYLCDSPPRLHGHRLQ
FT                   DARPSVLECHQAALVSGVCCALLLLILLVGALCHHFHGLWYLRMMWAWLQAKRKPKKAP
FT                   CRDVCYDAFVSYSEQDSHWVENLMVQQLENSDPPFKLCLHKRDFVPGKWIIDNIIDSIE
FT                   KSHKTVFVLSENFVRSEWCKYELDFSHFRLFDENNDAAILVLLEPIERKAIPQRFCKLR
FT                   KIMNTKTYLEWPLDEGQQEVFWVNLRTAIKS"
FT   gene            complement(19233867..19274153)
FT                   /locus_tag="mCG_18092"
FT                   /note="gene_id=mCG18092.1"
FT   mRNA            complement(join(19233867..19234824,19235388..19235527,
FT                   19236538..19236629,19237558..19237678,19241244..19241326,
FT                   19242558..19242636,19245355..19245537,19246576..19246715,
FT                   19249471..19249595,19255658..19255806,19258146..19258768,
FT                   19259154..19259303,19260194..19260379,19262311..19262497,
FT                   19263218..19263360,19264887..19265014,19266842..19266914,
FT                   19267930..19268039,19268930..19269071,19270805..19270922,
FT                   19273454..19273577,19273999..19274153))
FT                   /locus_tag="mCG_18092"
FT                   /product="mCG18092"
FT                   /note="gene_id=mCG18092.1 transcript_id=mCT19784.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(19234552..19234824,19235388..19235527,
FT                   19236538..19236629,19237558..19237678,19241244..19241326,
FT                   19242558..19242636,19245355..19245537,19246576..19246715,
FT                   19249471..19249595,19255658..19255806,19258146..19258768,
FT                   19259154..19259303,19260194..19260379,19262311..19262497,
FT                   19263218..19263360,19264887..19265014,19266842..19266914,
FT                   19267930..19268039,19268930..19269071,19270805..19270872))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18092"
FT                   /product="mCG18092"
FT                   /note="gene_id=mCG18092.1 transcript_id=mCT19784.2
FT                   protein_id=mCP11546.2"
FT                   /protein_id="EDL15414.1"
FT                   /translation="MDSELANKLYERWKKYKSGDACRRNVLGMAQFAFTKKSKETEPFV
FT                   SFLPRVVPEPNLVLNFSATALRNSAVKYFVVRNPTPQPVSLQLLPLSLYPRPEAAVRLL
FT                   HKWFGTDMQMVNLSTGEFQLTQACPYQGEPSEESSLGALHVHLQALETRRVGVVFTPAD
FT                   YGKVTSLILIRNNLTVVDMVGVEGFGAQELLKVGGRLPGAGGSLRFKVPESTLMDCHRQ
FT                   LKDSKQILSITKNFKVENIGPLPITVTSLKINGYNCQGYGFEVLDCHPFSLSPNTSRDI
FT                   SIVFTPDFTSSWVIRELTLVTAADLEFHFTLNVTLPHHMLPLCAEVVPGPSWEESFWRL
FT                   TVFFVSLSLLGVILIAFQQAQYILMEFMKTRQRQNGSSSSQQNGDPVAMISSHPHKSTC
FT                   KNFLDTYSPSDKGRGKSCLPVGPSLSRLQNAAKRSPATYGHSQKKHKCSFYYSKQKPSA
FT                   SAASSANVTTEEKQTVTLASSLSVAKEDICTNVLSENWVSLRYASGINGSLQKNLTLPK
FT                   NVLHKEESSLKNTVVTNTPSECSMKEGVHTYMFPKETDSKISENVAELKEQEPCPQKTS
FT                   KKPPESTLPKTPPQYLQSDLPEVSRKHGNKQQAPVRSEVDSFEPVRAADAEPSSVRKTQ
FT                   GASPEDTCSEKQDTPSAEQEDPSRKRKLQERREGSTQALNWNKTRPCRRNKKRASAQAS
FT                   SSPRPSEQSEQRLVCSDVRSWCAQDGAGETCKAGTEVSGSSPERREEDSYYQKSEKKCA
FT                   DKFCSDSSSDCGSSSGSVRASRGSWGSWSSSSSDCDRRPVVDIQHFLPPGDGVSPQNFP
FT                   SEASVPLSLPQHVCSSTDVSVLPEFTESPCPGLPATPAGAGEEKGLYPPGGLWPSQPVC
FT                   LTSSFNCPVENGAPGVSQEPTSIPDSSFIDWSASCEGQFPSVYCPLELNDYNAFPEENM
FT                   NYTNGFPCSSKVQTDFIGHSTPSTWNTPASMPAAWGHASLVNSPSYLTSTRSLSPMSGL
FT                   FGSIWAPQSEVYETCCPISPATEHATHMENQVMCKEYYLGFNPFRAYMNLDIWTSTANR
FT                   NANFPLSRDSSYCGNM"
FT   gene            complement(19276483..19376627)
FT                   /locus_tag="mCG_18095"
FT                   /note="gene_id=mCG18095.1"
FT   mRNA            complement(join(19276483..19276591,19278416..19278569,
FT                   19278781..19278858,19296720..19296830,19297549..19297665,
FT                   19298330..19298453,19304185..19304253,19367908..19367951,
FT                   19375778..19375848,19376440..19376627))
FT                   /locus_tag="mCG_18095"
FT                   /product="mCG18095"
FT                   /note="gene_id=mCG18095.1 transcript_id=mCT19786.2 created
FT                   on 14-NOV-2002"
FT   CDS             complement(join(19276545..19276591,19278416..19278569,
FT                   19278781..19278858,19296720..19296830,19297549..19297665,
FT                   19298330..19298453,19304185..19304253,19367908..19367951,
FT                   19375778..19375848,19376440..19376563))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18095"
FT                   /product="mCG18095"
FT                   /note="gene_id=mCG18095.1 transcript_id=mCT19786.2
FT                   protein_id=mCP11569.2"
FT                   /protein_id="EDL15413.1"
FT                   /translation="MAGLRRPQSGAYRRTAAAVNLLLGVFQVLLSCCRPGGAQGQAFEP
FT                   LPNVVELWQAEEGELLLPTQGDSEEDMEEPSQEQSFSDKLFIGKGLHFQPSVLDFGIQF
FT                   LGHPAAKLLYAYNPSRESEVVVNSVFTAARHFHVPPVHCRVIPAMGKASFRVIFLPTEE
FT                   GSIESSLFINTSSHGVFSYHVSGVGTRRVSTEGSAEQLPNAYFLLPQVQSIQLSQTQAE
FT                   TTNTSLLRVQLECSLHNKVCQQLKSCSLGSDDALHLEMNIIVAVENSSKQPEENTQALL
FT                   DHLSIVYVATDESDTSGYTSFLTEKCPVSAV"
FT   gene            complement(19424909..19487805)
FT                   /locus_tag="mCG_18091"
FT                   /note="gene_id=mCG18091.2"
FT   mRNA            complement(join(19424909..19425148,19430519..19430563,
FT                   19441803..19441917,19452747..19452821,19473387..19473535,
FT                   19477549..19477606,19481074..19481140,19487752..19487805))
FT                   /locus_tag="mCG_18091"
FT                   /product="mCG18091"
FT                   /note="gene_id=mCG18091.2 transcript_id=mCT19783.2 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(19425042..19425148,19430519..19430563,
FT                   19441803..19441917,19452747..19452821,19473387..19473535,
FT                   19477549..19477606,19481074..19481097))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18091"
FT                   /product="mCG18091"
FT                   /note="gene_id=mCG18091.2 transcript_id=mCT19783.2
FT                   protein_id=mCP11544.2"
FT                   /protein_id="EDL15412.1"
FT                   /translation="MMEIFFETKDVFQLKDLEKLAPKEKGITAMSVKEVLQSLVDDGMV
FT                   DCERIGTSNYYWAFPSKALHARKRKLEALNSQLSEGSQKHADLQKSIEKARVGRQETEE
FT                   RAMLAKELSSFRDQRQQLKAEVEKYRECDPQVVEEIREANKVAKEAANRWTDNIFAIKS
FT                   WAKRKFGFEESKIDKNFGIPEDFDYID"
FT   gene            complement(19492580..19553444)
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /note="gene_id=mCG18088.1"
FT   mRNA            complement(join(19492580..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19523860,19524710..19524890,
FT                   19525850..19526001,19540753..19540990,19542752..19542933,
FT                   19553212..19553444))
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, transcript variant
FT                   mCT19780"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT19780.1 created
FT                   on 20-AUG-2002"
FT   mRNA            complement(join(19495477..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19523860,19524710..19524890,
FT                   19525850..19526001,19540753..19540990,19542752..19542933,
FT                   19545165..>19545417))
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, transcript variant
FT                   mCT190926"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT190926.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(19495858..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19524890,19525850..19526001,
FT                   19540753..19540990,19542752..19542933,19553212..>19553428))
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, transcript variant
FT                   mCT190925"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT190925.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(19497228..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19523860,19524710..19524890,
FT                   19525850..19526001,19540753..19540990,19542752..19542933,
FT                   19545165..>19545167))
FT                   /codon_start=1
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT190926.0
FT                   protein_id=mCP111893.0 isoform=CRA_b"
FT                   /protein_id="EDL15409.1"
FT                   /translation="QQRAGSRTAGPPCQWSRMASEGASIPSPVVRQIDKQFLICSICLE
FT                   RYKNPKVLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLM
FT                   DVLQRTPGSNGEDSSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEH
FT                   AEHPTVPLKDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIH
FT                   STFDELQKTLNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNH
FT                   GTETEVLLVKKQMSEKLNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNA
FT                   VASETVATGEGLRQTIIGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEIL
FT                   DNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSP
FT                   GSGHVKQKAVKRPASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKI
FT                   LIADSNNQCVQIFSNDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSI
FT                   FSNDGKFKTKIGSGKLMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNG
FT                   DRQFAGPHFAAVNSNNEIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAV
FT                   DSNGNIIVADWGNSRIQVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHC
FT                   FKVYRYLQ"
FT   CDS             complement(join(19497228..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..19523860,19524710..19524890,
FT                   19525850..19526001,19540753..19540990,19542752..19542885))
FT                   /codon_start=1
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT19780.1
FT                   protein_id=mCP11539.2 isoform=CRA_c"
FT                   /protein_id="EDL15410.1"
FT                   /translation="MASEGASIPSPVVRQIDKQFLICSICLERYKNPKVLPCLHTFCER
FT                   CLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTPGSNGEDSSIL
FT                   ETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPLKDVVEQHKA
FT                   SLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKTLNVRKSVL
FT                   LMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEKL
FT                   NELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTII
FT                   GQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEG
FT                   DFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASMY
FT                   STGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSNDG
FT                   QFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKLM
FT                   GPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNNE
FT                   IIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQ
FT                   VFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ"
FT   CDS             complement(join(19497228..19497380,19499781..19499921,
FT                   19503602..19503672,19504924..19505092,19509772..19509939,
FT                   19510224..19510327,19523137..>19524037))
FT                   /codon_start=1
FT                   /gene="Trim2"
FT                   /locus_tag="mCG_18088"
FT                   /product="tripartite motif protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG18088.1 transcript_id=mCT190925.0
FT                   protein_id=mCP111892.0 isoform=CRA_a"
FT                   /protein_id="EDL15408.1"
FT                   /translation="RSAWVHWVKWNADGSEPPEWAGVEVGSFGRRALPQLLAKCPAGCT
FT                   VSCRKRSLPLCPRQVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVKKQMSEK
FT                   LNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEGLRQTI
FT                   IGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKE
FT                   GDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRPASM
FT                   YSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFSND
FT                   GQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGKL
FT                   MGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNN
FT                   EIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRI
FT                   QVFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ"
FT   gene            19506899..19507286
FT                   /locus_tag="mCG_18090"
FT                   /note="gene_id=mCG18090.0"
FT   mRNA            19506899..19507286
FT                   /locus_tag="mCG_18090"
FT                   /product="mCG18090"
FT                   /note="gene_id=mCG18090.0 transcript_id=mCT19782.0 created
FT                   on 08-NOV-2002"
FT   CDS             19506933..19507253
FT                   /codon_start=1
FT                   /locus_tag="mCG_18090"
FT                   /product="mCG18090"
FT                   /note="gene_id=mCG18090.0 transcript_id=mCT19782.0
FT                   protein_id=mCP11542.1"
FT                   /protein_id="EDL15411.1"
FT                   /translation="MVNVPKTRQTFCKKCGKHQSHKVTQYKKGKDSLYAQGKRRYDRKQ
FT                   SGYGGQTKPIFRKKAKTTKKIVLRLESVEPNCRSKRMLARKRCEHFELGGDKKRKGQVI
FT                   QF"
FT   gene            complement(19632616..19637397)
FT                   /locus_tag="mCG_147527"
FT                   /note="gene_id=mCG147527.0"
FT   mRNA            complement(join(19632616..19634566,19637245..19637397))
FT                   /locus_tag="mCG_147527"
FT                   /product="mCG147527"
FT                   /note="gene_id=mCG147527.0 transcript_id=mCT187790.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(19633734..19633991)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147527"
FT                   /product="mCG147527"
FT                   /note="gene_id=mCG147527.0 transcript_id=mCT187790.0
FT                   protein_id=mCP109371.0"
FT                   /protein_id="EDL15407.1"
FT                   /translation="MQYILLTVVILWEHQDLFLPSTYFLPVTNLTLFSFPSSLAVFEDQ
FT                   SLLSPSGTSGLRFCVSEVMQSFLFVLSLFPEGLPGPTCYE"
FT   gene            complement(19682062..19706263)
FT                   /locus_tag="mCG_60260"
FT                   /note="gene_id=mCG60260.1"
FT   mRNA            complement(join(19682062..19682793,19704511..19704668,
FT                   19705125..19705152,19706069..19706263))
FT                   /locus_tag="mCG_60260"
FT                   /product="mCG60260"
FT                   /note="gene_id=mCG60260.1 transcript_id=mCT60443.1 created
FT                   on 30-SEP-2002"
FT   CDS             complement(join(19682389..19682793,19704511..19704522))
FT                   /codon_start=1
FT                   /locus_tag="mCG_60260"
FT                   /product="mCG60260"
FT                   /note="gene_id=mCG60260.1 transcript_id=mCT60443.1
FT                   protein_id=mCP33320.2"
FT                   /protein_id="EDL15406.1"
FT                   /translation="MGRENTQGLQKEKTQHSYVKVPSRVHRPSPACSHEANHDLHPGHT
FT                   PPTPPPPTSLHLQGKHAQSSPATRTFPCKPNKIDGRNCGKEAGRETVVSKVGSEAWASS
FT                   SLRSNNNTKEKHSLNLKLSSSGGRSRVRSEGRIS"
FT   gene            complement(19770785..19805807)
FT                   /gene="6330505N24Rik"
FT                   /locus_tag="mCG_18093"
FT                   /note="gene_id=mCG18093.2"
FT   mRNA            complement(join(19770785..19773262,19775484..19775648,
FT                   19778104..19778221,19780242..19780312,19781517..19781624,
FT                   19781718..19781788,19783704..19783804,19783895..19783980,
FT                   19790917..19791019,19791848..19791909,19800460..19801097,
FT                   19805685..19805807))
FT                   /gene="6330505N24Rik"
FT                   /locus_tag="mCG_18093"
FT                   /product="RIKEN cDNA 6330505N24"
FT                   /note="gene_id=mCG18093.2 transcript_id=mCT19785.2 created
FT                   on 08-NOV-2002"
FT   CDS             complement(join(19771199..19773262,19775484..19775648,
FT                   19778104..19778221,19780242..19780312,19781517..19781624,
FT                   19781718..19781788,19783704..19783804,19783895..19783980,
FT                   19790917..19791019,19791848..19791909,19800460..19800960))
FT                   /codon_start=1
FT                   /gene="6330505N24Rik"
FT                   /locus_tag="mCG_18093"
FT                   /product="RIKEN cDNA 6330505N24"
FT                   /note="gene_id=mCG18093.2 transcript_id=mCT19785.2
FT                   protein_id=mCP11551.2"
FT                   /protein_id="EDL15405.1"
FT                   /translation="MHVMNCVSLASDKENGTLATAAAFMTGQTSPSASPPPPPPPPPPP
FT                   PCPHSGEGFSPSPPPPLPPPLPGGPPIPPPPPPGLPSVSYLNGYSSLGKKKRMRSFFWK
FT                   TIPEEQVRGKTNIWTLAAKQQHQYQIDKKTIEELFGQQEDTSKASLPKRGGALNSSFRD
FT                   AREEVTVLDAKRSMNIGIFLKQFKKSPQSIVEDIYQGKSEHYGSETLREILKLLPESEE
FT                   VKKLKAFNGDVSKLSLADSFLHCLIQVPNYSLRIEAMVLKKEFLPSCSSLFKDIRTLRA
FT                   ATKELMLCEELHSILHLVLQAGNIMNAGGYAGNAVGFKLSSLLKLADTKANKPGMNLLH
FT                   FVAQEAQKQDAILLNFSEKLQHVQETSRLSLDITEAELHSLFVRTKSLQENIQLDQELC
FT                   QQMEDFLQFAVEKLAELELWKRELQGEAHTLIDFFCEDKETMKLDECFQIFRDFCTRFN
FT                   KAVKDNHDREEQERKQLQRQKEMEQKRYSWSTGELGSFGRSSSENDVQMLAKTGTEDLP
FT                   SFLKPRPNSPSYRPPNTRRSRLSLGISADRELLTFLESATSSPEDPNKFNSLPRSSPRQ
FT                   ARPTIAWMEPREQQSHGPNFTHEPQASKIQEKAPPPAWQNQLPTTWREEPASPLPLAGR
FT                   SRPSLRKRNSEPVGLGPTQSPPLLPLDLGVREHELVTGLTQFDLQSPKSLEEGSQLTLN
FT                   DFCPTKLPSPGDRSSQSFAAGGDSLPPKNTDTQEVLSPAGEDDRTISDEPSSEALVSVV
FT                   VTDTEDKDAGPLLYVSDTTDCSLTLDCSEGMDSRAGGDKQEEEKEGDGSVSSGAGEAGS
FT                   SQVSSNSVSSPPGEVPAPKSSKSELSCQGGLPKDRPSRGKDAIAPKRNSFKEASVGASK
FT                   PVSARRSQGVTTKPVRTLNSSENEHMRKVVPISKSSRGAGPWKRPEPTPKATPRETPSS
FT                   TDTPLSRRSSVRGTSDTSPRRPQVSGSGAEEPRLPRSSGSISGRPGKDAPLQPRASFRK
FT                   PSAKPLRNIPRQKPEENKVSSPNSPDPESPKEEPKAPQATGVSRALPPIPSFARNTVAS
FT                   SSRSLRTDAPPAARTTGLTRTVSQRQLRVKGGSEDSASKDIGTLKRASSARASKKCPES
FT                   AGGSSANVETSLKGRGTTERSSLRLKDSGQATLGRILRPLQK"
FT   gene            complement(19822399..>19874362)
FT                   /locus_tag="mCG_18094"
FT                   /note="gene_id=mCG18094.1"
FT   mRNA            complement(join(19822399..19824194,19836072..19836246,
FT                   19841906..19842063,19845712..19845933,19853899..19854011,
FT                   19855377..19855472,19860818..19860926,19874270..>19874362))
FT                   /locus_tag="mCG_18094"
FT                   /product="mCG18094"
FT                   /note="gene_id=mCG18094.1 transcript_id=mCT19787.2 created
FT                   on 30-SEP-2002"
FT   CDS             complement(join(19824039..19824194,19836072..19836246,
FT                   19841906..19842063,19845712..19845933,19853899..19854011,
FT                   19855377..19855472,19860818..19860926,19874270..19874362))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18094"
FT                   /product="mCG18094"
FT                   /note="gene_id=mCG18094.1 transcript_id=mCT19787.2
FT                   protein_id=mCP11561.1"
FT                   /db_xref="GOA:G5E8V9"
FT                   /db_xref="InterPro:IPR010504"
FT                   /db_xref="InterPro:IPR027267"
FT                   /db_xref="MGI:MGI:1277120"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8V9"
FT                   /protein_id="EDL15404.1"
FT                   /translation="MAQESPKNSAAEIPVTSNGEVDDAHEHGYNRDLKHSLPSGLGLSE
FT                   TQITSHGFDSTKEGVTEAGAPQGSSAPPLPCVLSPSRVAASKLTQQAGDLTVPAGGQRT
FT                   HTKGGPVILADEIKNPAMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQID
FT                   ILRDNKKKYENILKLAQTLSTQLFQMVHTQKQLGDAFADLSLKSLELHEEFGYNADTQK
FT                   LLAKNGETLLGAINFFIASVNTLVNKTIEDTLMTVKQYENARVEYDAYRTDLEELNLGP
FT                   RDANTLPKIEQSQHLFQIHKEKYDKMRSDVSVKLKFLEENKVKVLRNQLVLFHSAVAAY
FT                   FAGNQKQLELTLKQFHVRLKTPGVDAPSWLEEQ"
FT   gene            complement(19879221..19879819)
FT                   /pseudo
FT                   /locus_tag="mCG_1032201"
FT                   /note="gene_id=mCG1032201.1"
FT   mRNA            complement(19879221..19879819)
FT                   /pseudo
FT                   /locus_tag="mCG_1032201"
FT                   /note="gene_id=mCG1032201.1 transcript_id=mCT149905.1
FT                   created on 28-MAR-2003"
FT   gene            complement(19883303..19884146)
FT                   /pseudo
FT                   /locus_tag="mCG_1032221"
FT                   /note="gene_id=mCG1032221.1"
FT   mRNA            complement(19883303..19884146)
FT                   /pseudo
FT                   /locus_tag="mCG_1032221"
FT                   /note="gene_id=mCG1032221.1 transcript_id=mCT149925.1
FT                   created on 28-MAR-2003"
FT   gene            19920227..19923687
FT                   /gene="Tigd4"
FT                   /locus_tag="mCG_147529"
FT                   /note="gene_id=mCG147529.0"
FT   mRNA            19920227..19923687
FT                   /gene="Tigd4"
FT                   /locus_tag="mCG_147529"
FT                   /product="tigger transposable element derived 4"
FT                   /note="gene_id=mCG147529.0 transcript_id=mCT187792.0
FT                   created on 13-JAN-2004"
FT   CDS             19920433..19921974
FT                   /codon_start=1
FT                   /gene="Tigd4"
FT                   /locus_tag="mCG_147529"
FT                   /product="tigger transposable element derived 4"
FT                   /note="gene_id=mCG147529.0 transcript_id=mCT187792.0
FT                   protein_id=mCP109373.0"
FT                   /protein_id="EDL15403.1"
FT                   /translation="MAEASVDIGTQPVTVKKKKSLSIEEKIDIINAVESGKKKAEIAAE
FT                   YGIKKNSLSSIMKNKDKVLEAFESLRFDPKRKRLRTAFYTDLEEALMRWYRIAQCLNVP
FT                   VNGPMLRLKANDFAQKLGHNDFKCSNGWLDRFKSRYGLVFRAQPVEATGISIDPSTVWY
FT                   QNVLPYYLNDYHPKNVFNVKETGLLYRMLPTNTFAFKGETCSVGKLCKDRITLALGTNM
FT                   DGSEKLPLLIIGKNRAPRCFKGIKSLPVYYEANRTAWMTAAIFEQWMQKLDEKFQAQKR
FT                   RVVIFVDSCPAHPEVKNLKSIELAFFPSCLSSGFAAMNQGVIKSLKIKYRHCLIKKFLS
FT                   SVESSKEFTFSLLDAVDTLHLCWRAVTPETIVKSYEEAGFRSPKGENDTANADAAVALD
FT                   LTAHAVGAGVEFLEGLSIEEYAALDEDLETCEATQKDDAEWAGESKQDETGLYTSDEEE
FT                   EDSGALEVDLPSPSKKDALSAVGTLKRFLRSHDLNDELHGSLADLENFINALSPK"
FT   gene            19993196..20028999
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /note="gene_id=mCG18089.1"
FT   mRNA            join(19993196..19993354,20011103..20011357,
FT                   20016474..20016501,20017442..20017527,20019392..20019449,
FT                   20028939..20028999)
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /product="transmembrane protein 154, transcript variant
FT                   mCT19781"
FT                   /note="gene_id=mCG18089.1 transcript_id=mCT19781.1 created
FT                   on 27-MAR-2003"
FT   mRNA            join(19993249..19993354,20011103..20011357,
FT                   20011446..20011484,20016474..20016501,20017442..20017527,
FT                   20019392..20019449,20028939..20028998)
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /product="transmembrane protein 154, transcript variant
FT                   mCT181532"
FT                   /note="gene_id=mCG18089.1 transcript_id=mCT181532.0 created
FT                   on 27-MAR-2003"
FT   CDS             join(19993291..19993354,20011103..20011357,
FT                   20011446..20011484,20016474..20016501,20017442..20017527,
FT                   20019392..20019449,20028939..20028954)
FT                   /codon_start=1
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /product="transmembrane protein 154, isoform CRA_a"
FT                   /note="gene_id=mCG18089.1 transcript_id=mCT181532.0
FT                   protein_id=mCP104454.0 isoform=CRA_a"
FT                   /protein_id="EDL15401.1"
FT                   /translation="MTVPCAALVLALGLAFGQSSQGNDEESEYSGQSITEEENSEDETT
FT                   RSALATVTTEALAENVNSTHTNDTSNQVEFILMVAIPLAALLILLFMVLIATYFKSKRP
FT                   KQEPSSQGSQSALQTHELGGETLKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADYECL
FT                   PTLKEEKEPNPSPSDNES"
FT   CDS             join(19993291..19993354,20011103..20011357,
FT                   20016474..20016501,20017442..20017527,20019392..20019449,
FT                   20028939..20028954)
FT                   /codon_start=1
FT                   /gene="Tmem154"
FT                   /locus_tag="mCG_18089"
FT                   /product="transmembrane protein 154, isoform CRA_b"
FT                   /note="gene_id=mCG18089.1 transcript_id=mCT19781.1
FT                   protein_id=mCP11541.2 isoform=CRA_b"
FT                   /protein_id="EDL15402.1"
FT                   /translation="MTVPCAALVLALGLAFGQSSQGNDEESEYSGQSITEEENSEDETT
FT                   RSALATVTTEALAENVNSTHTNDTSNQVEFILMVAIPLAALLILLFMVLIATYFKSKRP
FT                   KQDELGGETLKVPIFEEDTPSVMEIEMEELDKWMNSMNRNADYECLPTLKEEKEPNPSP
FT                   SDNES"
FT   gene            <20143666..20314314
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /note="gene_id=mCG114058.1"
FT   mRNA            join(<20143666..20143858,20199163..20199210,
FT                   20199336..20199399,20238730..20239308,20289992..20290074,
FT                   20293620..20293761,20300364..20300498,20302557..20302680,
FT                   20304282..20304418,20305913..20306026,20307492..20307673,
FT                   20309520..20309745,20311291..20311501,20312390..20314314)
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /product="F-box and WD-40 domain protein 7, archipelago
FT                   homolog (Drosophila), transcript variant mCT190977"
FT                   /note="gene_id=mCG114058.1 transcript_id=mCT190977.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(20143813..20143858,20199163..20199210,
FT                   20238730..20238975,20287497..20287772,20289992..20290074,
FT                   20293620..20293761,20300364..20300498,20302557..20302680,
FT                   20304282..20304418,20305913..20306026,20307492..20307673,
FT                   20309520..20309745,20311291..20311501,20312390..20314314)
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /product="F-box and WD-40 domain protein 7, archipelago
FT                   homolog (Drosophila), transcript variant mCT115149"
FT                   /note="gene_id=mCG114058.1 transcript_id=mCT115149.1
FT                   created on 30-SEP-2002"
FT   CDS             join(<20199370..20199399,20238730..20239308,
FT                   20289992..20290074,20293620..20293761,20300364..20300498,
FT                   20302557..20302680,20304282..20304418,20305913..20306026,
FT                   20307492..20307673,20309520..20309745,20311291..20311501,
FT                   20312390..20312658)
FT                   /codon_start=1
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /product="F-box and WD-40 domain protein 7, archipelago
FT                   homolog (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG114058.1 transcript_id=mCT190977.0
FT                   protein_id=mCP111933.0 isoform=CRA_b"
FT                   /protein_id="EDL15400.1"
FT                   /translation="SLYTLCLDNQNVKTFASSDSLAKVQEVASWLLEMNQELLSVGSKR
FT                   RRTGGSLRGNASSSQVDEGQMNRVVEEDPQQQARHQEEEHTARNGELVGANPRPGDQND
FT                   TQQGQVEENNNRFISVDEDSSGNQEEQEEDEEHAGEQEEEEEEEEEEEEMDQESDDFDP
FT                   SDDSSREDEHTHNSNVTNCSSVSDLPAHQLSSPFYTKTTKMKRKLDHGSEVRSFSLGKK
FT                   PCKVSDYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKMFQSWS
FT                   GPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKDLLQA
FT                   AQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYIRQHRIDT
FT                   NWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGHTG
FT                   GVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRDA
FT                   TLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGH
FT                   TNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNA
FT                   DSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIR
FT                   NLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK"
FT   CDS             join(20238799..20238975,20287497..20287772,
FT                   20289992..20290074,20293620..20293761,20300364..20300498,
FT                   20302557..20302680,20304282..20304418,20305913..20306026,
FT                   20307492..20307673,20309520..20309745,20311291..20311501,
FT                   20312390..20312658)
FT                   /codon_start=1
FT                   /gene="Fbxw7"
FT                   /locus_tag="mCG_114058"
FT                   /product="F-box and WD-40 domain protein 7, archipelago
FT                   homolog (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG114058.1 transcript_id=mCT115149.1
FT                   protein_id=mCP65815.1 isoform=CRA_a"
FT                   /protein_id="EDL15399.1"
FT                   /translation="MNQELLSVGSKRRRTGGSLRGNASSSQVDEGQMNRVVEEDPQQQA
FT                   RHQEEEHTARNGELWSCMRVCVPSSVLVLSCVCWCWGVLLPVPLPNLPFLACLSMSTLE
FT                   SVTYLPEKGLYCQRLPSSRTHGGTESLKGKNTENMGFYGTLKMIFYKMKRKLDHGSEVR
FT                   SFSLGKKPCKVSDYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWL
FT                   KMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLE
FT                   PKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAYI
FT                   RQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLR
FT                   TLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRV
FT                   VSGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETC
FT                   LHTLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDN
FT                   ILVSGNADSTVKIWDIKTGQCLQTLQGPSKHQSAVTCLQFNKNFVITSSDDGTVKLWDL
FT                   KTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK"
FT   gene            complement(20248135..20248790)
FT                   /pseudo
FT                   /locus_tag="mCG_50137"
FT                   /note="gene_id=mCG50137.2"
FT   mRNA            complement(20248135..20248790)
FT                   /pseudo
FT                   /locus_tag="mCG_50137"
FT                   /note="gene_id=mCG50137.2 transcript_id=mCT50320.2 created
FT                   on 28-MAR-2003"
FT   gene            <20659946..20672893
FT                   /locus_tag="mCG_146183"
FT                   /note="gene_id=mCG146183.0"
FT   mRNA            join(<20659946..20659988,20671828..20672163,
FT                   20672736..20672893)
FT                   /locus_tag="mCG_146183"
FT                   /product="mCG146183"
FT                   /note="gene_id=mCG146183.0 transcript_id=mCT186286.0
FT                   created on 14-JUL-2003"
FT   CDS             <20671832..20672011
FT                   /codon_start=1
FT                   /locus_tag="mCG_146183"
FT                   /product="mCG146183"
FT                   /note="gene_id=mCG146183.0 transcript_id=mCT186286.0
FT                   protein_id=mCP107587.0"
FT                   /protein_id="EDL15398.1"
FT                   /translation="AITTVLRRQERQPRTTEPHACQHLAPAATGAMRVLRTRQEDRIDT
FT                   WPIDGGRAKPMVLN"
FT   gene            complement(20733220..>20769751)
FT                   /locus_tag="mCG_145241"
FT                   /note="gene_id=mCG145241.0"
FT   mRNA            complement(join(20733220..20733935,20736525..20736647,
FT                   20739220..20739446,20740352..20740624,20769640..>20769751))
FT                   /locus_tag="mCG_145241"
FT                   /product="mCG145241"
FT                   /note="gene_id=mCG145241.0 transcript_id=mCT184665.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(20739352..20739446,20740352..>20740511))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145241"
FT                   /product="mCG145241"
FT                   /note="gene_id=mCG145241.0 transcript_id=mCT184665.0
FT                   protein_id=mCP105808.0"
FT                   /protein_id="EDL15397.1"
FT                   /translation="KWLLIDHKSCCASGHYKREEIAAFYIPQGINSKTVSCPYVGTKHI
FT                   LWHLLLGTAFLSGTQWALVATGFVEGSMSLWAWVMRPCF"
FT   gene            complement(20886246..20895321)
FT                   /locus_tag="mCG_147521"
FT                   /note="gene_id=mCG147521.0"
FT   mRNA            complement(join(20886246..20886485,20895224..20895321))
FT                   /locus_tag="mCG_147521"
FT                   /product="mCG147521"
FT                   /note="gene_id=mCG147521.0 transcript_id=mCT187784.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(join(20886379..20886485,20895224..20895266))
FT                   /codon_start=1
FT                   /locus_tag="mCG_147521"
FT                   /product="mCG147521"
FT                   /note="gene_id=mCG147521.0 transcript_id=mCT187784.0
FT                   protein_id=mCP109365.0"
FT                   /protein_id="EDL15396.1"
FT                   /translation="MGLQEYPSQSLPCDCPSETTVDQGLLSLSLQVTCSSRLCTGMTSF
FT                   LSHP"
FT   gene            <20915998..20991715
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /note="gene_id=mCG6516.4"
FT   mRNA            join(<20915998..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20990222)
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), transcript variant
FT                   mCT190942"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT190942.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<20915998..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989920)
FT                   /codon_start=1
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT190942.0
FT                   protein_id=mCP111924.0 isoform=CRA_b"
FT                   /protein_id="EDL15394.1"
FT                   /translation="RDFGDAMAAPMLRLGFPGRRWALTWLDGGSRHRSGSQTGPTSNWA
FT                   RRQSSVAQPSLHTAQKPRKGEHKWAAVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVS
FT                   YFDASLPGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYSDLPAGYQITQQRL
FT                   PIAANGHLTYCIYLGKKPSQVTTKTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIG
FT                   LLEVVLEPDLCCGEEAALAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGV
FT                   RTEVKNLNSLRFLAKAIDYEIQRQITELENGGEILNETRSFDYKLGCTMPMRDKEGKQD
FT                   YRFMPEPNLPPLVLYDDTSLPRGADSQQVINIDQLRDMLPELPSATRERLVQQYGMLPE
FT                   HSFALLNEVGLLEFFQNVIKETRTEPKKVTNWVLNTFLCYLKQQNLAVSESPVTPSALA
FT                   ELLNLLDRKAISSSAAKQVFEELWKGEGKTAAQIVSEQQLELMQDQEALEKLCQTTIDG
FT                   HPQVVTICNRSKSFVCNRSEGQLDICPQTLPSPINPYLCVSG"
FT   mRNA            join(20915999..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989803,20991113..20991552)
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), transcript variant
FT                   mCT181557"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT181557.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(20916001..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989846,20991113..20991715)
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), transcript variant mCT5946"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT5946.2 created on
FT                   26-MAR-2003"
FT   CDS             join(20916016..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989803,20991113..20991241)
FT                   /codon_start=1
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT181557.0
FT                   protein_id=mCP104479.0 isoform=CRA_a"
FT                   /protein_id="EDL15393.1"
FT                   /translation="MAAPMLRLGFPGRRWALTWLDGGSRHRSGSQTGPTSNWARRQSSV
FT                   AQPSLHTAQKPRKGEHKWAAVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVSYFDASL
FT                   PGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYSDLPAGYQITQQRLPIAANG
FT                   HLTYCIYLGKKPSQVTTKTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIGLLEVVL
FT                   EPDLCCGEEAALAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKN
FT                   LNSLRFLAKAIDYEIQRQITELENGGEILNETRSFDYKLGCTMPMRDKEGKQDYRFMPE
FT                   PNLPPLVLYDDTSLPRGADSQQVINIDQLRDMLPELPSATRERLVQQYGMLPEHSFALL
FT                   NEVGLLEFFQNVIKETRTEPKKVTNWVLNTFLCYLKQQNLAVSESPVTPSALAELLNLL
FT                   DRKAISSSAAKQVFEELWKGEGKTAAQIVSEQQLELMQDQEALEKLCQTTIDGHPQVVM
FT                   DVKKRNPKAINKLIGLVRKASHSRADPALIKKILERKLSL"
FT   CDS             join(20916016..20916191,20917736..20917886,
FT                   20943767..20943880,20946289..20946487,20946923..20947045,
FT                   20953264..20953377,20955375..20955459,20958573..20958617,
FT                   20960782..20960971,20974460..20974593,20982358..20982436,
FT                   20989669..20989846,20991113..20991153)
FT                   /codon_start=1
FT                   /gene="Pet112l"
FT                   /locus_tag="mCG_6516"
FT                   /product="PET112-like (yeast), isoform CRA_c"
FT                   /note="gene_id=mCG6516.4 transcript_id=mCT5946.2
FT                   protein_id=mCP11559.3 isoform=CRA_c"
FT                   /protein_id="EDL15395.1"
FT                   /translation="MAAPMLRLGFPGRRWALTWLDGGSRHRSGSQTGPTSNWARRQSSV
FT                   AQPSLHTAQKPRKGEHKWAAVVGLEIHAQISSNSKLFSGAQVCFAAPPNSLVSYFDASL
FT                   PGTLPVLNRRCVEAAVMTGLALNCHINKKSLFDRKHYFYSDLPAGYQITQQRLPIAANG
FT                   HLTYCIYLGKKPSQVTTKTVRIKQIQLEQDSGKSLHDDLRSQTLIDLNRAGIGLLEVVL
FT                   EPDLCCGEEAALAVRELQLILQALGTSQANMAEGQLRVDANISVHHPGEPLGVRTEVKN
FT                   LNSLRFLAKAIDYEIQRQITELENGGEILNETRSFDYKLGCTMPMRDKEGKQDYRFMPE
FT                   PNLPPLVLYDDTSLPRGADSQQVINIDQLRDMLPELPSATRERLVQQYGMLPEHSFALL
FT                   NEVGLLEFFQNVIKETRTEPKKVTNWVLNTFLCYLKQQNLAVSESPVTPSALAELLNLL
FT                   DRKAISSSAAKQVFEELWKGEGKTAAQIVSEQQLELMQDQEALEKLCQTTIDGHPQVVT
FT                   ICNRSKSFVCNRSDGCEEKKPQSYK"
FT   gene            complement(20997449..21229943)
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /note="gene_id=mCG51579.2"
FT   mRNA            complement(join(20997449..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21021001..21021080,21025851..21026018,21057818..21057904,
FT                   21060104..21060262,21067974..21068285))
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, transcript variant
FT                   mCT185450"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT185450.0 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(20997450..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21021001..21021080,21025851..21026018,21057818..21057904,
FT                   21060104..21060262,21124845..21124951,21156725..21156844,
FT                   21229551..21229883))
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, transcript variant
FT                   mCT5950"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT5950.2 created
FT                   on 12-JUN-2003"
FT   mRNA            complement(join(20997455..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21018315..21018407,21021001..21021080,21025851..21026018,
FT                   21057818..21057904,21060104..21060262,21124845..21124951,
FT                   21156725..21156844,21159399..21159565,21229551..21229943))
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, transcript variant
FT                   mCT185449"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT185449.0 created
FT                   on 12-JUN-2003"
FT   CDS             complement(join(20998356..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21021001..21021080,21025851..21026018,21057818..21057904,
FT                   21060104..21060262,21124845..21124913))
FT                   /codon_start=1
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, isoform CRA_c"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT5950.2
FT                   protein_id=mCP11552.3 isoform=CRA_c"
FT                   /protein_id="EDL15391.1"
FT                   /translation="MFNSLNPIVRASNSGITTPVVKQVLATGLSGLYSSLPTKLEEKGE
FT                   DWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQLVSYIYNGFLVPVLAPALH
FT                   KVTVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHENVHILDTLTSRINTPFRLC
FT                   VVSLALFRTLIGLHCEDVMLQLVLRYLVPCNHMMLSQRWAVKERDCYSVSAAKLLALTP
FT                   VCCASGITLTLGNQERDYILWSKCMHDGSGSEEQLLPETPCSPSSPSPPPPPAPAACIV
FT                   EYGKALDISYLQYLWEAHTNILHCMRDCRVWSALYDGDSPDPETFLQSLSEESRENSGH
FT                   PEARLPQQSVRTSGQTKDKSQSELEWDDSYDTGISSGADVGSPGPDDEVETPAPPAPID
FT                   PPKHIQEMKKNAILLFKGSYIEESDFQDDVMVYRLCAEKDTEDTTEPQKDTSEPQGDTL
FT                   EPLEDTSEQQEDTSEQLEDTSELQEDTAEPQGDTADPTAEAQPKLQPEAQSLPTSNGPL
FT                   SSPDPETESQPSRESSDLCQNTFSEAKPENEPGVALALDSELIATTFEAEPQSELAVVS
FT                   TESEDFIAQYDQIIQELDSGTEGLTEQSIPISEPSLLTQQEERREECKEEEDDDFDSLM
FT                   AATPAVEAGSSPFGVGEDTAFSSRHPVRTQSTPFTGPFISVVLSKLENMLENSLHVNLL
FT                   LIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLASVKNKIEQFASVERDFPGLL
FT                   IQAQQYLLFRVDMSDMAPAALTKDPIQEISRPESDKTLLDGPPRVLQPFLGNRAKVTRA
FT                   PPNLPLPVKNTMLAAALFPEFLKELAALAQEHSILCYKILGDFEDSCC"
FT   CDS             complement(join(20998356..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21018315..21018407,21021001..21021080,21025851..21026018,
FT                   21057818..21057904,21060104..21060262,21124845..21124913))
FT                   /codon_start=1
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, isoform CRA_a"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT185449.0
FT                   protein_id=mCP106706.0 isoform=CRA_a"
FT                   /protein_id="EDL15389.1"
FT                   /translation="MFNSLNPIVRASNSGITTPVVKQVLATGLSGLYSSLPTKLEEKGE
FT                   DWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQLVSYIYNGFLVPVLAPALH
FT                   KVTVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHENVHILDTLTSRINTPFRLC
FT                   VVSLALFRTLIGLHCEDVMLQLVLSLTGSEVHCFLPVGHQGQAKPELWQACLLDIWYLV
FT                   PCNHMMLSQRWAVKERDCYSVSAAKLLALTPVCCASGITLTLGNQERDYILWSKCMHDG
FT                   SGSEEQLLPETPCSPSSPSPPPPPAPAACIVEYGKALDISYLQYLWEAHTNILHCMRDC
FT                   RVWSALYDGDSPDPETFLQSLSEESRENSGHPEARLPQQSVRTSGQTKDKSQSELEWDD
FT                   SYDTGISSGADVGSPGPDDEVETPAPPAPIDPPKHIQEMKKNAILLFKGSYIEESDFQD
FT                   DVMVYRLCAEKDTEDTTEPQKDTSEPQGDTLEPLEDTSEQQEDTSEQLEDTSELQEDTA
FT                   EPQGDTADPTAEAQPKLQPEAQSLPTSNGPLSSPDPETESQPSRESSDLCQNTFSEAKP
FT                   ENEPGVALALDSELIATTFEAEPQSELAVVSTESEDFIAQYDQIIQELDSGTEGLTEQS
FT                   IPISEPSLLTQQEERREECKEEEDDDFDSLMAATPAVEAGSSPFGVGEDTAFSSRHPVR
FT                   TQSTPFTGPFISVVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQ
FT                   PSVRSLYQVLASVKNKIEQFASVERDFPGLLIQAQQYLLFRVDMSDMAPAALTKDPIQE
FT                   ISRPESDKTLLDGPPRVLQPFLGNRAKVTRAPPNLPLPVKNTMLAAALFPEFLKELAAL
FT                   AQEHSILCYKILGDFEDSCC"
FT   CDS             complement(join(20998356..20998609,21002744..21002882,
FT                   21003179..21003357,21009611..21010867,21013459..21013649,
FT                   21021001..21021080,21025851..21026018,21057818..21057904,
FT                   21060104..21060262,21067974..21068276))
FT                   /codon_start=1
FT                   /gene="9930021J17Rik"
FT                   /locus_tag="mCG_51579"
FT                   /product="RIKEN cDNA 9930021J17, isoform CRA_b"
FT                   /note="gene_id=mCG51579.2 transcript_id=mCT185450.0
FT                   protein_id=mCP106707.0 isoform=CRA_b"
FT                   /protein_id="EDL15390.1"
FT                   /translation="MMLLSSCSGTATPAVEGKLVVLLNQLCSILAKDPSILELFFHTSE
FT                   DQGAANFLIFSLLIPFIHREGTVGQQARDALLFIMSLSAENSMVANHIVENTYFCPVLA
FT                   TGLSGLYSSLPTKLEEKGEDWHCILKDDWLLLPALVQFMNSLEFCNAVIQVAHPLIRTQ
FT                   LVSYIYNGFLVPVLAPALHKVTVEEVMTTTAYLDLFLRSISEPALLEIFLRFILLHRHE
FT                   NVHILDTLTSRINTPFRLCVVSLALFRTLIGLHCEDVMLQLVLRYLVPCNHMMLSQRWA
FT                   VKERDCYSVSAAKLLALTPVCCASGITLTLGNQERDYILWSKCMHDGSGSEEQLLPETP
FT                   CSPSSPSPPPPPAPAACIVEYGKALDISYLQYLWEAHTNILHCMRDCRVWSALYDGDSP
FT                   DPETFLQSLSEESRENSGHPEARLPQQSVRTSGQTKDKSQSELEWDDSYDTGISSGADV
FT                   GSPGPDDEVETPAPPAPIDPPKHIQEMKKNAILLFKGSYIEESDFQDDVMVYRLCAEKD
FT                   TEDTTEPQKDTSEPQGDTLEPLEDTSEQQEDTSEQLEDTSELQEDTAEPQGDTADPTAE
FT                   AQPKLQPEAQSLPTSNGPLSSPDPETESQPSRESSDLCQNTFSEAKPENEPGVALALDS
FT                   ELIATTFEAEPQSELAVVSTESEDFIAQYDQIIQELDSGTEGLTEQSIPISEPSLLTQQ
FT                   EERREECKEEEDDDFDSLMAATPAVEAGSSPFGVGEDTAFSSRHPVRTQSTPFTGPFIS
FT                   VVLSKLENMLENSLHVNLLLIGIITQLASYPQPLLRSFLLNTNMVFQPSVRSLYQVLAS
FT                   VKNKIEQFASVERDFPGLLIQAQQYLLFRVDMSDMAPAALTKDPIQEISRPESDKTLLD
FT                   GPPRVLQPFLGNRAKVTRAPPNLPLPVKNTMLAAALFPEFLKELAALAQEHSILCYKIL
FT                   GDFEDSCC"
FT   gene            complement(21211663..21214003)
FT                   /locus_tag="mCG_145726"
FT                   /note="gene_id=mCG145726.0"
FT   mRNA            complement(21211663..21214003)
FT                   /locus_tag="mCG_145726"
FT                   /product="mCG145726"
FT                   /note="gene_id=mCG145726.0 transcript_id=mCT51762.2 created
FT                   on 23-JUN-2003"
FT   CDS             complement(21213480..21213977)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145726"
FT                   /product="mCG145726"
FT                   /note="gene_id=mCG145726.0 transcript_id=mCT51762.2
FT                   protein_id=mCP33353.2"
FT                   /db_xref="GOA:Q8BML3"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="MGI:MGI:2443773"
FT                   /db_xref="UniProtKB/TrEMBL:Q8BML3"
FT                   /protein_id="EDL15392.1"
FT                   /translation="MKRVFVTVGTTSFDDLIARVVAHDSVQILKNLGYNQLVLQIGRGT
FT                   VVPEPFSTESFTLDVYRYKDSLKEDLQQADLVISHAGAGSCLESLEKGKPLVVVVNEKL
FT                   MNNHQFELAKQLHKEGHLFYCTCSMLPELLQSMDLSTLKCYPPGQPEKFSAFLDKVVGL
FT                   QK"
FT   gene            21258094..21258517
FT                   /locus_tag="mCG_1125"
FT                   /note="gene_id=mCG1125.0"
FT   mRNA            21258094..21258517
FT                   /locus_tag="mCG_1125"
FT                   /product="mCG1125"
FT                   /note="gene_id=mCG1125.0 transcript_id=mCT8790.1 created on
FT                   07-NOV-2002"
FT   CDS             21258136..21258423
FT                   /codon_start=1
FT                   /locus_tag="mCG_1125"
FT                   /product="mCG1125"
FT                   /note="gene_id=mCG1125.0 transcript_id=mCT8790.1
FT                   protein_id=mCP22866.1"
FT                   /db_xref="GOA:J3QPX3"
FT                   /db_xref="InterPro:IPR007667"
FT                   /db_xref="MGI:MGI:3704221"
FT                   /db_xref="UniProtKB/TrEMBL:J3QPX3"
FT                   /protein_id="EDL15388.1"
FT                   /translation="MSTNTDLSLSSYDEGQGSKFIRKAKETLFVPIGMAGFAAIVAYGL
FT                   YKLKSRGNTKMSIHLIHMRVAAQGFVVGAMTLGMGYSMYQEFWANPKPKP"
FT   gene            complement(<21337041..>21343651)
FT                   /gene="Gm1019"
FT                   /locus_tag="mCG_1126"
FT                   /note="gene_id=mCG1126.2"
FT   mRNA            complement(join(<21337041..21337187,21340319..21340485,
FT                   21341161..21341420,21343489..>21343651))
FT                   /gene="Gm1019"
FT                   /locus_tag="mCG_1126"
FT                   /product="gene model 1019, (NCBI)"
FT                   /note="gene_id=mCG1126.2 transcript_id=mCT8791.2 created on
FT                   07-NOV-2002"
FT   CDS             complement(join(<21337041..21337187,21340319..21340485,
FT                   21341161..21341420,21343489..>21343649))
FT                   /codon_start=1
FT                   /gene="Gm1019"
FT                   /locus_tag="mCG_1126"
FT                   /product="gene model 1019, (NCBI)"
FT                   /note="gene_id=mCG1126.2 transcript_id=mCT8791.2
FT                   protein_id=mCP22871.2"
FT                   /protein_id="EDL15387.1"
FT                   /translation="CGRPVHTGRIVGGQDAALGRWPWQVSLRFDYTHSCGGSLISDHWV
FT                   LTAAHCIKKTWYSFLYSVWLGSIDREYSSTGKEYYVSRIAIPDKHRHTEADIALLKLSS
FT                   RVTFSSVILPICLPNISKQLTVPASCWVTGWGQNQEGHYPSTLQELEVPVISSEACEQL
FT                   YNPIGIFLPDLERVIKEDMFCAGERQSRKDSCKGDSGGPLSCHIDGVWRLMGVVSWGLE
FT                   CGKDLPGVYTNVTYYQKWISAII"
FT   gene            <21382959..21470210
FT                   /locus_tag="mCG_1127"
FT                   /note="gene_id=mCG1127.2"
FT   mRNA            join(<21382959..21383103,21417366..21417406,
FT                   21421175..21421214,21422625..21422667,21425479..21425617,
FT                   21425754..>21425823)
FT                   /locus_tag="mCG_1127"
FT                   /product="mCG1127, transcript variant mCT181716"
FT                   /note="gene_id=mCG1127.2 transcript_id=mCT181716.0 created
FT                   on 01-APR-2003"
FT   mRNA            join(21383083..21383103,21417366..21417406,
FT                   21422625..21422667,21425479..21425617,21425754..21425907,
FT                   21426620..21427609,21435714..21435821,21440168..21440280,
FT                   21444928..21444989,21446107..21446371,21448612..21448680,
FT                   21448855..21448995,21454758..21454830,21456439..21456569,
FT                   21458471..21458529,21462176..21462378,21462780..21462832,
FT                   21464846..21465032,21465386..21465483,21468301..21470210)
FT                   /locus_tag="mCG_1127"
FT                   /product="mCG1127, transcript variant mCT8795"
FT                   /note="gene_id=mCG1127.2 transcript_id=mCT8795.2 created on
FT                   01-APR-2003"
FT   CDS             join(<21421184..21421214,21422625..21422667,
FT                   21425479..21425617,21425754..>21425823)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1127"
FT                   /product="mCG1127, isoform CRA_b"
FT                   /note="gene_id=mCG1127.2 transcript_id=mCT181716.0
FT                   protein_id=mCP104638.0 isoform=CRA_b"
FT                   /protein_id="EDL15386.1"
FT                   /translation="LVYSTMPRGRASRTCIQSELHRDRRRPEITIVAAEPLRPASWFPG
FT                   APPPGLGFPSTPGAGPWRPNDLVPAELPPSYEQVIKEINQVQVNATNNN"
FT   CDS             join(21426916..21427609,21435714..21435821,
FT                   21440168..21440280,21444928..21444989,21446107..21446371,
FT                   21448612..21448680,21448855..21448995,21454758..21454830,
FT                   21456439..21456569,21458471..21458529,21462176..21462378,
FT                   21462780..21462832,21464846..21465032,21465386..21465483,
FT                   21468301..21468417)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1127"
FT                   /product="mCG1127, isoform CRA_a"
FT                   /note="gene_id=mCG1127.2 transcript_id=mCT8795.2
FT                   protein_id=mCP22867.2 isoform=CRA_a"
FT                   /protein_id="EDL15385.1"
FT                   /translation="MMNIMNTEQSQNTIVSRIKAFEGQTNTEIPGLPKKPEIIPRTIPP
FT                   KPAVSSGKPLVAPKPAANRASGEWDTWAENRLKVTSREGLTPYSSPQEAGITPVTKPEL
FT                   PKKPTPGLTRSVNHETSGGRPMAESPDTGKKIPTPAPRPLLPKKSASTDAPPYPSIPPK
FT                   LVSAPPRLSVASQAKAFRSLGEGLPSNPPVPAPQSKALGDIDLISFDDDVLPTSGSPAE
FT                   EPTGSETVLDPFQLPTKTEATKERAVQPAPTRKPTVIRIPAKPGKCLHEEPQSPPPLPA
FT                   EKPVGNTHSAVSGRPSHSDRTRNPELEQASESGGLVQGPPRLPPRPVHGKVIPVWRPPP
FT                   KGAPERPPPPKLPASKSSNKNLPFNRSSSDMDLQKKQSHFVSGLSKAKSQIFKNQDPVL
FT                   PPRPKPGHPLYRKYMLSVPHGIANEDIVSRNPTELSCKRGDVLVILKQAENNYLECQRG
FT                   EGTGRVHPSQMKIVTPLDERPRGRPNDSGHSQKPVDSGAPHAVALHDFPAEQADDLSLT
FT                   SGEIVYLLEKIDAEWYRGKCRNQTGVFPANYVKVIVDIPEGRSGKRESFSSHCAKGPRC
FT                   VARFEYIGDQKDELSFSEGEVIILTEYVNEEWGRGEIRDRSGIFPLNFVELVGDHPTSG
FT                   ANILSTKVPPKTKNEDPGSNSQDSSPPGEWCKALHSFTAETSEDLPFKRGDRILILERL
FT                   DSDWYRGRLHDREGIFPAVFVQPCPAEAKGVASAIPKGRKVKALYDFLGENEDELSFKA
FT                   GDVITELEPIDDAWMRGELMGRAGMFPKNYVQFLQVS"
FT   gene            complement(21480291..21484929)
FT                   /locus_tag="mCG_1128"
FT                   /note="gene_id=mCG1128.2"
FT   mRNA            complement(join(21480291..21480456,21480794..21480903,
FT                   21481349..21481557,21483500..21483687,21483959..21484062,
FT                   21484769..21484929))
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, transcript variant mCT8792"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT8792.2 created on
FT                   28-MAR-2003"
FT   mRNA            complement(join(21480293..21480456,21480794..21480903,
FT                   21481349..21481557,21483500..21483687,21483959..21484062,
FT                   21484771..21484847))
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, transcript variant mCT181563"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT181563.0 created
FT                   on 28-MAR-2003"
FT   CDS             complement(join(21480335..21480456,21480794..21480903,
FT                   21481349..21481557,21483500..21483687,21483959..21484062,
FT                   21484769..21484830))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, isoform CRA_c"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT8792.2
FT                   protein_id=mCP22810.1 isoform=CRA_c"
FT                   /db_xref="GOA:Q564F3"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="InterPro:IPR027500"
FT                   /db_xref="MGI:MGI:1202063"
FT                   /db_xref="UniProtKB/TrEMBL:Q564F3"
FT                   /protein_id="EDL15384.1"
FT                   /translation="MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIG
FT                   KTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMD
FT                   LTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQ
FT                   IRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKKPK
FT                   FELGKLMELHGEGGSSGKAAGDETGAKVERADGYEPPVQESV"
FT   CDS             complement(join(21480335..21480456,21480794..21480903,
FT                   21481349..21481557,21483500..21483687,21483959..21484013))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, isoform CRA_a"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT181563.0
FT                   protein_id=mCP104486.0 isoform=CRA_a"
FT                   /protein_id="EDL15382.1"
FT                   /translation="MFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFR
FT                   KFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVG
FT                   FTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKA
FT                   CQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGGSSGKAAGDETGAKVERADGYEPP
FT                   VQESV"
FT   mRNA            complement(join(<21480830..21480903,21481349..21481557,
FT                   21483500..21483687,21483959..21484021,21484797..21484842))
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, transcript variant mCT181564"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT181564.0 created
FT                   on 28-MAR-2003"
FT   CDS             complement(join(<21480830..21480903,21481349..21481557,
FT                   21483500..21483687,21483959..21484021,21484797..21484830))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1128"
FT                   /product="mCG1128, isoform CRA_b"
FT                   /note="gene_id=mCG1128.2 transcript_id=mCT181564.0
FT                   protein_id=mCP104485.0 isoform=CRA_b"
FT                   /protein_id="EDL15383.1"
FT                   /translation="MAVGKNKRLTKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFE
FT                   VSLADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTMIEAHVDV
FT                   KTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVN
FT                   KLIPDSIGKDIEKACQSIYPLHDVFV"
FT   gene            21485016..21487790
FT                   /locus_tag="mCG_147525"
FT                   /note="gene_id=mCG147525.0"
FT   mRNA            join(21485016..21485466,21487259..21487790)
FT                   /locus_tag="mCG_147525"
FT                   /product="mCG147525"
FT                   /note="gene_id=mCG147525.0 transcript_id=mCT187788.0
FT                   created on 13-JAN-2004"
FT   CDS             join(21485464..21485466,21487259..21487504)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147525"
FT                   /product="mCG147525"
FT                   /note="gene_id=mCG147525.0 transcript_id=mCT187788.0
FT                   protein_id=mCP109367.0"
FT                   /protein_id="EDL15381.1"
FT                   /translation="MVPFSAAHPPCPINGSLTPFLLLHRVTPLKGTKLRNGSCLTSQKT
FT                   LSEFDGTRSLTNHSISQDAHQLDFFSNKEAYDETFLC"
FT   gene            21498002..21515539
FT                   /locus_tag="mCG_114520"
FT                   /note="gene_id=mCG114520.0"
FT   mRNA            join(21498002..21498244,21515311..21515539)
FT                   /locus_tag="mCG_114520"
FT                   /product="mCG114520"
FT                   /note="gene_id=mCG114520.0 transcript_id=mCT115611.0
FT                   created on 07-NOV-2002"
FT   CDS             join(21498157..21498244,21515311..21515408)
FT                   /codon_start=1
FT                   /locus_tag="mCG_114520"
FT                   /product="mCG114520"
FT                   /note="gene_id=mCG114520.0 transcript_id=mCT115611.0
FT                   protein_id=mCP65541.1"
FT                   /protein_id="EDL15380.1"
FT                   /translation="MKEQQLERRCIQAAMTKRNSGNSPEPKLRGQGTEPGTEEPEDTEQ
FT                   DDFRSRSNQARPGDTG"
FT   gene            <21620026..22109992
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /note="gene_id=mCG1129.1"
FT   mRNA            join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073198,22078862..22079017,
FT                   22084717..22084884,22100435..22100536,22103306..22103502,
FT                   22107420..22107571,22108879..22109992)
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, transcript
FT                   variant mCT8793"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT8793.1 created on
FT                   16-AUG-2002"
FT   CDS             join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073198,22078862..22079017,
FT                   22084717..22084884,22100435..22100536,22103306..22103502,
FT                   22107420..22107571,22108879..22108969)
FT                   /codon_start=1
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, isoform CRA_c"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT8793.1
FT                   protein_id=mCP22811.1 isoform=CRA_c"
FT                   /protein_id="EDL15377.1"
FT                   /translation="KLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTA
FT                   ILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSK
FT                   LQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFH
FT                   TWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFD
FT                   FKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETAD
FT                   ANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDG
FT                   KLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSI
FT                   GGVQVLFPLFAQLDYKQYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIG
FT                   YSLEKSSKSHVSRAVLELCLAFSKYLSNLQNGMPLLKQLCDHILLNPAVWIHTPAKVQL
FT                   MLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPN
FT                   QKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAE
FT                   HPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLF
FT                   SLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIAT
FT                   LLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDE
FT                   QKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRK
FT                   GDEETGPCSSSLVPEGTGATRGVDVSVGSQHEDRKDSPISPHFTRNSDENSSIGRASSI
FT                   DSASNTELQTHDMSSDEKKVERENQELLDQATVEETATNGAKDDLETSSDAAEPVTINS
FT                   NSLEPGKDTVTISEVSASISSPSEEDAAEMPELLEKSGVEEEEDDDYVELKVEGSPTEE
FT                   AGLPTELQGEGLSVAASEGREEPDMCGHGCEVQVEAPITKIHNDPETTDSEDSRFPTVA
FT                   TAGSLATSSEVPVPQATVQSDSHEMLDGGMKATNLAGETESVSDCADNVSEAPATSEQK
FT                   ITKLDVSSVASDTERFELKASTSTEAPQPQRHGLEISRQQEQTAQGTAPDAVDQQRRDS
FT                   RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTI
FT                   HLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVL
FT                   IFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKARGDTAKSSKT
FT                   IHSLIPMGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLA
FT                   LAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGNASLPDAENTPAEFSSLTLSS
FT                   VEESLEGTSCTRRRDSGLGEETASGLGSGLSVASPAAPLGVSAGPDAISEVLCTLSLEV
FT                   NKSQETRIDGGNELDRKVTPSVPVSKNVNVKDILRSLVNMPADGVTVDPALLPPACLGA
FT                   LGDLSVDPPMQFRSFDRSVIIATKKSSVLPSALTTSAPSSAVSVVSSVDPTHASDTGGE
FT                   SPGSRSPNAKLPSVAAVGSVPQDPAAHMSITERLEHALEKAAPLLREIFVDFAPFLSRT
FT                   LLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLL
FT                   SQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAK
FT                   YRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGS
FT                   THPEATLKTAVEHAADEDILAKGKQSIKSQALGNQNSENEALLEGDDDTLSSVDEKDLE
FT                   NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHG
FT                   KWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFG
FT                   LPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWV
FT                   ITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTA
FT                   SFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYL
FT                   PEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDL
FT                   IFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEP
FT                   HPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRL
FT                   FAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIACGTGTHRRQVTDLLDQSIQVHSQCFVI
FT                   TSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSR
FT                   DATLLLWYWNGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAELGLVLSGSQEGPC
FT                   LIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVNGKLQATVETDD
FT                   HIRAIQLSRDGQYLLTGGDNGVVIVRQVSDLKQLFAYPGCDAGIRAMALSFDQRCIISG
FT                   MASGSIVLFYNDFNRWHHEYQTRY"
FT   mRNA            join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073198,22078862..22079017,
FT                   22084717..22084884,22100435..22100536,22103306..22104264)
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, transcript
FT                   variant mCT190944"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT190944.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073198,22078862..22079017,
FT                   22084717..22084884,22100435..22100536,22103306..22103553)
FT                   /codon_start=1
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, isoform CRA_a"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT190944.0
FT                   protein_id=mCP111872.0 isoform=CRA_a"
FT                   /protein_id="EDL15375.1"
FT                   /translation="KLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTA
FT                   ILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSK
FT                   LQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFH
FT                   TWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFD
FT                   FKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETAD
FT                   ANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDG
FT                   KLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSI
FT                   GGVQVLFPLFAQLDYKQYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIG
FT                   YSLEKSSKSHVSRAVLELCLAFSKYLSNLQNGMPLLKQLCDHILLNPAVWIHTPAKVQL
FT                   MLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPN
FT                   QKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAE
FT                   HPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLF
FT                   SLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIAT
FT                   LLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDE
FT                   QKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRK
FT                   GDEETGPCSSSLVPEGTGATRGVDVSVGSQHEDRKDSPISPHFTRNSDENSSIGRASSI
FT                   DSASNTELQTHDMSSDEKKVERENQELLDQATVEETATNGAKDDLETSSDAAEPVTINS
FT                   NSLEPGKDTVTISEVSASISSPSEEDAAEMPELLEKSGVEEEEDDDYVELKVEGSPTEE
FT                   AGLPTELQGEGLSVAASEGREEPDMCGHGCEVQVEAPITKIHNDPETTDSEDSRFPTVA
FT                   TAGSLATSSEVPVPQATVQSDSHEMLDGGMKATNLAGETESVSDCADNVSEAPATSEQK
FT                   ITKLDVSSVASDTERFELKASTSTEAPQPQRHGLEISRQQEQTAQGTAPDAVDQQRRDS
FT                   RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTI
FT                   HLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVL
FT                   IFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKARGDTAKSSKT
FT                   IHSLIPMGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLA
FT                   LAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGNASLPDAENTPAEFSSLTLSS
FT                   VEESLEGTSCTRRRDSGLGEETASGLGSGLSVASPAAPLGVSAGPDAISEVLCTLSLEV
FT                   NKSQETRIDGGNELDRKVTPSVPVSKNVNVKDILRSLVNMPADGVTVDPALLPPACLGA
FT                   LGDLSVDPPMQFRSFDRSVIIATKKSSVLPSALTTSAPSSAVSVVSSVDPTHASDTGGE
FT                   SPGSRSPNAKLPSVAAVGSVPQDPAAHMSITERLEHALEKAAPLLREIFVDFAPFLSRT
FT                   LLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLL
FT                   SQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAK
FT                   YRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGS
FT                   THPEATLKTAVEHAADEDILAKGKQSIKSQALGNQNSENEALLEGDDDTLSSVDEKDLE
FT                   NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHG
FT                   KWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFG
FT                   LPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWV
FT                   ITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTA
FT                   SFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYL
FT                   PEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDL
FT                   IFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEP
FT                   HPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRL
FT                   FAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIACGTGTHRRQVTDLLDQSIQVHSQCFVI
FT                   TSDNRYILVCGFWDKSFRVYSTDTGKLIQVVFGHWDVVTCLARSESYIGGNCYILSGSR
FT                   DATLLLWYWNGKSSGIGDNPGGETATPRAILTGHDYEITCAAVCAELGLVLSGSQEGPC
FT                   LIHSMNGDLLRTLEGPENCLKPKLIQASREGHCVIFYENGCFCTFSVNGKLQATVETDD
FT                   HIRVSAVGSTLFLLLGSSK"
FT   mRNA            join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22074043)
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, transcript
FT                   variant mCT190945"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT190945.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<21620026..21620260,21620666..21620766,
FT                   21627028..21627123,21630684..21630805,21630897..21631023,
FT                   21631833..21631952,21633452..21633598,21639752..21639949,
FT                   21640116..21640249,21645526..21645634,21645952..21646104,
FT                   21650897..21651065,21653669..21653748,21655126..21655188,
FT                   21656071..21656168,21659564..21659656,21664059..21664167,
FT                   21664754..21664835,21666650..21666773,21667215..21667407,
FT                   21680048..21681097,21682176..21682354,21683132..21683285,
FT                   21683759..21683939,21685599..21685726,21686129..21686236,
FT                   21688517..21688676,21691658..21692108,21700472..21700605,
FT                   21704050..21704128,21705408..21705541,21707877..21707938,
FT                   21727201..21727265,21749914..21750022,21777402..21777568,
FT                   21856120..21856244,21863939..21864085,21866611..21866747,
FT                   21930175..21930292,21932652..21932754,21941712..21941827,
FT                   21946250..21946362,21969107..21969247,21970269..21970388,
FT                   21991779..21991931,22042771..22042938,22064413..22064502,
FT                   22068740..22068917,22073136..22073233)
FT                   /codon_start=1
FT                   /gene="Lrba"
FT                   /locus_tag="mCG_1129"
FT                   /product="LPS-responsive beige-like anchor, isoform CRA_b"
FT                   /note="gene_id=mCG1129.1 transcript_id=mCT190945.0
FT                   protein_id=mCP111873.0 isoform=CRA_b"
FT                   /protein_id="EDL15376.1"
FT                   /translation="KLVGGQFDLEMNFIIQEGESIMCMVELLEKCDVTCQAEVWSMFTA
FT                   ILKKSIRNLQVCTEVGLVEKVLGKIEKVDSMIADLLVDMLGVLASYNLTVRELKLFFSK
FT                   LQGDKGQWPPHAGKLLSVLKHMPQKYGPDAFFNFPGKSAAAIALPPIARWPYQNGFTFH
FT                   TWLRMDPVNNINVDKDKPYLYCFRTSKGLGYSAHFVGGCLIITSIKSKGKGFQHCVKFD
FT                   FKPQKWYMVTIVHIYNRWKNSELRCYVNGELASYGEITWFVNTSDTFDKCFLGSSETAD
FT                   ANRVFCGQMTAVYLFSDALNAAQIFAIYQLGLGYKGTFKFKAESDLFLAEHHKLLLYDG
FT                   KLSSAIAFTYNPRATDAQLCLESSPKDNPSIFVHSPHALMLQDVKAVLTHSIQSAMHSI
FT                   GGVQVLFPLFAQLDYKQYLSDEVDLTICTTLLAFIMELLKNSIAMQEQMLACKGFLVIG
FT                   YSLEKSSKSHVSRAVLELCLAFSKYLSNLQNGMPLLKQLCDHILLNPAVWIHTPAKVQL
FT                   MLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYYWAVNPQDRSGITPKGLDGPRPN
FT                   QKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLLTMHEDDNLMDVLQLLVALMAE
FT                   HPNSMIPAFDQRNGLRVIYKLLASKSEGIRVQALKALGYFLKHLAPKRKAEVMLGHGLF
FT                   SLLAERLMLQTNLITMTMYNVLFEILIEQICTQVIHKQHPDPDSTVKIQNPQILKVIAT
FT                   LLRNSPQCPESMEVRRAFLSDMIKLFNNSRENRRSLLQCSVWQEWMLSLCYFNPKNSDE
FT                   QKITEMVYAIFRILLYHAVKYEWGGWRVWVDTLSITHSKVTFEIHKENLANIFREEQRK
FT                   GDEETGPCSSSLVPEGTGATRGVDVSVGSQHEDRKDSPISPHFTRNSDENSSIGRASSI
FT                   DSASNTELQTHDMSSDEKKVERENQELLDQATVEETATNGAKDDLETSSDAAEPVTINS
FT                   NSLEPGKDTVTISEVSASISSPSEEDAAEMPELLEKSGVEEEEDDDYVELKVEGSPTEE
FT                   AGLPTELQGEGLSVAASEGREEPDMCGHGCEVQVEAPITKIHNDPETTDSEDSRFPTVA
FT                   TAGSLATSSEVPVPQATVQSDSHEMLDGGMKATNLAGETESVSDCADNVSEAPATSEQK
FT                   ITKLDVSSVASDTERFELKASTSTEAPQPQRHGLEISRQQEQTAQGTAPDAVDQQRRDS
FT                   RSTMFRIPEFKWSQMHQRLLTDLLFSIETDIQMWRSHSTKTVMDFVNSSDNVIFVHNTI
FT                   HLISQVMDNMVMACGGILPLLSAATSATHELENIEPTQGLSIEASVTFLQRLISLVDVL
FT                   IFASSLGFTEIEAEKNMSSGGILRQCLRLVCAVAVRNCLECQQHSQLKARGDTAKSSKT
FT                   IHSLIPMGKSAAKSPVDIVTGGISPVRDLDRLLQDMDINRLRAVVFRDIEDSKQAQFLA
FT                   LAVVYFISVLMVSKYRDILEPQDERHSQSLKETSSDNGNASLPDAENTPAEFSSLTLSS
FT                   VEESLEGTSCTRRRDSGLGEETASGLGSGLSVASPAAPLGVSAGPDAISEVLCTLSLEV
FT                   NKSQETRIDGGNELDRKVTPSVPVSKNVNVKDILRSLVNMPADGVTVDPALLPPACLGA
FT                   LGDLSVDPPMQFRSFDRSVIIATKKSSVLPSALTTSAPSSAVSVVSSVDPTHASDTGGE
FT                   SPGSRSPNAKLPSVAAVGSVPQDPAAHMSITERLEHALEKAAPLLREIFVDFAPFLSRT
FT                   LLGSHGQELLIEGTSLVCMKSSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLL
FT                   SQTMKDHLVRVANEAEFILSRQRAEDIHRHAEFESLCAQYSADKREEEKMCDHLIRAAK
FT                   YRDHVTATQLIQKIINLLTDKHGAWGSSAVSRPREFWRLDYWEDDLRRRRRFVRNPLGS
FT                   THPEATLKTAVEHAADEDILAKGKQSIKSQALGNQNSENEALLEGDDDTLSSVDEKDLE
FT                   NLAGPVSLSTPAQLVAPSVVVKGTLSVTSSELYFEVDEEDPNFKKIDPKILAYTEGLHG
FT                   KWLFTEIRSIFSRRYLLQNTALEIFMANRVAVMFNFPDPATVKKVVNYLPRVGVGTSFG
FT                   LPQTRRISLATPRQLFKASNMTQRWQHREISNFEYLMFLNTIAGRSYNDLNQYPVFPWV
FT                   ITNYESEELDLTLPSNFRDLSKPIGALNPKRAAFFAERFESWEDDQVPKFHYGTHYSTA
FT                   SFVLAWLLRIEPFTTYFLNLQGGKFDHADRTFSSVSRAWRNSQRDTSDIKELIPEFYYL
FT                   PEMFVNFNNYNLGVMDDGTVVSDVELPPWAKTSEEFVRINRLALESEFVSCQLHQWIDL
FT                   IFGYKQQGPEAVRALNVFYYLTYEGAVNLNSITDPVLREAVEAQIRSFGQTPSQLLIEP
FT                   HPPRGSAMQASPLMFTDQAQQDVIMVLKFPSNSPVTHVAANTQPGLAMPAVITVTANRL
FT                   FAVNKWHNLPAHQGAVQDQPYQLPVEIDPLIGLSLLSLFAIH"
FT   gene            complement(21870088..21872665)
FT                   /gene="Mab21l2"
FT                   /locus_tag="mCG_1122"
FT                   /note="gene_id=mCG1122.2"
FT   mRNA            complement(21870088..21872665)
FT                   /gene="Mab21l2"
FT                   /locus_tag="mCG_1122"
FT                   /product="mab-21-like 2 (C. elegans)"
FT                   /note="gene_id=mCG1122.2 transcript_id=mCT8788.2 created on
FT                   19-AUG-2002"
FT   CDS             complement(21870648..21871727)
FT                   /codon_start=1
FT                   /gene="Mab21l2"
FT                   /locus_tag="mCG_1122"
FT                   /product="mab-21-like 2 (C. elegans)"
FT                   /note="gene_id=mCG1122.2 transcript_id=mCT8788.2
FT                   protein_id=mCP22840.1"
FT                   /protein_id="EDL15379.1"
FT                   /translation="MIAAQAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEV
FT                   EVQEPRFISSLSEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSD
FT                   GRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIR
FT                   ERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGKQ
FT                   SSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPGQPLNNYHMKTLLLYE
FT                   CEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAK
FT                   QTWRLAREILTNPKSLDKL"
FT   gene            complement(22095406..22105963)
FT                   /locus_tag="mCG_147518"
FT                   /note="gene_id=mCG147518.0"
FT   mRNA            complement(join(22095406..22096857,22105823..22105963))
FT                   /locus_tag="mCG_147518"
FT                   /product="mCG147518"
FT                   /note="gene_id=mCG147518.0 transcript_id=mCT187781.0
FT                   created on 13-JAN-2004"
FT   CDS             complement(22096561..22096785)
FT                   /codon_start=1
FT                   /locus_tag="mCG_147518"
FT                   /product="mCG147518"
FT                   /note="gene_id=mCG147518.0 transcript_id=mCT187781.0
FT                   protein_id=mCP109362.0"
FT                   /protein_id="EDL15378.1"
FT                   /translation="MAVAKAPVSSRAAPPAHLSAHTRMTWGWGRISTNKMILHVHSLQI
FT                   LQAPPASLKEQGKSSGKYHVILWMKTSDC"
FT   gene            complement(22113464..22262382)
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /note="gene_id=mCG1124.3"
FT   mRNA            complement(join(22113464..22114719,22119376..22121220,
FT                   22126319..22126396,22126769..22126902,22132748..22132894,
FT                   22133286..22133405,22140825..22140882,22142236..22142344,
FT                   22143508..22143580,22151813..22151907,22163450..22163551,
FT                   22173397..22173499,22241994..22242325,22261509..>22261947))
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, transcript
FT                   variant mCT190941"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190941.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(22113465..22114719,22119302..22119418,
FT                   22120526..22120606,22121124..22121220,22126319..22126396,
FT                   22126769..22126902,22132748..22132894,22133286..22133405,
FT                   22140825..22140882,22142236..22142344,22143508..22143580,
FT                   22151813..22151907,22163450..22163551,22173397..22173499,
FT                   22241994..22242325,22261509..22262382))
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, transcript
FT                   variant mCT8787"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT8787.2 created on
FT                   26-MAR-2003"
FT   CDS             complement(join(22114519..22114719,22119302..22119418,
FT                   22120526..22120606,22121124..22121220,22126319..22126396,
FT                   22126769..22126902,22132748..22132894,22133286..22133405,
FT                   22140825..22140882,22142236..22142344,22143508..22143580,
FT                   22151813..22151907,22163450..22163551,22173397..22173499,
FT                   22241994..22242325,22261509..22261929))
FT                   /codon_start=1
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT8787.2
FT                   protein_id=mCP22868.2 isoform=CRA_d"
FT                   /protein_id="EDL15374.1"
FT                   /translation="MASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSISGPKGNGLI
FT                   PSPAHSAHCSFYRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRSFDALLI
FT                   ELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDYTKNVNP
FT                   NWSVNIKGGTTRTLAVASSKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLNKKTAHS
FT                   FEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRYAQDDFV
FT                   LDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVNGTPSSQLSTPKSTKSSSSS
FT                   PTSPGSFRGLKISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFPLLEKYRIGKVIG
FT                   DGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIMLVEEME
FT                   TATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVHRDIKPE
FT                   NLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKVDVWAAG
FT                   VITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKELISQMLQVNVE
FT                   ARCTAGEILSHPWVSDDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMNTALD
FT                   KEGQIFCSKLCQDSSRPSREQTSPVPPSAQEAPPPLESPRPPGPPATSGCDLAGTWRRH
FT                   RD"
FT   mRNA            complement(join(22118748..22119418,22121124..22121220,
FT                   22126319..22126396,22126769..22126902,22132748..22132894,
FT                   22133286..22133405,22140825..22140882,22142236..22142344,
FT                   22143508..22143583,22151813..22151907,22163450..22163551,
FT                   22173397..22173499,22241994..22242325,22261509..>22262140))
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, transcript
FT                   variant mCT190939"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190939.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(22119164..22119418,22121124..22121220,
FT                   22126319..22126396,22126769..22126902,22132748..22132894,
FT                   22133286..22133405,22140825..22140882,22142236..22142344,
FT                   22143508..22143583,22151813..22151907,22163450..22163551,
FT                   22173397..22173499,22241994..22242325,22261509..>22261962))
FT                   /codon_start=1
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190939.0
FT                   protein_id=mCP111869.0 isoform=CRA_a"
FT                   /protein_id="EDL15371.1"
FT                   /translation="LICGELSRAAAMASTRSIELEHFEERDKRPRPGSRRGAPSSSGGS
FT                   SISGPKGNGLIPSPAHSAHCSFYRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISN
FT                   DRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPF
FT                   RKVDYTKNVNPNWSVNIKGGTTRTLAVASSKSEVKESKDFIKPKLVTVIRSGVKPRKAV
FT                   RILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGP
FT                   EKYRYAQDDFVLDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVNGTPSSQLS
FT                   TPKSTKSSSSSPTSPGSFRGLKQISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFP
FT                   LLEKYRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVK
FT                   HPNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLH
FT                   SLSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAET
FT                   GYGLKVDVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAK
FT                   DDASQENNMQAEVTGKLKQHFNNALPKQNSTTTGVSVIMVSGTQSSASESRGWPSWSCC
FT                   LDSQGSAHGSWCLPCSCLHGGLPGM"
FT   CDS             complement(join(22121067..22121220,22126319..22126396,
FT                   22126769..22126902,22132748..22132894,22133286..22133405,
FT                   22140825..22140882,22142236..22142344,22143508..22143580,
FT                   22151813..22151907,22163450..22163551,22173397..22173499,
FT                   22241994..22242325,22261509..>22261947))
FT                   /codon_start=1
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190941.0
FT                   protein_id=mCP111871.0 isoform=CRA_c"
FT                   /protein_id="EDL15373.1"
FT                   /translation="LSRAAAMASTRSIELEHFEERDKRPRPGSRRGAPSSSGGSSISGP
FT                   KGNGLIPSPAHSAHCSFYRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISNDRFRS
FT                   FDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPFRKVDY
FT                   TKNVNPNWSVNIKGGTTRTLAVASSKSEVKESKDFIKPKLVTVIRSGVKPRKAVRILLN
FT                   KKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGPEKYRY
FT                   AQDDFVLDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVNGTPSSQLSTPKST
FT                   KSSSSSPTSPGSFRGLKISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFPLLEKYR
FT                   IGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKHPNIIM
FT                   LVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHSLSIVH
FT                   RDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETGYGLKV
FT                   DVWAAGVITYILLCGFPPFRSENNLQEDLFDQILAGKLEFPAPYWDNITDSAKVLCRAL
FT                   PVYTVGSLHVGL"
FT   mRNA            complement(join(22126231..22126396,22126769..22126902,
FT                   22132748..22132894,22133286..22133405,22140825..22140882,
FT                   22142236..22142344,22143508..22143580,22151813..22151907,
FT                   22163450..22163551,22173397..22173499,22241994..22242325,
FT                   22261509..>22262134))
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, transcript
FT                   variant mCT190940"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190940.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(22126315..22126396,22126769..22126902,
FT                   22132748..22132894,22133286..22133405,22140825..22140882,
FT                   22142236..22142344,22143508..22143580,22151813..22151907,
FT                   22163450..22163551,22173397..22173499,22241994..22242325,
FT                   22261509..>22261962))
FT                   /codon_start=1
FT                   /gene="Dcamkl2"
FT                   /locus_tag="mCG_1124"
FT                   /product="doublecortin and CaM kinase-like 2, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG1124.3 transcript_id=mCT190940.0
FT                   protein_id=mCP111870.0 isoform=CRA_b"
FT                   /protein_id="EDL15372.1"
FT                   /translation="LICGELSRAAAMASTRSIELEHFEERDKRPRPGSRRGAPSSSGGS
FT                   SISGPKGNGLIPSPAHSAHCSFYRTRTLQALSSEKKAKKARFYRNGDRYFKGLVFAISN
FT                   DRFRSFDALLIELTRSLSDNVNLPQGVRTIYTIDGSRKVTSLDELLEGESYVCASNEPF
FT                   RKVDYTKNVNPNWSVNIKGGTTRTLAVASSKSEVKESKDFIKPKLVTVIRSGVKPRKAV
FT                   RILLNKKTAHSFEQVLTDITEAIKLDSGVVKRLCTLDGKQVTCLQDFFGDDDVFIACGP
FT                   EKYRYAQDDFVLDHSECRVLKSSYSRASAAKYSGSRSPGFSRRSKSPASVNGTPSSQLS
FT                   TPKSTKSSSSSPTSPGSFRGLKISAQGRSSSNVNGGPELDRCLSPEGVNGNRCSESFPL
FT                   LEKYRIGKVIGDGNFAVVKECVDRYTGKEFALKIIDKAKCCGKEHLIENEVSILRRVKH
FT                   PNIIMLVEEMETATDLFLVMELVKGGDLFDAITSSTKYTERDGSAMVYNLANALRYLHS
FT                   LSIVHRDIKPENLLVCEYPDGTKSLKLGDFGLATVVEGPLYTVCGTPTYVAPEIIAETG
FT                   YGLKVDVWAAGVITYILLCGFPPFRR"
FT   gene            22200420..22201339
FT                   /pseudo
FT                   /locus_tag="mCG_50654"
FT                   /note="gene_id=mCG50654.2"
FT   mRNA            22200420..22201339
FT                   /pseudo
FT                   /locus_tag="mCG_50654"
FT                   /note="gene_id=mCG50654.2 transcript_id=mCT50837.2 created
FT                   on 28-MAR-2003"
FT   gene            22328347..22331578
FT                   /locus_tag="mCG_3098"
FT                   /note="gene_id=mCG3098.1"
FT   mRNA            join(22328347..22328501,22328784..22329057,
FT                   22329340..22329618,22330075..22330353,22330949..22331045,
FT                   22331134..22331578)
FT                   /locus_tag="mCG_3098"
FT                   /product="mCG3098, transcript variant mCT1889"
FT                   /note="gene_id=mCG3098.1 transcript_id=mCT1889.2 created on
FT                   23-NOV-2004"
FT   mRNA            join(22328347..22328501,22328784..22328942,
FT                   22329340..22329618,22330075..22330353,22330949..22331045,
FT                   22331134..22331578)
FT                   /locus_tag="mCG_3098"
FT                   /product="mCG3098, transcript variant mCT190965"
FT                   /note="gene_id=mCG3098.1 transcript_id=mCT190965.1 created
FT                   on 23-NOV-2004"
FT   CDS             join(22328441..22328501,22328784..22328942,
FT                   22329340..22329618,22330075..22330353,22330949..22331045,
FT                   22331134..22331155)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3098"
FT                   /product="mCG3098, isoform CRA_b"
FT                   /note="gene_id=mCG3098.1 transcript_id=mCT190965.1
FT                   protein_id=mCP111919.1 isoform=CRA_b"
FT                   /protein_id="EDL15370.1"
FT                   /translation="MRYLPCLLLWAFLQVWGQSEVQQKNYTFRCLQTSSFANISWSRTD
FT                   SLILLGDLQTHRWSNDSATISFTKPWSQDPIEIQLSTGCEMYPGNASESFFHVAFQGKY
FT                   AVRFRGTSWQRVLGAPSWLDLPIKVLNADQGTSATVQTLLNDTWPQFARGLLEAGKSDL
FT                   EKQEKPVAWLSSVPSSAHGHLQLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNAD
FT                   ETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVG
FT                   AVVYYIWRRRSAYQDIR"
FT   CDS             join(22328441..22328501,22328784..22329049)
FT                   /codon_start=1
FT                   /locus_tag="mCG_3098"
FT                   /product="mCG3098, isoform CRA_a"
FT                   /note="gene_id=mCG3098.1 transcript_id=mCT1889.2
FT                   protein_id=mCP22834.3 isoform=CRA_a"
FT                   /protein_id="EDL15369.1"
FT                   /translation="MRYLPCLLLWAFLQVWGQSEVQQKNYTFRCLQTSSFANISWSRTD
FT                   SLILLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRAHTGISQ
FT                   NDVT"
FT   gene            complement(22337628..22341132)
FT                   /locus_tag="mCG_3074"
FT                   /note="gene_id=mCG3074.1"
FT   mRNA            complement(join(22337628..22338391,22338480..22338576,
FT                   22339128..22339406,22339862..22340140,22340423..22340695,
FT                   22340982..22341132))
FT                   /locus_tag="mCG_3074"
FT                   /product="mCG3074, transcript variant mCT1902"
FT                   /note="gene_id=mCG3074.1 transcript_id=mCT1902.1 created on
FT                   16-AUG-2002"
FT   mRNA            complement(join(22337634..22338391,22338480..22338576,
FT                   22339128..22339404,22340533..22340695,22340982..>22341104))
FT                   /locus_tag="mCG_3074"
FT                   /product="mCG3074, transcript variant mCT190951"
FT                   /note="gene_id=mCG3074.1 transcript_id=mCT190951.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(22338370..22338391,22338480..22338576,
FT                   22339128..22339406,22339862..22340140,22340423..22340695,
FT                   22340982..22341042))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3074"
FT                   /product="mCG3074, isoform CRA_a"
FT                   /note="gene_id=mCG3074.1 transcript_id=mCT1902.1
FT                   protein_id=mCP22865.2 isoform=CRA_a"
FT                   /protein_id="EDL15367.1"
FT                   /translation="MRYLPWLLLWAFLQVWGQSEAQQKNYTFRCLQMSSFANRSWSRTD
FT                   SVVWLGDLQTHRWSNDSATISFTKPWSQGKLSNQQWEKLQHMFQVYRVSFTRDIQELVK
FT                   MMSPKEDYPIEIQLSAGCEMYPGNASESFLHVAFQGKYVVRFWGTSWQTVPGAPSWLDL
FT                   PIKVLNADQGTSATVQMLLNDTCPLFVRGLLEAGKSDLEKQEKPVAWLSSVPSSAHGHR
FT                   QLVCHVSGFYPKPVWVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLAC
FT                   RVKHSSLGGQDIILYWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR"
FT   CDS             complement(join(22338370..22338391,22338480..22338576,
FT                   22339128..22339404,22340533..>22340574))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3074"
FT                   /product="mCG3074, isoform CRA_b"
FT                   /note="gene_id=mCG3074.1 transcript_id=mCT190951.0
FT                   protein_id=mCP111917.0 isoform=CRA_b"
FT                   /protein_id="EDL15368.1"
FT                   /translation="LSHHQLHEAMVPGQKPVAWLSSVPSSAHGHRQLVCHVSGFYPKPV
FT                   WVMWMRGDQEQQGTHRGDFLPNADETWYLQATLDVEAGEEAGLACRVKHSSLGGQDIIL
FT                   YWDARQAPVGLIVFIVLIMLVVVGAVVYYIWRRRSAYQDIR"
FT   gene            complement(22341662..>22354002)
FT                   /locus_tag="mCG_1032356"
FT                   /note="gene_id=mCG1032356.0"
FT   mRNA            complement(join(22341662..22341864,22343193..22343263,
FT                   22347289..22347367,22353833..>22354002))
FT                   /locus_tag="mCG_1032356"
FT                   /product="mCG1032356"
FT                   /note="gene_id=mCG1032356.0 transcript_id=mCT150060.0
FT                   created on 27-MAR-2003"
FT   CDS             complement(join(22341720..22341864,22343193..>22343209))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032356"
FT                   /product="mCG1032356"
FT                   /note="gene_id=mCG1032356.0 transcript_id=mCT150060.0
FT                   protein_id=mCP65812.0"
FT                   /protein_id="EDL15366.1"
FT                   /translation="NHEVLRCMARVFAVLKRFEGAHLVTFGFSSHQTDTSLRFSQIMTV
FT                   QYTEQNKN"
FT   gene            complement(22364711..22365682)
FT                   /pseudo
FT                   /locus_tag="mCG_115367"
FT                   /note="gene_id=mCG115367.1"
FT   mRNA            complement(22364711..22365682)
FT                   /pseudo
FT                   /locus_tag="mCG_115367"
FT                   /note="gene_id=mCG115367.1 transcript_id=mCT116470.1
FT                   created on 28-MAR-2003"
FT   gene            complement(22367320..22367728)
FT                   /pseudo
FT                   /locus_tag="mCG_1032219"
FT                   /note="gene_id=mCG1032219.1"
FT   mRNA            complement(22367320..22367728)
FT                   /pseudo
FT                   /locus_tag="mCG_1032219"
FT                   /note="gene_id=mCG1032219.1 transcript_id=mCT149923.1
FT                   created on 28-MAR-2003"
FT   gene            complement(22426023..>22519264)
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /note="gene_id=mCG115365.0"
FT   mRNA            complement(join(22426023..22427031,22427278..22427355,
FT                   22428216..22428355,22428493..22428600,22429793..22429991,
FT                   22431561..22431661,22431754..22431880,22432546..22432673,
FT                   22432877..22433025,22433191..22433296,22433853..22434003,
FT                   22435500..22435657,22439046..22439195,22441157..22441321,
FT                   22485776..22485921,22519110..22519264))
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /product="kin of IRRE like 1 (Drosophila), transcript
FT                   variant mCT116468"
FT                   /note="gene_id=mCG115365.0 transcript_id=mCT116468.1
FT                   created on 20-AUG-2002"
FT   CDS             complement(join(22426555..22427031,22427278..22427355,
FT                   22428216..22428355,22428493..22428600,22429793..22429991,
FT                   22431561..22431661,22431754..22431880,22432546..22432673,
FT                   22432877..22433025,22433191..22433296,22433853..22434003,
FT                   22435500..22435657,22439046..22439195,22441157..22441321,
FT                   22485776..22485824))
FT                   /codon_start=1
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /product="kin of IRRE like 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG115365.0 transcript_id=mCT116468.1
FT                   protein_id=mCP65551.1 isoform=CRA_a"
FT                   /protein_id="EDL15364.1"
FT                   /translation="MWAPHLVVAYLIFVTLALALPGTQTRFSQEPADQTVVAGQRAVLP
FT                   CVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVVGSADAGQYNLEITDAELSDDASYEC
FT                   QATEAALRSRRAKLTVLIPPEETRIDGGPVILLQAGTPYNLTCRAFNAKPAATIIWFRD
FT                   GTQQEGAVTSTELLKDGKRETTISQLLIEPTDLDIGRVFTCRSMNEAIPNGKETSIELD
FT                   VHHPPTVTLSIEPQTVLEGERVIFTCQATANPEILGYRWAKGGFLIEDAHESRYETNVD
FT                   YSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIVVYPKPTTTDIGSDVTLTCVWVGNPP
FT                   LTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYTCRAIVPRIGVAEREVPLYVNGPPII
FT                   SSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWKENFLEVGTLERYTVERTNSGSGVLS
FT                   TLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLEEREVLPVGIIAGATIGAGILVVFSF
FT                   AALVFFLYRRRKGSRKDVTLRKLDIKVETVNREPLTMHSDREDDTASISTATRVMKAIY
FT                   SSFKDDVDLKQDLRCDTIDTREEYEMKDPTNGYYNVRAHEDRPSSRAVLYADYRAPGPT
FT                   RFDGRPSSRLSHSSGYAQLNTYSRAPASDYGTEPTPSGPSAPGGTDTTSQLSYENYEKF
FT                   NSHPFPGAAGYPTYRLGYPQAPPSGLERTPYEAYDPIGKYATATRFSYTSQHSDYGQRF
FT                   QQRMQTHV"
FT   mRNA            complement(join(22428040..22428355,22428493..22428600,
FT                   22429793..22429991,22431561..22431661,22431754..22431880,
FT                   22432546..22432673,22432877..22433025,22433191..22433296,
FT                   22433853..22434003,22435500..22435657,22439046..22439195,
FT                   22441157..22441321,22485776..22485921,22519110..>22519264))
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /product="kin of IRRE like 1 (Drosophila), transcript
FT                   variant mCT190989"
FT                   /note="gene_id=mCG115365.0 transcript_id=mCT190989.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(22428126..22428355,22428493..22428600,
FT                   22429793..22429991,22431561..22431661,22431754..22431880,
FT                   22432546..22432673,22432877..22433025,22433191..22433296,
FT                   22433853..22434003,22435500..22435657,22439046..22439195,
FT                   22441157..22441321,22485776..22485921,22519110..>22519264))
FT                   /codon_start=1
FT                   /gene="Kirrel1"
FT                   /locus_tag="mCG_115365"
FT                   /product="kin of IRRE like 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG115365.0 transcript_id=mCT190989.0
FT                   protein_id=mCP111935.0 isoform=CRA_b"
FT                   /protein_id="EDL15365.1"
FT                   /translation="EASECAPCVQGREGGERASGGPARADWGPAAGGQHAEPPHLDPHS
FT                   LQHFLTSRALGMTLESPSTRLMTCQSSLLPEKPRFLSQKMWAPHLVVAYLIFVTLALAL
FT                   PGTQTRFSQEPADQTVVAGQRAVLPCVLLNYSGIVQWTKDGLALGMGQGLKAWPRYRVV
FT                   GSADAGQYNLEITDAELSDDASYECQATEAALRSRRAKLTVLIPPEETRIDGGPVILLQ
FT                   AGTPYNLTCRAFNAKPAATIIWFRDGTQQEGAVTSTELLKDGKRETTISQLLIEPTDLD
FT                   IGRVFTCRSMNEAIPNGKETSIELDVHHPPTVTLSIEPQTVLEGERVIFTCQATANPEI
FT                   LGYRWAKGGFLIEDAHESRYETNVDYSFFTEPVSCEVYNKVGSTNVSTLVNVHFAPRIV
FT                   VYPKPTTTDIGSDVTLTCVWVGNPPLTLTWTKKDSNMVLSNSNQLLLKSVTQADAGTYT
FT                   CRAIVPRIGVAEREVPLYVNGPPIISSEAVQFAVRGDGGKVECFIGSTPPPDRIAWAWK
FT                   ENFLEVGTLERYTVERTNSGSGVLSTLTINNVMEADFQTHYNCTAWNSFGPGTAIIQLE
FT                   EREVLPVGIIAGATIGAGILVVFSFAALVFFLYRRRKGSRKDVTLRKLDIKVETVNREP
FT                   LTMHSDREDDTASISTATRVMKAIYSVRIMLLSTWPRLFIVLRPAPPAFNDFRYL"
FT   gene            complement(22551068..22551829)
FT                   /locus_tag="mCG_1032217"
FT                   /note="gene_id=mCG1032217.1"
FT   mRNA            complement(22551068..22551829)
FT                   /locus_tag="mCG_1032217"
FT                   /product="mCG1032217"
FT                   /note="gene_id=mCG1032217.1 transcript_id=mCT149921.1
FT                   created on 28-MAR-2003"
FT   CDS             complement(22551244..22551708)
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032217"
FT                   /product="mCG1032217"
FT                   /note="gene_id=mCG1032217.1 transcript_id=mCT149921.1
FT                   protein_id=mCP65744.0"
FT                   /db_xref="GOA:Q561N4"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:Q561N4"
FT                   /protein_id="EDL15363.1"
FT                   /translation="MAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPP
FT                   YDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQV
FT                   IQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD"
FT   gene            complement(22554725..22555361)
FT                   /pseudo
FT                   /locus_tag="mCG_1032216"
FT                   /note="gene_id=mCG1032216.1"
FT   mRNA            complement(22554725..22555361)
FT                   /pseudo
FT                   /locus_tag="mCG_1032216"
FT                   /note="gene_id=mCG1032216.1 transcript_id=mCT149920.1
FT                   created on 28-MAR-2003"
FT   gene            complement(22601886..22614726)
FT                   /gene="Msr2"
FT                   /locus_tag="mCG_3078"
FT                   /note="gene_id=mCG3078.1"
FT   mRNA            complement(join(22601886..22602517,22603557..22603877,
FT                   22607758..22608036,22608434..22608742,22609992..22610273,
FT                   22610492..22610758,22613309..22613329,22614578..22614726))
FT                   /gene="Msr2"
FT                   /locus_tag="mCG_3078"
FT                   /product="macrophage scavenger receptor 2"
FT                   /note="gene_id=mCG3078.1 transcript_id=mCT1901.1 created on
FT                   16-AUG-2002"
FT   CDS             complement(join(22602498..22602517,22603557..22603877,
FT                   22607758..22608036,22608434..22608742,22609992..22610273,
FT                   22610492..22610758,22613309..22613329,22614578..22614608))
FT                   /codon_start=1
FT                   /gene="Msr2"
FT                   /locus_tag="mCG_3078"
FT                   /product="macrophage scavenger receptor 2"
FT                   /note="gene_id=mCG3078.1 transcript_id=mCT1901.1
FT                   protein_id=mCP22847.2"
FT                   /db_xref="GOA:Q9EQY5"
FT                   /db_xref="InterPro:IPR001190"
FT                   /db_xref="InterPro:IPR003598"
FT                   /db_xref="InterPro:IPR003599"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017448"
FT                   /db_xref="MGI:MGI:1933397"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQY5"
FT                   /protein_id="EDL15362.1"
FT                   /translation="MPLCLLLLVFAPVGVQSDWLSISLPHRSYEGDQVVISCTGKNNGD
FT                   IKRLKYFKDGYHIETYSSASSYTIRNARRGDSGSYSCKADRKFFLFIDTTEETGSKWLN
FT                   VQELFPAPGLTASPLQPVEGSSVTLSCNTWLPSDRATTQLRYSFFKDGHTLQSGWTSSK
FT                   FTISAISKEDSGNYWCEAMTASRSVSKQSHRSYIDVERIPVSQVTMEIQPSRGWGVEGE
FT                   PLVVEGEPLVLACSVAKGTGLITFSWHRQDTKESVGKKSQRSQRVELEIPTIRESHAGG
FT                   YYCTADNNYGLIQSAIVNITVKIPVLNPLLSISVPGVLPFIGDVAELHCEDKRASPPVL
FT                   YWFYHENITLANTSAPFGGKASFKLSLTAGHSGNYSCEAENAWGTKRSEVVTLNVTEPP
FT                   PKVRLVNGPHHCEGRVEVEQEGRWGTVCDDGWDMRDVAVVCRELGCGAAQHTPIAMLYP
FT                   PAVDEALPVLIQVALCNGTEKTLAECDQVEAFDCGHDEDAGAVCEVLPSTF"
FT   gene            22709859..22722769
FT                   /gene="Cd5l"
FT                   /locus_tag="mCG_3081"
FT                   /note="gene_id=mCG3081.1"
FT   mRNA            join(22709859..22709913,22712566..22712601,
FT                   22717474..22717794,22719236..22719574,22720144..22720464,
FT                   22721900..22722769)
FT                   /gene="Cd5l"
FT                   /locus_tag="mCG_3081"
FT                   /product="CD5 antigen-like"
FT                   /note="gene_id=mCG3081.1 transcript_id=mCT1899.1 created on
FT                   15-AUG-2002"
FT   CDS             join(22709886..22709913,22712566..22712601,
FT                   22717474..22717794,22719236..22719574,22720144..22720464,
FT                   22721900..22721913)
FT                   /codon_start=1
FT                   /gene="Cd5l"
FT                   /locus_tag="mCG_3081"
FT                   /product="CD5 antigen-like"
FT                   /note="gene_id=mCG3081.1 transcript_id=mCT1899.1
FT                   protein_id=mCP22851.1"
FT                   /protein_id="EDL15361.1"
FT                   /translation="MAPLFNLMLAILSIFVGSCFSESPTKVQLVGGAHRCEGRVEVEHN
FT                   GQWGTVCDDGWDRRDVAVVCRELNCGAVIQTPRGASYQPPASEQRVLIQGVDCNGTEDT
FT                   LAQCELNYDVFDCSHEEDAGAQCENPDSDLLFIPEDVRLVDGPGHCQGRVEVLHQSQWS
FT                   TVCKAGWNLQVSKVVCRQLGCGRALLTYGSCNKSTQGKGPIWMGKMSCSGQEANLRSCL
FT                   LSRLENNCTHGEDTWMECEDPFELKLVGGDTPCSGRLEVLHKGSWGSVCDDNWGEKEDQ
FT                   VVCKQLGCGKSLHPSPKTRKIYGPGAGRIWLDDVNCSGKEQSLEFCRHRLWGYHDCTHK
FT                   EDVEVICTDFDV"
FT   gene            22728056..22755498
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /note="gene_id=mCG142621.0"
FT   mRNA            join(22728056..22728196,22732945..22733004,
FT                   22733381..22733401,22736194..22736475,22736643..22736921,
FT                   22737258..22737386,22738353..22738377,22740948..22741030,
FT                   22741204..22741275,22741839..22741870,22742833..22743359)
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, transcript variant mCT181219"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181219.0
FT                   created on 19-MAR-2003"
FT   mRNA            join(22728071..22728196,22736194..22736475,
FT                   22736643..22736921,22737258..22737386,22738353..22738377,
FT                   22740948..22741030,22741204..22741275,22741839..22741870,
FT                   22752740..22752782,22753958..22754098,22755344..22755498)
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, transcript variant mCT181220"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181220.0
FT                   created on 19-MAR-2003"
FT   mRNA            join(<22728131..22728196,22733381..22733401,
FT                   22736194..22736475,22736643..22736921,22737258..22737386,
FT                   22738353..22738377,22740948..22741030,22741204..22741275,
FT                   22741839..22741870,22752740..22752782,22753958..22754462)
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, transcript variant mCT190949"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT190949.0
FT                   created on 08-MAR-2004"
FT   mRNA            join(22728131..22728196,22733381..22733401,
FT                   22736194..22736475,22736643..22736921,22737258..22737386,
FT                   22738353..22738377,22740948..22741030,22741204..22741275,
FT                   22741839..22741870,22742833..22743361)
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, transcript variant mCT181218"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181218.0
FT                   created on 19-MAR-2003"
FT   CDS             join(<22728133..22728196,22733381..22733401,
FT                   22736194..22736475,22736643..22736921,22737258..22737386,
FT                   22738353..22738377,22740948..22741030,22741204..22741275,
FT                   22741839..22741870,22752740..22752760)
FT                   /codon_start=1
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, isoform CRA_d"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT190949.0
FT                   protein_id=mCP111878.0 isoform=CRA_d"
FT                   /protein_id="EDL15360.1"
FT                   /translation="HLQVTIPSLVLMLPWLLLLICALPCEPAGISDVSLKTRPPGGWVM
FT                   EGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCA
FT                   ANDGHDPIPSELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFY
FT                   HESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPT
FT                   ENGISHLSLGLTGWLLGCLSLITMALIFCYWLKRKIGRQSEDPVRSPPQTVLQGSTYPK
FT                   SPDSRQPEPLYENVNVVSGNEVYSLVYHTPQVLEPAAAQHVRTHGVSEVQGGIA"
FT   CDS             join(22728166..22728196,22736194..22736475,
FT                   22736643..22736921,22737258..22737386,22738353..22738377,
FT                   22740948..22741030,22741204..22741275,22741839..22741870,
FT                   22752740..22752760)
FT                   /codon_start=1
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, isoform CRA_c"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181220.0
FT                   protein_id=mCP104140.0 isoform=CRA_c"
FT                   /protein_id="EDL15359.1"
FT                   /translation="MLPWLLLLICGISDVSLKTRPPGGWVMEGDKLVLICSVDRVTGNI
FT                   TYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIPSELVSIHVR
FT                   VPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSAPSGGGAS
FT                   FNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSLGLTGWLLGC
FT                   LSLITMALIFCYWLKRKIGRQSEDPVRSPPQTVLQGSTYPKSPDSRQPEPLYENVNVVS
FT                   GNEVYSLVYHTPQVLEPAAAQHVRTHGVSEVQGGIA"
FT   CDS             join(22728166..22728196,22732945..22733004,
FT                   22733381..22733401,22736194..22736475,22736643..22736921,
FT                   22737258..22737386,22738353..22738377,22740948..22741030,
FT                   22741204..22741275,22741839..22741870,22742833..22742910)
FT                   /codon_start=1
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, isoform CRA_b"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181219.0
FT                   protein_id=mCP104141.0 isoform=CRA_b"
FT                   /protein_id="EDL15358.1"
FT                   /translation="MLPWLLLLICGAAQFSVNNIAFSLQPDEMLSLPCEPAGISDVSLK
FT                   TRPPGGWVMEGDKLVLICSVDRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQ
FT                   SDADQYYCAANDGHDPIPSELVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRG
FT                   SPPIFYQFYHESIILGNSSAPSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALN
FT                   LTGLSLVPTENGISHLSLGLTGWLLGCLSLITMALIFCYWLKRKIGRQSEDPVRSPPQT
FT                   VLQGSTYPKSPDSRQPEPLYENVNVVSGNEVYSLVYHTPQVLEPAAAQHVRTHGVSESF
FT                   QVSSGLYSKPRINIAHMDYEDAM"
FT   CDS             join(22728166..22728196,22733381..22733401,
FT                   22736194..22736475,22736643..22736921,22737258..22737386,
FT                   22738353..22738377,22740948..22741030,22741204..22741275,
FT                   22741839..22741870,22742833..22742910)
FT                   /codon_start=1
FT                   /gene="Fcrl1"
FT                   /locus_tag="mCG_142621"
FT                   /product="Fc receptor-like 1, isoform CRA_a"
FT                   /note="gene_id=mCG142621.0 transcript_id=mCT181218.0
FT                   protein_id=mCP104142.0 isoform=CRA_a"
FT                   /protein_id="EDL15357.1"
FT                   /translation="MLPWLLLLICALPCEPAGISDVSLKTRPPGGWVMEGDKLVLICSV
FT                   DRVTGNITYFWYRGALGFQLETKTQPSLTAEFEISDMKQSDADQYYCAANDGHDPIPSE
FT                   LVSIHVRVPVSRPVLTFGDSGTQAVLGDLVELHCKALRGSPPIFYQFYHESIILGNSSA
FT                   PSGGGASFNFSLTAEHSGNFSCEASNGQGAQRSEVVALNLTGLSLVPTENGISHLSLGL
FT                   TGWLLGCLSLITMALIFCYWLKRKIGRQSEDPVRSPPQTVLQGSTYPKSPDSRQPEPLY
FT                   ENVNVVSGNEVYSLVYHTPQVLEPAAAQHVRTHGVSESFQVSSGLYSKPRINIAHMDYE
FT                   DAM"
FT   gene            22789898..22850036
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /note="gene_id=mCG63865.2"
FT   mRNA            join(22789898..22790070,22794261..22794281,
FT                   22796044..22796307,22797591..22797848,22802188..>22802466)
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /product="Fc receptor-like 5, transcript variant mCT64048"
FT                   /note="gene_id=mCG63865.2 transcript_id=mCT64048.2 created
FT                   on 19-JUN-2003"
FT   mRNA            join(22789934..22790070,22794261..22794281,
FT                   22797591..22797848,22798105..22798389,22800293..22800574,
FT                   22802188..22802466,22808645..22808752,22809773..22809800,
FT                   22811129..22811211,22811391..22811453,22811805..22811874,
FT                   22849028..22850036)
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /product="Fc receptor-like 5, transcript variant mCT181560"
FT                   /note="gene_id=mCG63865.2 transcript_id=mCT181560.0 created
FT                   on 19-JUN-2003"
FT   CDS             join(22790007..22790070,22794261..22794281,
FT                   22797591..22797848,22798105..22798389,22800293..22800574,
FT                   22802188..22802466,22808645..22808752,22809773..22809800,
FT                   22811129..22811211,22811391..22811453,22811805..22811857)
FT                   /codon_start=1
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /product="Fc receptor-like 5, isoform CRA_a"
FT                   /note="gene_id=mCG63865.2 transcript_id=mCT181560.0
FT                   protein_id=mCP104482.0 isoform=CRA_a"
FT                   /protein_id="EDL15355.1"
FT                   /translation="MSGSFSPCVVFTQMWLTLLVVTPVNGQHDFLVLQAPPAVFEGDSV
FT                   VLRCYAKKGIEAETLTFYKDGKALTLHHQSELSIHHANLKDNGQYKCTSKKKWSFGSLY
FT                   TSNTVGVQVQELFPRPVLRARPSHPIDGSPVTLTCQTQLSAQKSDARLQFCFFRNLQLL
FT                   GSGCSRSSEFHIPAIWTEESRRYQCKAETVNSQVRKQSTAFIIPVQRASARFQTHIIPA
FT                   SKLVFEGQLLLLNCSVKGVPGPLKFSWYKKDMLNEETKILKSSNAEFKISQVNISDAGE
FT                   YHCEATNSRRSFVSRAFPITIKVPVSQPVLTLSTGKTQALEGDLMTLHCQSQRGSPCIL
FT                   YEFFYENVSLGNSSILSGGGAYFNFSMSTERSGNYYCTADNGLGAQCSEAIRISIFDMT
FT                   KNRSVPMAAGITVGLLIMAVGVFLFYCWFSRKAGGKPTSDDSRNPSDSEPQEPTYYNVP
FT                   ACIELQPVYSNEPEENVIYTEVRRTQPRQKHADQESESPRSRCQMAEKK"
FT   CDS             join(22790007..22790070,22794261..22794281,
FT                   22796044..22796307,22797591..22797848,22802188..>22802466)
FT                   /codon_start=1
FT                   /gene="Fcrl5"
FT                   /locus_tag="mCG_63865"
FT                   /product="Fc receptor-like 5, isoform CRA_b"
FT                   /note="gene_id=mCG63865.2 transcript_id=mCT64048.2
FT                   protein_id=mCP42625.2 isoform=CRA_b"
FT                   /protein_id="EDL15356.1"
FT                   /translation="MSGSFSPCVVFTQMWLTLLVVTPVNGQHEAAQQSVVSLQPPWTTF
FT                   FRGEVVTLTCYRFGFSVPQKTKWYQKRKTVKQTPGALVIKAHTLKVHESGEYWCQADSL
FT                   LPSMHVNVEFSEDFLVLQAPPAVFEGDSVVLRCYAKKGIEAETLTFYKDGKALTLHHQS
FT                   ELSIHHANLKDNGQYKCTSKKKWSFGSLYTSNTVGVQVQVPVSQPVLTLSTGKTQALEG
FT                   DLMTLHCQSQRGSPCILYEFFYENVSLGNSSILSGGGAYFNFSMSTERSGNYYCTADNG
FT                   LGAQCSEAIRISIF"
FT   gene            22875059..22886114
FT                   /gene="Etv3"
FT                   /locus_tag="mCG_3087"
FT                   /note="gene_id=mCG3087.2"
FT   mRNA            join(22875059..22875076,22876694..22876752,
FT                   22877306..22877543,22878659..22878774,22884929..22886114)
FT                   /gene="Etv3"
FT                   /locus_tag="mCG_3087"
FT                   /product="ets variant gene 3"
FT                   /note="gene_id=mCG3087.2 transcript_id=mCT1892.2 created on
FT                   15-AUG-2002"
FT   CDS             join(22876707..22876752,22877306..22877543,
FT                   22878659..22878774,22884929..22886070)
FT                   /codon_start=1
FT                   /gene="Etv3"
FT                   /locus_tag="mCG_3087"
FT                   /product="ets variant gene 3"
FT                   /note="gene_id=mCG3087.2 transcript_id=mCT1892.2
FT                   protein_id=mCP22856.2"
FT                   /db_xref="GOA:Q8R4Z4"
FT                   /db_xref="InterPro:IPR000418"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="MGI:MGI:1350926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8R4Z4"
FT                   /protein_id="EDL15354.1"
FT                   /translation="MKAGCSIVEKPEGGGGYQFPDWAYKAESSPGSRQIQLWHFILELL
FT                   QKEEFRHVIAWQQGEYGEFVIKDPDEVARLWGRRKCKPQMNYDKLSRALRYYYNKRILH
FT                   KTKGKRFTYKFNFNKLVMPNYPFINIRSSGVVPQSAPPVPTASSRFHFPPLDSHSPTGD
FT                   VQPGRFSASSLSASGPESGVTTDRKVEPSDLEDGSASDWHRGMDFMPSRNALGGGAVGH
FT                   QKRKPDILLPLFTRPAMYPDPHSPFAISPVPGRGGVLNVPISPALSLTPTMFSYSPSPG
FT                   LSPFTSSSCFSFNPEEMKHYLHSQACSVFNYHLSPRTFPRYPGLMVPPLQCQMHPEEPS
FT                   QFSIKLQPPPAGRKNRERVESREEAVRGSVPASAPVPSRIKVEPATEKDPDSLRQSTQG
FT                   KEEQTQEVDSMRSRTIEEGKGTGFAHPSPTWPSVSISTPSDEPLEGTEDSEDRSVREPG
FT                   VPEKKEDALMPPKLRLKRRWNDDPEARELNKTGKFLWNGAGPQGLATTATAAADA"
FT   gene            22903961..22904764
FT                   /pseudo
FT                   /locus_tag="mCG_3095"
FT                   /note="gene_id=mCG3095.2"
FT   mRNA            22903961..22904764
FT                   /pseudo
FT                   /locus_tag="mCG_3095"
FT                   /note="gene_id=mCG3095.2 transcript_id=mCT1886.2 created on
FT                   28-MAR-2003"
FT   gene            complement(23032165..23032632)
FT                   /pseudo
FT                   /locus_tag="mCG_3090"
FT                   /note="gene_id=mCG3090.0"
FT   mRNA            complement(23032165..23032632)
FT                   /pseudo
FT                   /locus_tag="mCG_3090"
FT                   /note="gene_id=mCG3090.0 transcript_id=mCT1895.0 created on
FT                   28-MAR-2003"
FT   gene            23036202..23090670
FT                   /gene="Arhgef11"
FT                   /locus_tag="mCG_3082"
FT                   /note="gene_id=mCG3082.1"
FT   mRNA            join(23036202..23036293,23037196..23037294,
FT                   23038744..23038793,23039664..23039721,23040563..23040741,
FT                   23041528..23041599,23048116..23048235,23054832..23054906,
FT                   23055129..23055230,23062237..23062335,23064171..23064213,
FT                   23065683..23065779,23065893..23066015,23069653..23069797,
FT                   23070044..23070143,23074849..23074975,23078000..23078179,
FT                   23078258..23078305,23078485..23078672,23078893..23079039,
FT                   23079658..23079737,23079886..23080011,23080479..23080596,
FT                   23081032..23081210,23081721..23081796,23082001..23082168,
FT                   23082925..23083015,23083668..23083817,23084298..23084359,
FT                   23085176..23085388,23085664..23086020,23086939..23087067,
FT                   23087860..23088086,23088321..23088510,23089559..23090670)
FT                   /gene="Arhgef11"
FT                   /locus_tag="mCG_3082"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 11"
FT                   /note="gene_id=mCG3082.1 transcript_id=mCT1907.1 created on
FT                   01-NOV-2002"
FT   CDS             join(23038755..23038793,23039664..23039721,
FT                   23040563..23040741,23041528..23041599,23048116..23048235,
FT                   23054832..23054906,23055129..23055230,23062237..23062335,
FT                   23064171..23064213,23065683..23065779,23065893..23066015,
FT                   23069653..23069797,23070044..23070143,23074849..23074975,
FT                   23078000..23078179,23078258..23078305,23078485..23078672,
FT                   23078893..23079039,23079658..23079737,23079886..23080011,
FT                   23080479..23080596,23081032..23081210,23081721..23081796,
FT                   23082001..23082168,23082925..23083015,23083668..23083817,
FT                   23084298..23084359,23085176..23085388,23085664..23086020,
FT                   23086939..23087067,23087860..23088086,23088321..23088510,
FT                   23089559..23089617)
FT                   /codon_start=1
FT                   /gene="Arhgef11"
FT                   /locus_tag="mCG_3082"
FT                   /product="Rho guanine nucleotide exchange factor (GEF) 11"
FT                   /note="gene_id=mCG3082.1 transcript_id=mCT1907.1
FT                   protein_id=mCP22816.2"
FT                   /protein_id="EDL15353.1"
FT                   /translation="MRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLLGSS
FT                   PSSIGVSGLQQNPSLSGGPRVNPTIPPPPPPPPLPPPQHITGPKPLQDPEVQKHATQIL
FT                   RNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVGIDQSPK
FT                   PLIIGPEEDYDPGYFNNESDIIFQDLEKLKSHPAYLVVFLRYIFSQADPGPLLFYLCSE
FT                   VYQQTNPKDSRNLGKDIWNIFLEKNAPLRVKIPEMLQAEIDLRLRNSEDPRSALYEAQE
FT                   AVMPEIQEQINDYRSKRTLGLGSLYGENDLLDLDGDPLRERQMAEKQLAALGDIFAPMD
FT                   FAVNTYMSHTGIRLRESRPSSTAEKTQSAPDKDKWLPFFPKTKKQSSNSKKEKDALEDK
FT                   KRNPILRYIGKPKSSSQSIKPGNVRNIIQHFENSHQYDVPEPGTQRLSTGSFPEDLLES
FT                   DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSL
FT                   STRSLENPTPPFTPKMGRRSIESPNLGFCTDVILPHLLEDDLGQLSDLEPEPEVQNWQH
FT                   TVGKDVVANLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELAR
FT                   LFPNLPELIEIHNSWCEAMKKLREEGPIIRDISDLMLARFDGPAREELQQVAAQFCSYQ
FT                   SVALELIRTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLENIIKH
FT                   TAGGTSEHEKLCRARDQCREILKFVNEAVKQTENRHRLEGYQKRLDATALERASNPLAA
FT                   EFKSLDLTTRKMIHEGPLTWRISKDKTLDLQVLLLEDLVVLLQRQEEKLLLKCHSKTAV
FT                   GSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSELGPPQIYELVALTSSDKNIPVF
FT                   VPSNRWMELLEEAVQNATKHPGDAPVLNHPSPPGSQEPAYQGSTSSRVEVNDSEVYPTE
FT                   REPKKPSEGPGPEQRGQDKQLLAQEGPEQEEDAEELRALPCPPPSLDGENRGIRTRDPV
FT                   LLALTGPLLMEGLADAALEDVENLRHLILWSLLPGHTVKTQAAGEPEDDLTPTPSVVSI
FT                   TSHPWDPGSPGQAPAISDNTQFPRPEGSQPEGEDVALCSLAHLPPRTRNSGIWDSPELD
FT                   RNPAEEASSSEPAGSYKVVRKVSLLPGGGVGAAKVAGSNVTPALPESGQSESELSEVEG
FT                   GAQATGNCFYVSMPAEPLDSSTEPPGTPPSLSQCHSLPAWPTEPPQHRGVTGGQRSSLV
FT                   LRDMGVIFHTIEQLTVKLHRLKDMELAHRELLNSLGGESSGGTTPVGSFHTEAARWTDY
FT                   SLSPPAKEALTSDPQNNQEQGSYPEEGSDTPLEDSATDTASSPGP"
FT   gene            complement(23089438..23101585)
FT                   /locus_tag="mCG_3093"
FT                   /note="gene_id=mCG3093.2"
FT   mRNA            complement(join(23089438..23091706,23091866..23091987,
FT                   23092349..23092463,23093492..23093580,23093953..23094046,
FT                   23094233..23094382,23095143..23095232,23095305..23095388,
FT                   23095462..23095621,23095814..23095882,23097953..23098030,
FT                   23098179..23098254,23098395..23098523,23098608..23098757,
FT                   23101004..23101526))
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, transcript variant mCT181526"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT181526.0 created
FT                   on 27-MAR-2003"
FT   mRNA            complement(join(23090410..23091706,23091866..23091987,
FT                   23092349..23092460,23093492..23094046,23094233..23094382,
FT                   23095143..23095232,23095305..23095388,23095462..23095621,
FT                   23095814..23095882,23097953..23098030,23098179..23098254,
FT                   23098395..23098523,23098608..23098757,23101004..>23101326))
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, transcript variant mCT190953"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT190953.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23090411..23091706,23091866..23091987,
FT                   23092349..23092460,23093492..23093580,23093953..23094046,
FT                   23094233..23094382,23095143..23095232,23095305..23095388,
FT                   23095453..23095621,23095814..23095882,23097953..23098030,
FT                   23098179..23098254,23098395..23098523,23098608..23098757,
FT                   23101004..23101585))
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, transcript variant mCT1885"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT1885.1 created on
FT                   27-MAR-2003"
FT   CDS             complement(join(23091596..23091706,23091866..23091987,
FT                   23092349..23092463,23093492..23093580,23093953..23094046,
FT                   23094233..23094382,23095143..23095232,23095305..23095388,
FT                   23095462..23095621,23095814..23095882,23097953..23098030,
FT                   23098179..23098254,23098395..23098523,23098608..23098757,
FT                   23101004..23101163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, isoform CRA_a"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT181526.0
FT                   protein_id=mCP104448.0 isoform=CRA_a"
FT                   /protein_id="EDL15350.1"
FT                   /translation="MSSEPSTTGTSPRTPRPGAQKSSGAVTKKGDRAAKDKTASTLPPV
FT                   GEDEPKNPEEYQCTGVLETDFAELCTRSGYVDFPKVVTRPRVQQSSVPSASTSEKPVLD
FT                   DQRPSASCSQSSLESKYVFFRPTIQVELEQEDSKAVKEIYIRGWKVEDRILGIFSKCLP
FT                   SLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKVSLEGNPIPEQSFSKLMGLDSTI
FT                   VHLSLRNNNINDHGAQLLGQALSTLQNSNRTLVSLNLAFNHIGDVGAGYIADGLRLNRS
FT                   LLWLSLAHNHIQDKGALKLAEVLRPFELTHREVVERRRLLLVKGTQERSRSPSSSRYGD
FT                   SKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEKTGEVVKKEEKLGSGQSPTQ
FT                   GTPKKEDAAKAGKGKVTIPEQKMSKGKATKMGAKEKRSILLESEQLVVEATEMVNPLLE
FT                   PVEHRDGKVFLPGNKVLLHLNLLRNQITEVGLEGFLTAVQYQVQVSKPKTSPKAPLGLL
FT                   WLSLAKNCFDPQCPTHVMIQELMLPRDPVKAKAREEEAAAT"
FT   CDS             complement(join(23091596..23091706,23091866..23091987,
FT                   23092349..23092460,23093492..23093580,23093953..23094046,
FT                   23094233..23094382,23095143..23095232,23095305..23095388,
FT                   23095453..23095621,23095814..23095882,23097953..23098030,
FT                   23098179..23098254,23098395..23098523,23098608..23098757,
FT                   23101004..23101163))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, isoform CRA_b"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT1885.1
FT                   protein_id=mCP22864.1 isoform=CRA_b"
FT                   /protein_id="EDL15351.1"
FT                   /translation="MSSEPSTTGTSPRTPRPGAQKSSGAVTKKGDRAAKDKTASTLPPV
FT                   GEDEPKNPEEYQCTGVLETDFAELCTRSGYVDFPKVVTRPRVQQSSVPSASTSEKPVLD
FT                   DQRPSASCSQSSLESKYVFFRPTIQVELEQEDSKAVKEIYIRGWKVEDRILGIFSKCLP
FT                   SLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKVSLEGNPIPEQSFSKLMGLDSTI
FT                   VHLSLRNNNINDHGAQLLGQALSTLQNSNRTLVSLNLAFNHIGDVGAGYIADVRAGLRL
FT                   NRSLLWLSLAHNHIQDKGALKLAEVLRPFELTHREVVERRRLLLVKGTQERSRSPSSSR
FT                   YGDSKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEKTGEVVKKEEKLGSGQS
FT                   PTQGTPKKEDAAKAGKGKVTIPEQKMSKGKATKMGAKEKRSILLESELVVEATEMVNPL
FT                   LEPVEHRDGKVFLPGNKVLLHLNLLRNQITEVGLEGFLTAVQYQVQVSKPKTSPKAPLG
FT                   LLWLSLAKNCFDPQCPTHVMIQELMLPRDPVKAKAREEEAAAT"
FT   CDS             complement(join(23093816..23094046,23094233..23094382,
FT                   23095143..23095232,23095305..23095388,23095462..23095621,
FT                   23095814..23095882,23097953..23098030,23098179..23098254,
FT                   23098395..23098523,23098608..23098757,23101004..>23101220))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3093"
FT                   /product="mCG3093, isoform CRA_c"
FT                   /note="gene_id=mCG3093.2 transcript_id=mCT190953.0
FT                   protein_id=mCP111918.0 isoform=CRA_c"
FT                   /protein_id="EDL15352.1"
FT                   /translation="GPQSPVSSCLSLEGSKSTPMSSEPSTTGTSPRTPRPGAQKSSGAV
FT                   TKKGDRAAKDKTASTLPPVGEDEPKNPEEYQCTGVLETDFAELCTRSGYVDFPKVVTRP
FT                   RVQQSSVPSASTSEKPVLDDQRPSASCSQSSLESKYVFFRPTIQVELEQEDSKAVKEIY
FT                   IRGWKVEDRILGIFSKCLPSLSQLQAINLWKVGLTDKTLTTFIALLPLCSSTLRKVSLE
FT                   GNPIPEQSFSKLMGLDSTIVHLSLRNNNINDHGAQLLGQALSTLQNSNRTLVSLNLAFN
FT                   HIGDVGAGYIADGLRLNRSLLWLSLAHNHIQDKGALKLAEVLRPFELTHREVVERRRLL
FT                   LVKGTQERSRSPSSSRYGDSKAEREKSQTLGISNVTLVDKQEKMQSLKAPKTISKKKEK
FT                   TGEVVKKEEKLGSGQSPTQGTPKKEDAAKAGKGSKCENPLWDSSPPTWRKSFGQGVGAW
FT                   LCLPGAVLSRLSLGLVYNE"
FT   gene            complement(23102599..23123092)
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /note="gene_id=mCG122089.1"
FT   mRNA            complement(join(23102599..23102996,23105240..23105485,
FT                   23105570..23105644,23105780..23105903,23105984..23106072,
FT                   23106237..23106449,23106602..23106730,23106838..23106966,
FT                   23107880..23108008,23108178..23108324,23108407..23108509,
FT                   23108612..23108775,23109992..23110112,23110193..23110367,
FT                   23110639..23110851,23110936..23111072,23111231..23111351,
FT                   23111992..23112235,23112390..23112482,23113226..23113326,
FT                   23113609..23113713,23114357..23114518,23116345..23116414,
FT                   23123014..>23123080))
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /product="RIKEN cDNA 3110045G13, transcript variant
FT                   mCT190943"
FT                   /note="gene_id=mCG122089.1 transcript_id=mCT190943.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(23102845..23102996,23105240..23105485,
FT                   23105570..23105644,23105780..23105903,23105984..23106072,
FT                   23106237..23106449,23106602..23106730,23106838..23106966,
FT                   23107880..23108008,23108178..23108324,23108407..23108509,
FT                   23108612..23108775,23109992..23110112,23110193..23110367,
FT                   23110639..23110851,23110936..23111072,23111231..23111351,
FT                   23111992..23112235,23112390..23112482,23113226..23113326,
FT                   23113609..23113713,23114357..>23114517))
FT                   /codon_start=1
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /product="RIKEN cDNA 3110045G13, isoform CRA_b"
FT                   /note="gene_id=mCG122089.1 transcript_id=mCT190943.0
FT                   protein_id=mCP111875.0 isoform=CRA_b"
FT                   /protein_id="EDL15349.1"
FT                   /translation="CVLPAAGCSAVLLPCALSQASAMPLCPLLLLALGLRLTGTLNSND
FT                   PNVCTFWESFTTTTKESHLRPFSLLPAESCHRPWEDPHTCAQPTVVYRTVYRQVVKMDS
FT                   RPRLQCCRGYYESRGACVPLCAQECVHGRCVAPNQCQCAPGWRGGDCSSECAPGMWGPQ
FT                   CDKFCHCGNNSSCDPKSGACFCPSGLQPPNCLQPCPAGHYGPACQFDCQCYGASCDPQD
FT                   GACFCPPGRAGPSCNVPCSQGTDGFFCPRTYPCQNGGVPQGSQGSCSCPPGWMGVICSL
FT                   PCPEGFHGPNCTQECRCHNGGLCDRFTGQCHCAPGYIGDRCQEECPVGRFGQDCAETCD
FT                   CAPGARCFPANGACLCEHGFTGDRCTERLCPDGRYGLSCQEPCTCDPEHSLSCHPMHGE
FT                   CSCQPGWAGLHCNESCPQDTHGPGCQEHCLCLHGGLCLADSGLCRCAPGYTGPHCANLC
FT                   PPDTYGINCSSRCSCENAIACSPIDGTCICKEGWQRGNCSVPCPLGTWGFNCNASCQCA
FT                   HDGVCSPQTGACTCTPGWHGAHCQLPCPKGQFGEGCASVCDCDHSDGCDPVHGQCRCQA
FT                   GWMGTRCHLPCPEGFWGANCSNTCTCKNGGTCVSENGNCVCAPGFRGPSCQRPCPPGRY
FT                   GKRCVQCKCNNNHSSCHPSDGTCSCLAGWTGPDCSEACPPGHWGLKCSQLCQCHHGGTC
FT                   HPQDGSCICTPGWTGPNCLEGCPPRMFGVNCSQLCQCDLGEMCHPETGACVCPPGHSGA
FT                   DCKMGSQESFTIMPTSPVTHNSLGAVIGIAVLGTLVVALIALFIGYRQWQKGKEHEHLA
FT                   VAYSTGRLDGSDYVMPDVSPSYSHYYSNPSYHTLSQCSPNPPPPNKVPGSQLFVSSQAP
FT                   ERPSRAHGRENHTTLPADWKHRREPHDRGASHLDRSYSCSYSHRNGPGPFCHKGPISEE
FT                   GLGASVMSLSSENPYATIRDLPSLPGEPRESGYVEMKGPPSVSPPRQSLHLRDRQQRQL
FT                   QPQRDSGTYEQPSPLSHNEESLGSTPPLPPGLPPGHYDSPKNSHIPGHYDLPPVRHPPS
FT                   PPSRRQDR"
FT   mRNA            complement(join(23103230..23103426,23105240..23105485,
FT                   23105570..23105644,23105780..23105903,23105984..23106072,
FT                   23106237..23106563,23106602..23106730,23107880..23108008,
FT                   23108178..23108324,23108407..23108509,23108612..23108775,
FT                   23109992..23110112,23110193..23110367,23110639..23110851,
FT                   23110936..23111072,23111231..23111351,23111992..23112235,
FT                   23112390..23112482,23113226..23113326,23113609..23113713,
FT                   23114357..23114518,23116345..23116414,23117360..23117493,
FT                   23123014..23123092))
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /product="RIKEN cDNA 3110045G13, transcript variant
FT                   mCT123304"
FT                   /note="gene_id=mCG122089.1 transcript_id=mCT123304.1
FT                   created on 30-SEP-2002"
FT   CDS             complement(join(23103275..23103426,23105240..23105485,
FT                   23105570..23105644,23105780..23105903,23105984..23106072,
FT                   23106237..23106563,23106602..23106730,23107880..23108008,
FT                   23108178..23108324,23108407..23108509,23108612..23108775,
FT                   23109992..23110112,23110193..23110367,23110639..23110851,
FT                   23110936..23111072,23111231..23111351,23111992..23112235,
FT                   23112390..23112482,23113226..23113326,23113609..23113713,
FT                   23114357..23114451))
FT                   /codon_start=1
FT                   /gene="3110045G13Rik"
FT                   /locus_tag="mCG_122089"
FT                   /product="RIKEN cDNA 3110045G13, isoform CRA_a"
FT                   /note="gene_id=mCG122089.1 transcript_id=mCT123304.1
FT                   protein_id=mCP65437.1 isoform=CRA_a"
FT                   /protein_id="EDL15348.1"
FT                   /translation="MPLCPLLLLALGLRLTGTLNSNDPNVCTFWESFTTTTKESHLRPF
FT                   SLLPAESCHRPWEDPHTCAQPTVVYRTVYRQVVKMDSRPRLQCCRGYYESRGACVPLCA
FT                   QECVHGRCVAPNQCQCAPGWRGGDCSSECAPGMWGPQCDKFCHCGNNSSCDPKSGACFC
FT                   PSGLQPPNCLQPCPAGHYGPACQFDCQCYGASCDPQDGACFCPPGRAGPSCNVPCSQGT
FT                   DGFFCPRTYPCQNGGVPQGSQGSCSCPPGWMGVICSLPCPEGFHGPNCTQECRCHNGGL
FT                   CDRFTGQCHCAPGYIGDRCQEECPVGRFGQDCAETCDCAPGARCFPANGACLCEHGFTG
FT                   DRCTERLCPDGRYGLSCQEPCTCDPEHSLSCHPMHGECSCQPGWAGLHCNESCPQDTHG
FT                   PGCQEHCLCLHGGLCLADSGLCRCAPGYTGPHCANLCPPDTYGINCSSRCSCENAIACS
FT                   PIDGTCICKEGWQRGNCSVPCPLGTWGFNCNASCQCAHDGVCSPQTGACTCTPGWHGAH
FT                   CQLPCPKGQFGEGCASVCDCDHSDGCDPVHGQCRCQAGWMGTRCHLPCPEGFWGANCSN
FT                   TCTCKNGGTCVSENGNCVCAPGFRGPSCQRPCPPGRYGKRCVQCKCNNNHSSCHPSDGT
FT                   CSCLAGWTGPDCSEGCPPRMFGVNCSQLCQCDLGEMCHPETGACVCPPGHSGADCKMGS
FT                   GTQGALITFSVFLTMHSSSLAERTKVPVSVPTPHLTGSQESFTIMPTSPVTHNSLGAVI
FT                   GIAVLGTLVVALIALFIGYRQWQKGKEHEHLAVAYSTGRLDGSDYVMPDVSPSYSHYYS
FT                   NPSYHTLSQCSPNPPPPNKVPGSQLFVSSQAPERPSRAHGRENHTTLPADWKHRREPHD
FT                   RGASHLDRSYSCSYSHRNGPGPFCHKGPISEEGLGASVMSLSSENPYATIRDLPSLPGE
FT                   PRESGYVEMKGPPSVSPPRQSLHLRDRQQRQLQPQRDSGTYEQPSPLSHNEESLGSTPP
FT                   LPPGLPPGHYDSPKNSHIPGHYDLPPVRHPPSPPSRRQDR"
FT   gene            complement(23132381..>23149282)
FT                   /locus_tag="mCG_3085"
FT                   /note="gene_id=mCG3085.1"
FT   mRNA            complement(join(23132381..23132735,23133772..23133930,
FT                   23134207..23134447,23135498..23135739,23135877..23136007,
FT                   23136289..23136435,23136863..23136965,23137212..23137267,
FT                   23137808..23138137,23140106..23140238,23142455..23142597,
FT                   23142760..23142959,23145512..23145583,23145808..23145882,
FT                   23149071..>23149282))
FT                   /locus_tag="mCG_3085"
FT                   /product="mCG3085"
FT                   /note="gene_id=mCG3085.1 transcript_id=mCT1896.2 created on
FT                   31-OCT-2002"
FT   CDS             complement(join(23132550..23132735,23133772..23133930,
FT                   23134207..23134447,23135498..23135739,23135877..23136007,
FT                   23136289..23136435,23136863..23136965,23137212..23137267,
FT                   23137808..23138137,23140106..23140238,23142455..23142597,
FT                   23142760..23142959,23145512..23145583,23145808..23145882,
FT                   23149071..23149282))
FT                   /codon_start=1
FT                   /locus_tag="mCG_3085"
FT                   /product="mCG3085"
FT                   /note="gene_id=mCG3085.1 transcript_id=mCT1896.2
FT                   protein_id=mCP22857.2"
FT                   /protein_id="EDL15347.1"
FT                   /translation="MLRGQRLGQLGWHRPAAGLGSLMTSLMLACASAASCREVCCPVGP
FT                   SGLRCTRAGSLDTLRGLRGAGNLTELYVENQQHLQRLEFEDLQGLGELRSLTIVKSGLR
FT                   FVAPDAFRFTPRLSHLPVAPSFPDSQHPLPNRTLSGNPLHCSCALFWLQRWEQEGLCGV
FT                   HTQTLHDSGPGDQFLPLGHNTSCGVPTVKIQMPNDSVEVGDDVFLQCQVEGLALQQADW
FT                   ILTELEGAATVKKFGDLPSLGLILVNVTSDLNKKNVTCWAENDVGRAEVSVQVSVSFPA
FT                   SVHLGLAVEQHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTQFLESALTNETMRHG
FT                   CLRLNQPTHVNNGNYTLLAANPYGQAAASVMAAFMDNPFEFNPEDPIPDGNSTSRDPVE
FT                   KKDETPFGVSVAVGLAVSAALFLSALLLVLNKCGQRSKFGINRPAVLAPEDGLAMSLHF
FT                   MTLGGSSLSPTEGKGSGLQGHIMENPQYFSDTCVHHIKRQDIILKWELGEGAFGKVFLA
FT                   ECYNLLNDQDKMLVAVKALKEASENARQDFQREAELLTMLQHQHIVRFFGVCTEGGPLL
FT                   MVFEYMRHGDLNRFLRYKNPPLLPSLLSSLQEYPCLSARSHGPDAKLLAGGEDVAPGPL
FT                   GLGQLLAVASQVAAGMVYLASLHFVHRDLATRNCLVGQGLVVKIGDFGMSRDIYSTDYY
FT                   RVGGRTMLPIRWMPPESILYRKFSTESDVWSFGVVLWEIFTYGKQPWYQLSNTEAIECI
FT                   TQGRELERPRACPPDVYAIMRGCWQREPQQRLSMKDVHARLQALAQAPPSYLDVLG"
FT   gene            23151200..23170260
FT                   /gene="Insrr"
FT                   /locus_tag="mCG_3075"
FT                   /note="gene_id=mCG3075.1"
FT   mRNA            join(23151200..23151646,23154489..23155040,
FT                   23156530..23156833,23156920..23157062,23157224..23157368,
FT                   23158155..23158369,23158550..23158676,23162732..23162970,
FT                   23163438..23163605,23163694..23163889,23164054..23164095,
FT                   23164174..23164394,23164592..23164728,23164809..23164971,
FT                   23165100..23165205,23165743..23165795,23167112..23167341,
FT                   23167722..23167832,23167940..23168099,23168345..23168474,
FT                   23168607..23168741,23169294..23170260)
FT                   /gene="Insrr"
FT                   /locus_tag="mCG_3075"
FT                   /product="insulin receptor-related receptor"
FT                   /note="gene_id=mCG3075.1 transcript_id=mCT1916.1 created on
FT                   15-AUG-2002"
FT   CDS             join(23151562..23151646,23154489..23155040,
FT                   23156530..23156833,23156920..23157062,23157224..23157368,
FT                   23158155..23158369,23158550..23158676,23162732..23162970,
FT                   23163438..23163605,23163694..23163889,23164054..23164095,
FT                   23164174..23164394,23164592..23164728,23164809..23164971,
FT                   23165100..23165205,23165743..23165795,23167112..23167341,
FT                   23167722..23167832,23167940..23168099,23168345..23168474,
FT                   23168607..23168741,23169294..23169534)
FT                   /codon_start=1
FT                   /gene="Insrr"
FT                   /locus_tag="mCG_3075"
FT                   /product="insulin receptor-related receptor"
FT                   /note="gene_id=mCG3075.1 transcript_id=mCT1916.1
FT                   protein_id=mCP22873.1"
FT                   /db_xref="GOA:Q9WTL4"
FT                   /db_xref="InterPro:IPR000494"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR002011"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR006211"
FT                   /db_xref="InterPro:IPR006212"
FT                   /db_xref="InterPro:IPR008266"
FT                   /db_xref="InterPro:IPR009030"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016246"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR020635"
FT                   /db_xref="InterPro:IPR028792"
FT                   /db_xref="MGI:MGI:1346037"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9WTL4"
FT                   /protein_id="EDL15346.1"
FT                   /translation="MAVPALWPWGVHLLMSLLSLGSGLDTLEVCPSLDIRSEVTELRRL
FT                   ENCSVVEGHLQILLMFAATGEDFRGLSFPRLTQVTDYLLLFRVYGLESLRDLFPNLTVI
FT                   RGTRLFLGYALIIFEMPHLRDVGLPSLGAVLRGAVRVEKNQELCHLSTIDWGLLQPAPG
FT                   TNHIVGNKLGEECADVCPGVLGAAGEPCSRTTFSGRTDYRCWTSSHCQKVCPCPRGMAC
FT                   TAGGDCCHSECLGGCSQPEDPRACVACRHLYFQGVCLRACPPGTYQYESWRCVTAELCA
FT                   HLREVPGLATTFGIYEGSCLAQCPPGFTRNGSSIFCHKCEGLCPKECKVGTKTIDSVQA
FT                   TQDLVGCTHVEGNLILNLRQGYNLEPELQRNLGLVETITGFLKIKHSFALVTLGFFKNL
FT                   KLIRGDSMVDGNYTLYVLDNQNLQQLGSWVTAGLTIPVGKIYFAFNPRLCLEHIYQLEE
FT                   VTGTRGRQSKAEINPRTNGDRAACQTRTLRFVFNLTEEDRILLRWERYEPLEARDLLSF
FT                   IVYYKESPFQNATEHVGPDACGTQSWNLLDVELPLSRTQEPGVTLAPLKPWTQYAVFVR
FT                   AITLTTAEDSPHQGAQSPIVYLRTLPAAPTVPQDVISTSNSSSHLLVRWKPPVQRNGNI
FT                   TYYLVLWQRLAEDGDLYINDYCHRGLRLPTSSHDTRFDREDPALEAEPEQGCCPCQHSP
FT                   PGQALPALEAQEVTFQKKFENFLHHAITIPKAPWKVTSINKNPQRDSERHRREAGLLRL
FT                   GKNNSDFEIQEDKVPRERAILSGLRHFTEYRIDIHACNHAAHTVGCSAATFVFARTMPH
FT                   READGIPGKVAWKAAGKSSVTLHWLEPPDPNGLILKYEIKYRRLGEEATVLCVSRLRYA
FT                   KVGGVHLALLPPGNYSAKVRATSLAGNGSWTDGVTFYITDLEEEDTGGMRIFLTVTPVG
FT                   FMLLVTLAALGFFYSRKRNSTLYTSVNPEYFSASHMYVPDEWEVPREQIAIIRELGQGS
FT                   FGMVYEGLARGLEAGEESTPVALKTVNELASARERVEFLKEASVMKAFKCHHVVRLLGV
FT                   VSQGQPTLVIMELMTRGDLKSHLRSLRPEAENNPGLPQPALSDMIQMAGEIADGMAYLA
FT                   AKKFVHRDLAARNCMVSQDFTVKIGDFGMTRDVYETDYYRKGGKGLLPVRWMAPESLKD
FT                   GIFTTHSDVWSFGVVLWEIVTLAEQPYQGLSNEQVLKFVMDGGVLEELENCPIQLQELM
FT                   RLCWQHSPRLRPTFVHILDRIQDELRPSFRLCSFYYSPECQRGQASLLPTEAEPDSPPT
FT                   LNGASDYSAPNGGPGH"
FT   gene            23200972..23206994
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /note="gene_id=mCG3076.1"
FT   mRNA            join(23200972..23201330,23201860..23202014,
FT                   23202581..23202762,23203286..23203375,23203534..23203702,
FT                   23205946..23206098,23206290..23206994)
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /product="SH2 domain protein 2A, transcript variant
FT                   mCT1903"
FT                   /note="gene_id=mCG3076.1 transcript_id=mCT1903.1 created on
FT                   26-MAR-2003"
FT   mRNA            join(23201254..23201330,23201860..23202014,
FT                   23202581..23202762,23203286..23203375,23203534..23203702,
FT                   23205946..23206074,23206290..>23206323)
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /product="SH2 domain protein 2A, transcript variant
FT                   mCT181531"
FT                   /note="gene_id=mCG3076.1 transcript_id=mCT181531.0 created
FT                   on 26-MAR-2003"
FT   CDS             join(23201297..23201330,23201860..23202014,
FT                   23202581..23202762,23203286..23203375,23203534..23203702,
FT                   23205946..23206098,23206290..23206631)
FT                   /codon_start=1
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /product="SH2 domain protein 2A, isoform CRA_a"
FT                   /note="gene_id=mCG3076.1 transcript_id=mCT1903.1
FT                   protein_id=mCP22845.1 isoform=CRA_a"
FT                   /protein_id="EDL15344.1"
FT                   /translation="MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSM
FT                   QVMKEQGVQLSPRTNHTVVSASAPGTAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQ
FT                   AHWLLLKTAPLWFHGFITRREAERLLQPQPLGCYLVRFSESAVTFVLSYRSQTCCRHFL
FT                   LAQLGDGRHVVLGEDSAHAQLQDLLEHYTECPLSPYGEILTQPLARQTAEPAGLSLRAD
FT                   SDSGSKRQDPDTQLSLLLQQGQAQASGHTEKVWASQQKATSQASRPRPPIPAKPQLPPE
FT                   VYTSPASRLHQAPPINPIYQEPDEPIAFYAMGRGSPGDAPSNIYAEVEGPSGTAPIGHP
FT                   ILRKCWSRPISRGQVREVQGKISSRSRAERGSPS"
FT   CDS             join(23201297..23201330,23201860..23202014,
FT                   23202581..23202762,23203286..23203375,23203534..23203702,
FT                   23205946..23206074,23206290..>23206323)
FT                   /codon_start=1
FT                   /gene="Sh2d2a"
FT                   /locus_tag="mCG_3076"
FT                   /product="SH2 domain protein 2A, isoform CRA_b"
FT                   /note="gene_id=mCG3076.1 transcript_id=mCT181531.0
FT                   protein_id=mCP104453.0 isoform=CRA_b"
FT                   /protein_id="EDL15345.1"
FT                   /translation="MEFCLAQPCPQGNHEATSSTFNTFQPMNLTQGRCQNLSCGSRPSM
FT                   QVMKEQGVQLSPRTNHTVVSASAPGTAWVLGNADRAEEVPGKGDLSLQAETRAWVQKTQ
FT                   AHWLLLKTAPLWFHGFITRREAERLLQPQPLGCYLVRFSESAVTFVLSYRSQTCCRHFL
FT                   LAQLGDGRHVVLGEDSAHAQLQDLLEHYTECPLSPYGEILTQPLARQTAEPAGLSLRAD
FT                   SDSGSKRQDPDTQLSLLLQQGQAQASGHTEKTSQASRPRPPI"
FT   gene            complement(23213142..23239969)
FT                   /gene="Prcc"
FT                   /locus_tag="mCG_3086"
FT                   /note="gene_id=mCG3086.1"
FT   mRNA            complement(join(23213142..23213573,23214373..23214438,
FT                   23216358..23216501,23221959..23222054,23224231..23224797,
FT                   23226868..23226915,23239264..23239969))
FT                   /gene="Prcc"
FT                   /locus_tag="mCG_3086"
FT                   /product="papillary renal cell carcinoma
FT                   (translocation-associated)"
FT                   /note="gene_id=mCG3086.1 transcript_id=mCT1891.1 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(23213487..23213573,23214373..23214438,
FT                   23216358..23216501,23221959..23222054,23224231..23224797,
FT                   23226868..23226915,23239264..23239731))
FT                   /codon_start=1
FT                   /gene="Prcc"
FT                   /locus_tag="mCG_3086"
FT                   /product="papillary renal cell carcinoma
FT                   (translocation-associated)"
FT                   /note="gene_id=mCG3086.1 transcript_id=mCT1891.1
FT                   protein_id=mCP22838.2"
FT                   /db_xref="GOA:Q9EQC8"
FT                   /db_xref="InterPro:IPR018800"
FT                   /db_xref="MGI:MGI:2137738"
FT                   /db_xref="UniProtKB/TrEMBL:Q9EQC8"
FT                   /protein_id="EDL15343.1"
FT                   /translation="MSLVAYASSDDSEPDEPEPEPEPEEEDVAAPMPGPTLGGLFASLP
FT                   APKGPALLPPPPQMLAPAFPPPLLLPPPTGDPRLQPPPPLPFGLGGFPPPAGVSPAEAA
FT                   GVGEGLGLPSPQGPGLSLPPAVGGVGPPLGLPKPKKRTEPVRIAAPELQKGDSDSEEDE
FT                   PAKKKVVLQGSGEGTGLSALLPQPKNLTVKETNRLLLPHAFSRKPSDISSDAKPSRLAS
FT                   KTKPASLAPVLGTTTTTPSPSAIKAAAKSAALQVTKQITQEDDDSDEEVAPENFFSLPD
FT                   KAEPPGVEPYPYPVPTVPEELPPGTEPEPAFQDDAANAPLEFKMAAGSSGAPWMPKPGD
FT                   DYSYNQFSTYGDANAAGAYYQDYYSGGYYPAPDPALVPPQEIAPDASFIDDEAFKRLQG
FT                   KRNRGREEINFVEIKGDDQLSGAQQWMTKSLTEEKTMKSFSKKKGEQPTGQQRRKHQIT
FT                   YLIHQAKERELELKNTWSENKLSRRQTQAKYGF"
FT   gene            23259922..23269659
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /note="gene_id=mCG3084.3"
FT   mRNA            join(23259922..23260107,23260208..23260317,
FT                   23266697..23266773,23266919..23267057,23267658..23267843,
FT                   23268079..23268296,23268508..23269272)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT185422"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185422.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(23259954..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23268538,23269391..23269659)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT185420"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185420.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(23259968..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23269301)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT1900"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT1900.2 created on
FT                   12-JUN-2003"
FT   CDS             join(23260231..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_b"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185420.0
FT                   protein_id=mCP106678.0 isoform=CRA_b"
FT                   /protein_id="EDL15338.1"
FT                   /translation="MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKY
FT                   QVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQ
FT                   KKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLE
FT                   DSPKRPKESGDHEEEDKEIAALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAA
FT                   KEEAEAQGVRDHESL"
FT   CDS             join(23260231..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_b"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT1900.2
FT                   protein_id=mCP22852.2 isoform=CRA_b"
FT                   /protein_id="EDL15341.1"
FT                   /translation="MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKY
FT                   QVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQ
FT                   KKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLE
FT                   DSPKRPKESGDHEEEDKEIAALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAA
FT                   KEEAEAQGVRDHESL"
FT   CDS             join(23260231..23260317,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_b"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185422.0
FT                   protein_id=mCP106680.0 isoform=CRA_b"
FT                   /protein_id="EDL15342.1"
FT                   /translation="MSRSNRQKEYKCGDLVFAKMKGYPHWPARIDEMPEAAVKSTANKY
FT                   QVFFFGTHETAFLGPKDLFPYEESKEKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQ
FT                   KKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVIDEPAKEKNEKGTLKRRAGDVLE
FT                   DSPKRPKESGDHEEEDKEIAALEGERPLPVEVEKNSTPSEPDSGQGPPAEEEEGEEEAA
FT                   KEEAEAQGVRDHESL"
FT   mRNA            join(23260450..23260768,23266697..23266773,
FT                   23266919..23267057,23267447..23267516,23267658..23267843,
FT                   23268079..23268296,23268508..23269294)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT185423"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185423.0 created
FT                   on 12-JUN-2003"
FT   mRNA            join(23260482..23260768,23266697..23266773,
FT                   23266919..23267057,23267658..23267843,23268079..23268296,
FT                   23268508..23269294)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT181530"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT181530.1 created
FT                   on 12-JUN-2003"
FT   CDS             join(23266706..23266773,23266919..23267057,
FT                   23267658..23267843,23268079..23268296,23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_a"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT181530.1
FT                   protein_id=mCP104452.1 isoform=CRA_a"
FT                   /protein_id="EDL15337.1"
FT                   /translation="MPEAAVKSTANKYQVFFFGTHETAFLGPKDLFPYEESKEKFGKPN
FT                   KRKGFSEGLWEIENNPTVKASGYQSSQKKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEE
FT                   GKLVIDEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDKEIAALEGERPLPVEV
FT                   EKNSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHESL"
FT   CDS             join(23266767..23266773,23266919..23267057,
FT                   23267447..23267516,23267658..23267843,23268079..23268296,
FT                   23268508..23268514)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_d"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185423.0
FT                   protein_id=mCP106681.0 isoform=CRA_d"
FT                   /protein_id="EDL15340.1"
FT                   /translation="MRRHSWAPKTSSLMRNPRRSLASPTRGKGSARGCGRSRTTLQSRP
FT                   LATSPPPSCTEPCLPGLWVNPRANPTESSQKKSCAAEPEVEPEAHEGDGDKKGSAEGSS
FT                   DEEGKLVIDEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDKEIAALEGERPLP
FT                   VEVEKNSTPSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHESL"
FT   mRNA            join(23267567..23267843,23268079..23268383)
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, transcript
FT                   variant mCT185421"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185421.0 created
FT                   on 12-JUN-2003"
FT   CDS             join(23267643..23267843,23268079..23268300)
FT                   /codon_start=1
FT                   /gene="Hdgf"
FT                   /locus_tag="mCG_3084"
FT                   /product="hepatoma-derived growth factor, isoform CRA_c"
FT                   /note="gene_id=mCG3084.3 transcript_id=mCT185421.0
FT                   protein_id=mCP106679.0 isoform=CRA_c"
FT                   /protein_id="EDL15339.1"
FT                   /translation="MSPPQSSQKKSCAAEPEVEPEAHEGDGDKKGSAEGSSDEEGKLVI
FT                   DEPAKEKNEKGTLKRRAGDVLEDSPKRPKESGDHEEEDKEIAALEGERPLPVEVEKNST
FT                   PSEPDSGQGPPAEEEEGEEEAAKEEAEAQGVRDHER"
FT   gene            23273105..23277601
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /note="gene_id=mCG3097.1"
FT   mRNA            join(23273105..23273300,23275749..23275980,
FT                   23276063..23276158,23276320..23276483,23276867..23276997,
FT                   23277142..23277601)
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, transcript
FT                   variant mCT1888"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT1888.1 created on
FT                   26-MAR-2003"
FT   mRNA            join(23273138..23273300,23275749..23275980,
FT                   23276063..23276158,23276320..23276423,23276867..23276997,
FT                   23277142..23277596)
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, transcript
FT                   variant mCT181527"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181527.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(23273140..23273246,23275749..23275980,
FT                   23276063..23276158,23276320..23276423,23276867..23276997,
FT                   23277142..23277365)
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, transcript
FT                   variant mCT181529"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181529.0 created
FT                   on 26-MAR-2003"
FT   mRNA            join(23273292..23273423,23275749..23275980,
FT                   23276063..23276158,23276320..23276423,23276867..23276997,
FT                   23277142..23277594)
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, transcript
FT                   variant mCT181528"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181528.0 created
FT                   on 26-MAR-2003"
FT   CDS             join(23275798..23275980,23276063..23276158,
FT                   23276320..23276483,23276867..23276997,23277142..23277278)
FT                   /codon_start=1
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT1888.1
FT                   protein_id=mCP22819.1 isoform=CRA_b"
FT                   /protein_id="EDL15335.1"
FT                   /translation="MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVV
FT                   VEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDH
FT                   RGTMIASEAPLLHHQVKLVDPVDRQAQGPLVKGLLTLESSDRVGKPTEIQWRFTEAGER
FT                   VRVSTRSGRIIPKPEFPRADGIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAM
FT                   GIQETRRFKKVYWY"
FT   CDS             join(23275798..23275980,23276063..23276158,
FT                   23276320..23276423,23276867..23276997,23277142..23277278)
FT                   /codon_start=1
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181527.0
FT                   protein_id=mCP104450.0 isoform=CRA_a"
FT                   /protein_id="EDL15333.1"
FT                   /translation="MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVV
FT                   VEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDH
FT                   RGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRAD
FT                   GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY"
FT   CDS             join(23275798..23275980,23276063..23276158,
FT                   23276320..23276423,23276867..23276997,23277142..23277278)
FT                   /codon_start=1
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181529.0
FT                   protein_id=mCP104449.0 isoform=CRA_a"
FT                   /protein_id="EDL15334.1"
FT                   /translation="MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVV
FT                   VEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDH
FT                   RGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRAD
FT                   GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY"
FT   CDS             join(23275798..23275980,23276063..23276158,
FT                   23276320..23276423,23276867..23276997,23277142..23277278)
FT                   /codon_start=1
FT                   /gene="Mrpl24"
FT                   /locus_tag="mCG_3097"
FT                   /product="mitochondrial ribosomal protein L24, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG3097.1 transcript_id=mCT181528.0
FT                   protein_id=mCP104451.0 isoform=CRA_a"
FT                   /protein_id="EDL15336.1"
FT                   /translation="MRLSALLALASKATSSPFYRYGMSRPGSIADKRKNPPWSRRRPVV
FT                   VEPISDEDWHLFCGDMVEILEGKDAGKQGKVVQVVRQRNWVVLEGLNTHYRYIGRTKDH
FT                   RGTMIASEAPLLHHQVKLVDPVDRKPTEIQWRFTEAGERVRVSTRSGRIIPKPEFPRAD
FT                   GIVPETWTDGPKDTSVEDALERTYVPRLKTLEEDVMEAMGIQETRRFKKVYWY"
FT   gene            complement(23276855..23283861)
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /note="gene_id=mCG3080.2"
FT   mRNA            complement(join(23276855..23277844,23278276..23279363,
FT                   23280445..23280588,23280769..23280831,23281277..23281469,
FT                   23281638..23281762,23283570..>23283841))
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, transcript variant
FT                   mCT190991"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT190991.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23277577..23277844,23278276..23278460,
FT                   23278879..23279363,23280445..23280588,23280769..23280831,
FT                   23281277..23281469,23281638..23281762,23283570..23283861))
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, transcript variant
FT                   mCT1898"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT1898.2 created on
FT                   13-DEC-2002"
FT   mRNA            complement(join(23277593..23277844,23278276..23278460,
FT                   23278874..23279363,23280445..23280588,23280769..23280831,
FT                   23281277..23281429,23281638..23281972))
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, transcript variant
FT                   mCT177228"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT177228.0 created
FT                   on 13-DEC-2002"
FT   mRNA            complement(join(23277595..23279363,23280445..23280588,
FT                   23280769..23280831,23281277..23281762,23283570..>23283860))
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, transcript variant
FT                   mCT190992"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT190992.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(23277723..23277844,23278276..23278460,
FT                   23278879..23279363,23280445..23280588,23280769..23280831,
FT                   23281277..23281469,23281638..23281762,23283570..23283680))
FT                   /codon_start=1
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, isoform CRA_b"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT1898.2
FT                   protein_id=mCP22830.3 isoform=CRA_b"
FT                   /db_xref="GOA:G3X8Q8"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="MGI:MGI:2387197"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Q8"
FT                   /protein_id="EDL15330.1"
FT                   /translation="MRGVSAHGLSHEERRQLAVDLTRVLAHYRSILDAYIIEFFTDSLW
FT                   GTLPHSWQEALDGLNPPQLATLLLGMPRDGEEMRYRSVWPLTLLALKSTACALAFTRTP
FT                   GFHTPSEFLENPSQSSRLTAPFRKHVKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSG
FT                   QGHLSRFMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRP
FT                   HHVVQWVSPTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALA
FT                   SVGCCYMKLSDPGSYPLSQWIAGLPGHELPYRLREGACHALEDYAERLHKAEPGLQTHC
FT                   FRAALETVIRQVCPELRRPGVQGIPRVHELKIEEYVKQGLKRVGLDPQLPLDLAALQAH
FT                   QAQENRVVAFFSLALLLAPLVETLILLDRMLYLQEQGFYAELLPIFSPELSPRNLVLVA
FT                   TKTPLGQAFSTLETEDN"
FT   CDS             complement(join(23278875..23279363,23280445..23280588,
FT                   23280769..23280831,23281277..23281469,23281638..23281762,
FT                   23283570..>23283839))
FT                   /codon_start=1
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, isoform CRA_c"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT190991.0
FT                   protein_id=mCP111948.0 isoform=CRA_c"
FT                   /protein_id="EDL15331.1"
FT                   /translation="GRDRPERCRRAGSEFLLCVGRAELSPVWVAWFRGTDLVSPHLLPP
FT                   CTDISRHRMRGVSAHGLSHEERRQLAVDLTRVLAHYRSILDAYIIEFFTDSLWGTLPHS
FT                   WQEALDGLNPPQLATLLLGMPRDGEEMRYRSVWPLTLLALKSTACALAFTRTPGFHTPS
FT                   EFLENPSQSSRLTAPFRKHVKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSR
FT                   FMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQW
FT                   VSPTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCY
FT                   MKLSDPGSYPLSQWIAGLPGHELPYRLREGACHALEDYAERLHKAEPGLQTHCFRAALE
FT                   TVIRQVCPELRRPGVQGIPRVHELKIEE"
FT   CDS             complement(join(23278875..23279363,23280445..23280588,
FT                   23280769..23280831,23281277..23281429,23281638..23281721))
FT                   /codon_start=1
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, isoform CRA_a"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT177228.0
FT                   protein_id=mCP100150.0 isoform=CRA_a"
FT                   /protein_id="EDL15329.1"
FT                   /translation="MARSTGWTEPTTAGHPAAGDAEGRGGNESTACALAFTRTPGFHTP
FT                   SEFLENPSQSSRLTAPFRKHVKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLS
FT                   RFMSLGLGLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQ
FT                   WVSPTTLCEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCC
FT                   YMKLSDPGSYPLSQWIAGLPGHELPYRLREGACHALEDYAERLHKAEPGLQTHCFRAAL
FT                   ETVIRQVCPELRRPGVQGIPRVHELKIEE"
FT   CDS             complement(join(23278875..23279363,23280445..23280588,
FT                   23280769..23280831,23281277..>23281492))
FT                   /codon_start=1
FT                   /gene="BC023814"
FT                   /locus_tag="mCG_3080"
FT                   /product="cDNA sequence BC023814, isoform CRA_d"
FT                   /note="gene_id=mCG3080.2 transcript_id=mCT190992.0
FT                   protein_id=mCP111949.0 isoform=CRA_d"
FT                   /protein_id="EDL15332.1"
FT                   /translation="QPGLDYLRYRSVWPLTLLALKSTACALAFTRTPGFHTPSEFLENP
FT                   SQSSRLTAPFRKHVKPKKQHEIRRLGELVKKLSDLTGCTQVVDVGSGQGHLSRFMSLGL
FT                   GLMVKSLEGNQRLVKRAQHLDQELLKALDKMEKRHPKMVQRGPRHRPHHVVQWVSPTTL
FT                   CEELLLPLERPGQSSARLLLTGLHACGDLSVALLRHFCCCPEVVALASVGCCYMKLSDP
FT                   GSYPLSQWIAGLPGHELPYRLREGACHALEDYAERLHKAEPGLQTHCFRAALETVIRQV
FT                   CPELRRPGVQGIPRVHELKIEE"
FT   gene            23285162..23293434
FT                   /gene="Isg20l2"
FT                   /locus_tag="mCG_3091"
FT                   /note="gene_id=mCG3091.2"
FT   mRNA            join(23285162..23285991,23292290..23292490,
FT                   23292954..23293434)
FT                   /gene="Isg20l2"
FT                   /locus_tag="mCG_3091"
FT                   /product="interferon stimulated exonuclease gene 20-like 2"
FT                   /note="gene_id=mCG3091.2 transcript_id=mCT1890.2 created on
FT                   31-OCT-2002"
FT   CDS             join(23285419..23285991,23292290..23292490,
FT                   23292954..23293067)
FT                   /codon_start=1
FT                   /gene="Isg20l2"
FT                   /locus_tag="mCG_3091"
FT                   /product="interferon stimulated exonuclease gene 20-like 2"
FT                   /note="gene_id=mCG3091.2 transcript_id=mCT1890.2
FT                   protein_id=mCP22808.2"
FT                   /protein_id="EDL15328.1"
FT                   /translation="MPKEEKEAAASKRDSERSKDKKAPLSWLTPAPSKKTASVVSKIDL
FT                   LGEFQSALPKTKSTQKKGSKKKSLKKKIATENSTQAQSKDKGSKKKPLKKNAVPNSTQA
FT                   RSEDKCPTVPQNLPGKMVAIDCEMVGTGPKGRVSSLARCSIVNYNGDVLYDEYVLPPCY
FT                   IVNYRTRWSGIRKCHMVNATPFKTARSQILKILSGKVVIGHAIHNDYKALQYFHPKSLT
FT                   RDTSRIPLLNRKADCPENVTLSLKHLTKKLLSRDIQVGNTGHSSVEDAQATMELYKLVE
FT                   VEWEQHLAQNPPEN"
FT   gene            23302403..23307095
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /note="gene_id=mCG3092.1"
FT   mRNA            join(23302403..23302625,23305837..23306015,
FT                   23306200..23306316,23306709..23307095)
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /product="cellular retinoic acid binding protein II,
FT                   transcript variant mCT1884"
FT                   /note="gene_id=mCG3092.1 transcript_id=mCT1884.1 created on
FT                   09-APR-2003"
FT   mRNA            join(<23302426..23302625,23306202..23306316,
FT                   23306709..23307094)
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /product="cellular retinoic acid binding protein II,
FT                   transcript variant mCT181525"
FT                   /note="gene_id=mCG3092.1 transcript_id=mCT181525.0 created
FT                   on 09-APR-2003"
FT   CDS             join(23302556..23302625,23305837..23306015,
FT                   23306200..23306316,23306709..23306759)
FT                   /codon_start=1
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /product="cellular retinoic acid binding protein II,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG3092.1 transcript_id=mCT1884.1
FT                   protein_id=mCP22829.1 isoform=CRA_a"
FT                   /protein_id="EDL15326.1"
FT                   /translation="MPNFSGNWKIIRSENFEEMLKALGVNMMMRKIAVAAASKPAVEIK
FT                   QENDTFYIKTSTTVRTTEINFKIGEEFEEQTVDGRPCKSLVKWESGNKMVCEQRLLKGE
FT                   GPKTSWSRELTNDGELILTMTADDVVCTRVYVRE"
FT   CDS             <23306726..23307040
FT                   /codon_start=1
FT                   /gene="Crabp2"
FT                   /locus_tag="mCG_3092"
FT                   /product="cellular retinoic acid binding protein II,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG3092.1 transcript_id=mCT181525.0
FT                   protein_id=mCP104447.0 isoform=CRA_b"
FT                   /protein_id="EDL15327.1"
FT                   /translation="RCVHQGLRPRVSAYGSKNCLRRLLCPLQDTNLPPTSILQTSSPLT
FT                   PEGYCFLQGLLFFAFSTPERGRSSEPSHRHLPLPGQQSQLHTRVLPGRDCLSGLYSLSL
FT                   "
FT   gene            <23324804..23334162
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /note="gene_id=mCG8845.2"
FT   mRNA            join(<23324804..23325699,23326703..23326827,
FT                   23328513..23328586,23329132..23334162)
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /product="nestin, transcript variant mCT190960"
FT                   /note="gene_id=mCG8845.2 transcript_id=mCT190960.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(23324840..23325699,23326703..23326827,
FT                   23328513..23328586,23329132..23330401,23330534..23334160)
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /product="nestin, transcript variant mCT9439"
FT                   /note="gene_id=mCG8845.2 transcript_id=mCT9439.2 created on
FT                   13-AUG-2002"
FT   CDS             join(<23324845..23325699,23326703..23326827,
FT                   23328513..23328586,23329132..23333741)
FT                   /codon_start=1
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /product="nestin, isoform CRA_a"
FT                   /note="gene_id=mCG8845.2 transcript_id=mCT190960.0
FT                   protein_id=mCP111928.0 isoform=CRA_a"
FT                   /protein_id="EDL15324.1"
FT                   /translation="KLQGPLPSLVLHVRLPSGGQTSDMEGCVGEESFQMWELNRRLEAY
FT                   LTRVKTLEEQNQLLSAELGGLRAQSGDASWRARADDELAALRVLVDQRWREKHEAEVQR
FT                   DNLAEELESVAGRCQQVRLARERTIEEAACSRRALEAEKNARGWLSTQAAELERELEAL
FT                   RASHEEERAHLNAQAACTPRRPPAPAHASPIRAPEVEELARRLGEVWRGAVRDYQERVA
FT                   HMESSLGQARERLGQAVRGARESRLEVQQLQADRDSLQERREALEQRLEGRWQDRLQAT
FT                   EKFQLAVEALEQEKQGLQSQIAQILEGGQQLAHLKMSLSLEVATYRTLLEAENSRLQTP
FT                   GRSSQASLGFPDPKLKLHFLGIPEDQHLGSVLPVLSPTSFSSPLPNTLETPVTAFLKTQ
FT                   EFLKARTPTLASTPIPPMSEAPYPKNAEVRAQDVPHSLLQGGRQQAPEPLWAEATVPSS
FT                   TGVLPELEEPGGEQPDHFPDDPSSLAPPLNPHHSILEAKDRESSESRVSSIFQEEEGQI
FT                   WELVKKEAATEVKVENSLAQEIQESGLDTEEIQDSQGPLQKETLEALGDEPLMSLKTQN
FT                   HETPGKENCNSSIEENSGTVKSPEKEKQTPLKSLEEKNVEAEKTLENGVLELSKPLGEE
FT                   EPRMEDQELMSPEHTLETVSFLGKENQEVVRSSEEQNLESLITFKEESQYPLGGPEAED
FT                   QMLERLVEKEDQRFPRSPEEDQQAFRPLEKENQEPLRFEEAEDQVLERLIEKERQESLK
FT                   SPEEEDQQAFRLLEKENQEPLRFEDAEDQVLERLIEKERQESLKSPEEEDQQAFRLLEK
FT                   ENQEPLRFEEAEDQVLERLVEKESQESLKSPEEEDQRTGKPLEKENQESLRSLDENQET
FT                   IVLLESKNQRPLRSLEVEEEEQRIVKPLEKVSQVSLESLEKENVQSPRYLEDDDHMIKS
FT                   LLEDKTHEILGSLEDRNGENFIPPENETQGSLRPPEEEDQRIVNHLEKESQEFLRSPEA
FT                   EEEEEQVMVRSLEGENHDPLSSVVKEEQMAESKLENESQDSGKSLEDESQETFGSLEKE
FT                   NLESLRSLAGQDQEEQKLEQETQQPLRAVEDEQMTVNPPEKVDPELPKPLRNDQEVVRS
FT                   LDKENQESLVSLNEGGMETVKSSETENIESLETVGECLGRRKSVDTQEPLWSTEVTSET
FT                   IEPLEDETQEPLGCVDENQEVLTPLERESQELRSLGKWNPETVESPGGVEDSQQCLEVE
FT                   EGPEREQHQESLRSLGEVEWELPGSGSQQRWEDVVEDGEGQEASLGATGVETEDKAELH
FT                   LRGQGGEEKAVEEGELLQDAVGEAWSLGSSEPKEQRVPAEPLDDLEGQPEQTGTLEVPV
FT                   AQGMPEATEQDEDRAQAGEQDSVEVTLGLEAARAGLELEQEVVGLEDPRHFAREEAIHP
FT                   SLGEESVKAKIDQGLEEPGKEPKEAGALDSGIPELPKTSSETLECKGWEESGEGWGEEE
FT                   ASLETSDHEGSHAPQPRPPKTEEDEGLQAALTVPGPKLLEPCSPIPILTDAHELQPQAE
FT                   GIQEAGWQPEAGTEALGRVEDEPEFGRGEIPEGLQDWEEGREDSEADELGETLPDSTPL
FT                   GLYLKSPASPKWEQAGEQRLFPQGEARKEGWSPAVLAAQGLSDPPEEEQQGHDSDLSSE
FT                   EFEDLGTEASLLPGVPKEVSDHLGQEPPVLQPACWDQGGESDGFADEEESGEEGEEEDA
FT                   DEEEGAESGAQWWGPGPSGGGVKVQDVTQRGDLEHESVGDSGLWDDGLSGAAANVLVTA
FT                   LETVSQDSAEPSGSEGSESASLEGEEGQAIDHLDAPQEVTSVVPGAGDTFDISGQGPNL
FT                   ESEQVNGRMENGLEQAEGQVVLHGDEDQDIPLQEQGTLKAPLVGSPVHLGPSQPLKFTL
FT                   SGVDGDSWSSGED"
FT   CDS             join(23324914..23325699,23326703..23326827,
FT                   23328513..23328586,23329132..23330401,23330534..23333741)
FT                   /codon_start=1
FT                   /gene="Nes"
FT                   /locus_tag="mCG_8845"
FT                   /product="nestin, isoform CRA_b"
FT                   /note="gene_id=mCG8845.2 transcript_id=mCT9439.2
FT                   protein_id=mCP22843.2 isoform=CRA_b"
FT                   /protein_id="EDL15325.1"
FT                   /translation="MEGCVGEESFQMWELNRRLEAYLTRVKTLEEQNQLLSAELGGLRA
FT                   QSGDASWRARADDELAALRVLVDQRWREKHEAEVQRDNLAEELESVAGRCQQVRLARER
FT                   TIEEAACSRRALEAEKNARGWLSTQAAELERELEALRASHEEERAHLNAQAACTPRRPP
FT                   APAHASPIRAPEVEELARRLGEVWRGAVRDYQERVAHMESSLGQARERLGQAVRGARES
FT                   RLEVQQLQADRDSLQERREALEQRLEGRWQDRLQATEKFQLAVEALEQEKQGLQSQIAQ
FT                   ILEGGQQLAHLKMSLSLEVATYRTLLEAENSRLQTPGRSSQASLGFPDPKLKLHFLGIP
FT                   EDQHLGSVLPVLSPTSFSSPLPNTLETPVTAFLKTQEFLKARTPTLASTPIPPMSEAPY
FT                   PKNAEVRAQDVPHSLLQGGRQQAPEPLWAEATVPSSTGVLPELEEPGGEQPDHFPDDPS
FT                   SLAPPLNPHHSILEAKDRESSESRVSSIFQEEEGQIWELVKKEAATEVKVENSLAQEIQ
FT                   ESGLDTEEIQDSQGPLQKETLEALGDEPLMSLKTQNHETPGKENCNSSIEENSGTVKSP
FT                   EKEKQTPLKSLEEKNVEAEKTLENGVLELSKPLGEEEPRMEDQELMSPEHTLETVSFLG
FT                   KENQEVVRSSEEQNLESLITFKEESQYPLGGPEAEDQMLERLVEKEDQRFPRSPEEDQQ
FT                   AFRPLEKENQEPLRFEEAEDQVLERLIEKERQESLKSPEEEDQQAFRLLEKENQEPLRF
FT                   EEAEDQVLERLVEKESQESLKSPEEEDQRTGKPLEKENQESLRSLDENQETIVLLESKN
FT                   QRPLRSLEVEEEEQRIVKPLEKVSQVSLESLEKENVQSPRYLEDDDHMIKSLLEDKTHE
FT                   ILGSLEDRNGENFIPPENETQGSLRPPEEEDQRIVNHLEKESQEFLRSPEAEEEEEQVM
FT                   VRSLEGENHDPLSSVVKEEQMAESKLENESQDSGKSLEDESQETFGSLEKENLESLRSL
FT                   AGQDQEEQKLEQETQQPLRAVEDEQMTVNPPEKVDPELPKPLRNDQEVVRSLDKENQES
FT                   LVSLNEGGMETVKSSETENIESLETVGECLGRRKSVDTQEPLWSTEVTSETIEPLEDET
FT                   QEPLGCVDENQEVLTPLERESQELRSLGKWNPETVESPGGVEDSQQCLEVEEGPEREQH
FT                   QESLRSLGEVEWELPGSGSQQRWEDVVEDGEGQEASLGATGVETEDKAELHLRGQGGEE
FT                   KAVEEGELLQDAVGEAWSLGSSEPKEQRVPAEPLDDLEGQPEQTGTLEVPVAQGMPEAT
FT                   EQDEDRAQAGEQDSVEVTLGLEAARAGLELEQEVVGLEDPRHFAREEAIHPSLGEESVK
FT                   AKIDQGLEEPGKEPKEAGALDSGIPELPKTSSETLECKGWEESGEGWGEEEASLETSDH
FT                   EGSHAPQPRPPKTEEDEGLQAALTVPGPKLLEPCSPIPILTDAHELQPQAEGIQEAGWQ
FT                   PEAGTEALGRVEDEPEFGRGEIPEGLQDWEEGREDSEADELGETLPDSTPLGLYLKSPA
FT                   SPKWEQAGEQRLFPQGEARKEGWSPAVLAAQGLSDPPEEEQQGHDSDLSSEEFEDLGTE
FT                   ASLLPGVPKEVSDHLGQEPPVLQPACWDQGGESDGFADEEESGEEGEEEDADEEEGAES
FT                   GAQWWGPGPSGGGVKVQDVTQRGDLEHESVGDSGLWDDGLSGAAANVLVTALETVSQDS
FT                   AEPSGSEGSESASLEGEEGQAIDHLDAPQEVTSVVPGAGDTFDISGQGPNLESEQVNGR
FT                   MENGLEQAEGQVVLHGDEDQDIPLQEQGTLKAPLVGSPVHLGPSQPLKFTLSGVDGDSW
FT                   SSGED"
FT   gene            complement(23341228..23353924)
FT                   /gene="Bcan"
FT                   /locus_tag="mCG_8847"
FT                   /note="gene_id=mCG8847.1"
FT   mRNA            complement(join(23341228..23341664,23341969..23342159,
FT                   23342390..23342534,23342865..23342947,23343834..23343992,
FT                   23344369..23344476,23346749..23347336,23347806..23348027,
FT                   23349104..23349397,23349812..23349939,23350233..23350407,
FT                   23350679..23351050,23351439..23351549,23353797..23353924))
FT                   /gene="Bcan"
FT                   /locus_tag="mCG_8847"
FT                   /product="brevican"
FT                   /note="gene_id=mCG8847.1 transcript_id=mCT9441.1 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(23341569..23341664,23341969..23342159,
FT                   23342390..23342534,23342865..23342947,23343834..23343992,
FT                   23344369..23344476,23346749..23347336,23347806..23348027,
FT                   23349104..23349397,23349812..23349939,23350233..23350407,
FT                   23350679..23351050,23351439..23351529))
FT                   /codon_start=1
FT                   /gene="Bcan"
FT                   /locus_tag="mCG_8847"
FT                   /product="brevican"
FT                   /note="gene_id=mCG8847.1 transcript_id=mCT9441.1
FT                   protein_id=mCP22844.2"
FT                   /db_xref="GOA:Q61361"
FT                   /db_xref="InterPro:IPR000436"
FT                   /db_xref="InterPro:IPR000538"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001304"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003596"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR018378"
FT                   /db_xref="MGI:MGI:1096385"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q61361"
FT                   /protein_id="EDL15323.1"
FT                   /translation="MIPLLLSLLAALVLTQAPAALADDLKEDSSEDRAFRVRIGATQLR
FT                   GVLGGALAIPCHVHHLRPPHSRRAAPGFPRVKWTFLSGDREVEVLVARGLRVKVNEAYR
FT                   FRVALPAYPASLTDVSLVLSELRPNDSGVYRCEVQHGIDDSSDAVEVKVKGVVFLYREG
FT                   SARYAFSFAGAQEACARIGARIATPEQLYAAYLGGYEQCDAGWLSDQTVRYPIQNPREA
FT                   CSGDMDGYPGVRNYGVVGPDDLYDVYCYAEDLNGELFLGAPPSKLTWEEARDYCLERGA
FT                   QIASTGQLYAAWNGGLDRCSPGWLADGSVRYPIITPSQRCGGGLPGVKTLFLFPNQTGF
FT                   PSKQNRFNVYCFRDSAHPSASSEASSPASDGLEAIVTVTEKLEELQLPQEAMESESRGA
FT                   IYSIPISEDGGGGSSTPEDPAEAPRTPLESETQSIAPPTESSEEEGVALEEEERFKDLE
FT                   ALEEEKEQEDLWVWPRELSSPLPTGSETEHSLSQVSPPAQAVLQLGASPSPGPPRVRGP
FT                   PAETLLPPREGSPTSTPGGAREVGGETGSPELSGVPRESEEAGSSSLEDGPSLLPATWA
FT                   PVGPRELETPSEEKSGRTVLAGTSVQAQPVLPTDSASHGGVAVAPSSGDCIPSPCHNGG
FT                   TCLEEKEGFRCLCLPGYGGDLCDVGLHFCSPGWEAFQGACYKHFSTRRSWEEAESQCRA
FT                   LGAHLTSICTPEEQDFVNDRYREYQWIGLNDRTIEGDFLWSDGAPLLYENWNPGQPDSY
FT                   FLSGENCVVMVWHDQGQWSDVPCNYHLSYTCKMGLVSCGPPPQLPLAQIFGRPRLRYAV
FT                   DTVLRYRCRDGLAQRNLPLIRCQENGLWEAPQISCVPRRPGRALRSMDAPEGPRGQLSR
FT                   HRKAPLTPPSSL"
FT   gene            complement(23377572..>23383093)
FT                   /gene="Hapln2"
FT                   /locus_tag="mCG_8827"
FT                   /note="gene_id=mCG8827.3"
FT   mRNA            complement(join(23377572..23378334,23378730..23378912,
FT                   23379033..23379149,23379274..23379627,23379839..23379980,
FT                   23382395..23382450,23382895..23383092))
FT                   /gene="Hapln2"
FT                   /locus_tag="mCG_8827"
FT                   /product="hyaluronan and proteoglycan link protein 2,
FT                   transcript variant mCT9421"
FT                   /note="gene_id=mCG8827.3 transcript_id=mCT9421.2 created on
FT                   13-AUG-2002"
FT   CDS             complement(join(23378051..23378334,23378730..23378912,
FT                   23379033..23379149,23379274..23379627,23379839..23379926))
FT                   /codon_start=1
FT                   /gene="Hapln2"
FT                   /locus_tag="mCG_8827"
FT                   /product="hyaluronan and proteoglycan link protein 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG8827.3 transcript_id=mCT9421.2
FT                   protein_id=mCP22832.2 isoform=CRA_b"
FT                   /db_xref="GOA:B2RRU7"
FT                   /db_xref="InterPro:IPR000538"
FT                   /db_xref="InterPro:IPR003596"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013106"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016186"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="MGI:MGI:2137300"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRU7"
FT                   /protein_id="EDL15322.1"
FT                   /translation="MPSRIPLPAFCCFLLPWAFTSFHKALGNPAPHPGPHYLLPPIHEV
FT                   IHSRRGATATLPCVLGTSPPSYKVRWSKVEPGELRETLILITNGLHARDYGLLGGRASL
FT                   RRGHRLDASLIIKNVRLEDEGRYRCELINGIEDESVALTLRLEGVVFPYQPSRGRYQFN
FT                   YFEAKRACEEQDGRLATYGQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGHGRP
FT                   GIRSYGPRDRSRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYA
FT                   AWKFSGLDQCDGGWLADGSVRFPITTPRPRCGGLPDPGVRSFGFPRPQQASYGTYCYAE
FT                   K"
FT   mRNA            complement(join(<23378154..23378334,23378730..23378912,
FT                   23379033..23379149,23379274..23379980,23382395..23382450,
FT                   23382895..>23383093))
FT                   /gene="Hapln2"
FT                   /locus_tag="mCG_8827"
FT                   /product="hyaluronan and proteoglycan link protein 2,
FT                   transcript variant mCT190956"
FT                   /note="gene_id=mCG8827.3 transcript_id=mCT190956.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(<23378154..23378334,23378730..23378912,
FT                   23379033..23379149,23379274..>23379715))
FT                   /codon_start=1
FT                   /gene="Hapln2"
FT                   /locus_tag="mCG_8827"
FT                   /product="hyaluronan and proteoglycan link protein 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG8827.3 transcript_id=mCT190956.0
FT                   protein_id=mCP111925.0 isoform=CRA_a"
FT                   /protein_id="EDL15321.1"
FT                   /translation="ARGEPLGTRSEWALGAGKIRSLPLWPLCSAPHPGPHYLLPPIHEV
FT                   IHSRRGATATLPCVLGTSPPSYKVRWSKVEPGELRETLILITNGLHARDYGLLGGRASL
FT                   RRGHRLDASLIIKNVRLEDEGRYRCELINGIEDESVALTLRLEGVVFPYQPSRGRYQFN
FT                   YFEAKRACEEQDGRLATYGQLYQAWTEGLDWCNAGWLLEGSVRYPVLTARAPCGGHGRP
FT                   GIRSYGPRDRSRDRYDAFCFTSALAGQVFFVPGRLTLSEAHAACRRRGAVVAKVGHLYA
FT                   AWKFSGLDQCDGGWLADGSVRFPITTP"
FT   gene            23398607..23411824
FT                   /gene="Gpatc4"
FT                   /locus_tag="mCG_8850"
FT                   /note="gene_id=mCG8850.1"
FT   mRNA            join(23398607..23398679,23406999..23407126,
FT                   23407510..23407583,23407682..23407774,23407869..23407955,
FT                   23410206..23410297,23410540..23410590,23410795..23411824)
FT                   /gene="Gpatc4"
FT                   /locus_tag="mCG_8850"
FT                   /product="G patch domain containing 4, transcript variant
FT                   mCT9444"
FT                   /note="gene_id=mCG8850.1 transcript_id=mCT9444.0 created on
FT                   09-AUG-2002"
FT   mRNA            join(<23398608..23398679,23406999..23407126,
FT                   23407510..23407583,23407682..23407774,23407869..23407955,
FT                   23410206..23410497)
FT                   /gene="Gpatc4"
FT                   /locus_tag="mCG_8850"
FT                   /product="G patch domain containing 4, transcript variant
FT                   mCT190913"
FT                   /note="gene_id=mCG8850.1 transcript_id=mCT190913.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<23398624..23398679,23398967..23399101,
FT                   23406999..23407126,23407510..23407583,23407682..23407774,
FT                   23407869..23407955,23410206..23410297,23410540..23410590,
FT                   23410795..23411036,23411299..23411824)
FT                   /gene="Gpatc4"
FT                   /locus_tag="mCG_8850"
FT                   /product="G patch domain containing 4, transcript variant
FT                   mCT190912"
FT                   /note="gene_id=mCG8850.1 transcript_id=mCT190912.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23407006..23407126,23407510..23407583,
FT                   23407682..23407774,23407869..23407955,23410206..23410297,
FT                   23410540..23410590,23410795..23411036,23411299..23411330)
FT                   /codon_start=1
FT                   /gene="Gpatc4"
FT                   /locus_tag="mCG_8850"
FT                   /product="G patch domain containing 4, isoform CRA_a"
FT                   /note="gene_id=mCG8850.1 transcript_id=mCT190912.0
FT                   protein_id=mCP111929.0 isoform=CRA_a"
FT                   /protein_id="EDL15318.1"
FT                   /translation="CHVFPGENLRTDPAMSVTPEVKSRGMKFAEEQLLKHGWTQGKGLG
FT                   RRENGITQALKVTLKQDNHGVGHDPAKEFTDHWWSDLFNKTAASLVVDSGKDGVQIRRL
FT                   SKETTQRSHPKPSLLYQKFVKTATLTSGEEKPDRDLGNCSDVDNHEPTPPKILTDEMLL
FT                   KACEGRTAHKAARIGITMKAKLARLEAQEQAFLAQLKGSKALGTSQPLTDSEPSQKKKK
FT                   KRKQKEGEEAATTEKSLGDELLGHTDRSFRDTRSEGRVGRT"
FT   CDS             join(<23407006..23407126,23407510..23407583,
FT                   23407682..23407774,23407869..23407955,23410206..23410301)
FT                   /codon_start=1
FT                   /gene="Gpatc4"
FT                   /locus_tag="mCG_8850"
FT                   /product="G patch domain containing 4, isoform CRA_b"
FT                   /note="gene_id=mCG8850.1 transcript_id=mCT190913.0
FT                   protein_id=mCP111930.0 isoform=CRA_b"
FT                   /protein_id="EDL15319.1"
FT                   /translation="CHVFPGENLRTDPAMSVTPEVKSRGMKFAEEQLLKHGWTQGKGLG
FT                   RRENGITQALKVTLKQDNHGVGHDPAKEFTDHWWSDLFNKTAASLVVDSGKDGVQIRRL
FT                   SKETTQRSHPKPSLLYQKFVKTATLTSGEEKPDRDLGNCSDVDNHEPTPPKM"
FT   CDS             join(23407048..23407126,23407510..23407583,
FT                   23407682..23407774,23407869..23407955,23410206..23410297,
FT                   23410540..23410590,23410795..23411566)
FT                   /codon_start=1
FT                   /gene="Gpatc4"
FT                   /locus_tag="mCG_8850"
FT                   /product="G patch domain containing 4, isoform CRA_c"
FT                   /note="gene_id=mCG8850.1 transcript_id=mCT9444.0
FT                   protein_id=mCP22846.1 isoform=CRA_c"
FT                   /protein_id="EDL15320.1"
FT                   /translation="MSVTPEVKSRGMKFAEEQLLKHGWTQGKGLGRRENGITQALKVTL
FT                   KQDNHGVGHDPAKEFTDHWWSDLFNKTAASLVVDSGKDGVQIRRLSKETTQRSHPKPSL
FT                   LYQKFVKTATLTSGEEKPDRDLGNCSDVDNHEPTPPKILTDEMLLKACEGRTAHKAARI
FT                   GITMKAKLARLEAQEQAFLAQLKGSKALGTSQPLTDSEPSQKKKKKRKQKEGEEAATTE
FT                   KSLGDELLGHTDRSFRDSRKKKKRQKAERQGTAIGSEEEEAAGESGPRELSTEQSDQPS
FT                   RKKKKRRKQRHEEDGEMGVCDEGGRDVTSRPKAVNSGGDKDPRRSSKKRGTCGEDLDTQ
FT                   EEEGKDDLTKGERKVRRKDKRKRQQCCEEDLDVSSKDDGGTWVAEDAGERSRQYPKERA
FT                   KKKKRKRDRGSEVDLS"
FT   gene            complement(23412352..23414350)
FT                   /gene="Apoa1bp"
FT                   /locus_tag="mCG_8853"
FT                   /note="gene_id=mCG8853.1"
FT   mRNA            complement(join(23412352..23412613,23412823..23412970,
FT                   23413561..23413674,23413758..23413868,23413967..23414075,
FT                   23414164..23414350))
FT                   /gene="Apoa1bp"
FT                   /locus_tag="mCG_8853"
FT                   /product="apolipoprotein A-I binding protein"
FT                   /note="gene_id=mCG8853.1 transcript_id=mCT9447.1 created on
FT                   31-OCT-2002"
FT   CDS             complement(join(23412411..23412613,23412823..23412970,
FT                   23413561..23413674,23413758..23413868,23413967..23414075,
FT                   23414164..23414327))
FT                   /codon_start=1
FT                   /gene="Apoa1bp"
FT                   /locus_tag="mCG_8853"
FT                   /product="apolipoprotein A-I binding protein"
FT                   /note="gene_id=mCG8853.1 transcript_id=mCT9447.1
FT                   protein_id=mCP22876.2"
FT                   /protein_id="EDL15317.1"
FT                   /translation="MSGLRTLLGLGLLVAGSRLPRVISQQSVCRARPIWWGMQRRGSET
FT                   MAGAAVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSKSPPT
FT                   VLVICGPGNNGGDGLVCARHLKLFGYQPTIYYPKRPNKPLFTGLVTQCQKMDIPFLGEM
FT                   PPEPMMVDELYELVVDAIFGFSFKGDVREPFHSILSVLSGLTVPIASIDIPSGWDVEKG
FT                   NPSGIQPDLLISLTAPKKSATHFTGRYHYLGGRFVPPALEKKYQLNLPSYPDTECVYRL
FT                   Q"
FT   gene            complement(23425311..23434223)
FT                   /gene="A430025D11Rik"
FT                   /locus_tag="mCG_145756"
FT                   /note="gene_id=mCG145756.0"
FT   mRNA            complement(join(23425311..23426008,23426221..23426311,
FT                   23426933..23427030,23427163..23427248,23428209..23428307,
FT                   23428625..23428737,23428859..23428987,23430325..23430528,
FT                   23430695..23431391,23434188..23434223))
FT                   /gene="A430025D11Rik"
FT                   /locus_tag="mCG_145756"
FT                   /product="RIKEN cDNA A430025D11"
FT                   /note="gene_id=mCG145756.0 transcript_id=mCT185761.0
FT                   created on 16-JUN-2003"
FT   CDS             complement(join(23425927..23426008,23426221..23426311,
FT                   23426933..23427030,23427163..23427248,23428209..23428307,
FT                   23428625..23428737,23428859..23428987,23430325..23430528,
FT                   23430695..23430797))
FT                   /codon_start=1
FT                   /gene="A430025D11Rik"
FT                   /locus_tag="mCG_145756"
FT                   /product="RIKEN cDNA A430025D11"
FT                   /note="gene_id=mCG145756.0 transcript_id=mCT185761.0
FT                   protein_id=mCP107019.0"
FT                   /db_xref="GOA:B9EJT8"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024812"
FT                   /db_xref="MGI:MGI:2443841"
FT                   /db_xref="UniProtKB/TrEMBL:B9EJT8"
FT                   /protein_id="EDL15316.1"
FT                   /translation="MLSSRQYGLSDVLRALEESRKLADADRSTDQGLLGPFYNDLGMGY
FT                   FQLQLFPLAVEAFLQALPLCRQPSEQATVLQNLGMTHNVLGNYWEAQEFHQKAASLHGS
FT                   VGQRWEQGRSFSGLAFSLSQLGDHRAAWDSYLHALQAAQDTGDVKGQWQACEGLGAAAA
FT                   RLGQHDQALKYYKEALALCQHEPSSVRERLVAKLADAMRTFVAQEKIAQARFLPSAPGK
FT                   LQTSRKAKTSARVQSSAEDAQESQWEGEASEGGHEKKEMEGLVNTATVLGPQRQNRATT
FT                   HLPSGGPSPSGEEYPFIIAPKKLRVSRSSTWAKEALGRNFQRTRIQSGLCSIM"
FT   gene            23437918..23476997
FT                   /locus_tag="mCG_142620"
FT                   /note="gene_id=mCG142620.1"
FT   mRNA            join(23437918..23438010,23439849..23439936,
FT                   23442068..23442224,23443196..23443273,23444812..23444888,
FT                   23445579..23445646,23445735..23445848,23446056..23446234,
FT                   23446654..23446732,23447389..23447552,23448330..23448417,
FT                   23450502..23450665,23452820..23452977,23454236..23454357,
FT                   23454776..23454939,23456545..23456635,23457347..23457514,
FT                   23457597..23457736,23457816..23457986,23459979..23460062,
FT                   23460220..23460291,23460385..23460454,23463432..23463486,
FT                   23463605..23463666,23464307..23464459,23464753..23464916,
FT                   23465218..23465442,23465941..23466081,23468250..23468334,
FT                   23468544..23468776,23469046..23469178,23469293..23469395,
FT                   23469870..23469996,23470850..23470937,23471854..23472066,
FT                   23472730..23472896,23473149..23473250,23473627..23473735,
FT                   23476114..23476997)
FT                   /locus_tag="mCG_142620"
FT                   /product="mCG142620, transcript variant mCT181203"
FT                   /note="gene_id=mCG142620.1 transcript_id=mCT181203.1
FT                   created on 22-NOV-2004"
FT   mRNA            join(23437918..23438010,23439849..23439936,
FT                   23442068..23442224,23443196..23443470)
FT                   /locus_tag="mCG_142620"
FT                   /product="mCG142620, transcript variant mCT194535"
FT                   /note="gene_id=mCG142620.1 transcript_id=mCT194535.0
FT                   created on 22-NOV-2004"
FT   CDS             join(23437974..23438010,23439849..23439936,
FT                   23442068..23442224,23443196..23443273,23444812..23444888,
FT                   23445579..23445646,23445735..23445848,23446056..23446234,
FT                   23446654..23446732,23447389..23447552,23448330..23448417,
FT                   23450502..23450665,23452820..23452977,23454236..23454357,
FT                   23454776..23454939,23456545..23456635,23457347..23457514,
FT                   23457597..23457736,23457816..23457986,23459979..23460062,
FT                   23460220..23460291,23460385..23460454,23463432..23463486,
FT                   23463605..23463666,23464307..23464347)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142620"
FT                   /product="mCG142620, isoform CRA_b"
FT                   /note="gene_id=mCG142620.1 transcript_id=mCT181203.1
FT                   protein_id=mCP104125.1 isoform=CRA_b"
FT                   /protein_id="EDL15315.1"
FT                   /translation="MEPCAAGRARTAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWME
FT                   VCLKEELPSPVELEESLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTD
FT                   NINFWLSAVAHIGLPSIFLPETTDIYDKKNMPRVIYCIHALSLFLFRLGLAPQIHDLYG
FT                   KVKFTAEELGNIASELAKYGLQLPAFSKIGGILANEFSADEAAVHAAILAINDAVERGV
FT                   VEDTLVTLQNPNALLGNLREPLAAVYQELLALAKMEKAANARNHDDGQEQDIYESCLTQ
FT                   AEIQGHINLANVQGALEVVDDALERQNPGALLEALHDPVLALQGVRGTFADWYLEQLTS
FT                   DREQKSQELGLVRLLEKEEIQAGVAVANEKGDEEQTMLQAVWRINKAIRRGVAADTVKE
FT                   LMCPEAQLPRVYPFASAFYQQELALLQKQQQGELGQEELFVAVEMLSAVVLINRALEAG
FT                   DVCAFWDNLVNPATGLAQVEEENAQRYFDALVKVQQFQGTHRGILSWNDLQAAVSQVNE
FT                   QVQEETDQVLAISLINEALDQGCPEKTLSALLLPAAGLEDVSLHVAPRYHLLLVAAKRQ
FT                   KARVTGDPGAVLWLEEIRQGVARANEDTSTAQRIALGVAAINQAIKEGKAAQTERVLRN
FT                   PNVALRGIVPDCAKSYQQALEGAAAKKQCPGDTAFWVQHDMKDGTAYYLHLQTFQGTWE
FT                   HPSGCHLNTSHLTWEEIQSVITKVTAAHDRQLLWKANVGFVIKLQARLRGFLVRQKFAE
FT                   SSHVFRTLLPAVIKIQAHWRGYRQRKAYQERLQHFKANLDAIIKIQAWARMWAARRRYL
FT                   RRLRYFQKNVDSVVKIQAFFRARKARDDYRMLVHARHPPLCVVRKFAHLLKGPQPHGHQ
FT                   DWSARQEPHHPAGGSLPLQEADQEE"
FT   CDS             join(23437974..23438010,23439849..23439936,
FT                   23442068..23442224,23443196..23443294)
FT                   /codon_start=1
FT                   /locus_tag="mCG_142620"
FT                   /product="mCG142620, isoform CRA_a"
FT                   /note="gene_id=mCG142620.1 transcript_id=mCT194535.0
FT                   protein_id=mCP115564.0 isoform=CRA_a"
FT                   /protein_id="EDL15314.1"
FT                   /translation="MEPCAAGRARTAYERLTAEEMDEQRRQNVAYQYLCRLEEAKRWME
FT                   VCLKEELPSPVELEESLRNGVLLAKLGHCFAPSVVPLKKIYDVEQLRYQATGLHFRHTD
FT                   NINFWLSAVAHIGLPSVRLHVI"
FT   gene            23498347..23527980
FT                   /gene="Mef2d"
FT                   /locus_tag="mCG_142619"
FT                   /note="gene_id=mCG142619.0"
FT   mRNA            join(23498347..23498594,23511602..23511786,
FT                   23512246..23512449,23513958..23514095,23515046..23515256,
FT                   23515460..23515516,23517115..23517305,23518882..23519011,
FT                   23523429..23523648,23523952..23524258,23524546..23527980)
FT                   /gene="Mef2d"
FT                   /locus_tag="mCG_142619"
FT                   /product="myocyte enhancer factor 2D"
FT                   /note="gene_id=mCG142619.0 transcript_id=mCT181202.0
FT                   created on 19-MAR-2003"
FT   CDS             join(23511733..23511786,23512246..23512449,
FT                   23513958..23514095,23515046..23515256,23515460..23515516,
FT                   23517115..23517305,23518882..23519011,23523429..23523648,
FT                   23523952..23524258,23524546..23524557)
FT                   /codon_start=1
FT                   /gene="Mef2d"
FT                   /locus_tag="mCG_142619"
FT                   /product="myocyte enhancer factor 2D"
FT                   /note="gene_id=mCG142619.0 transcript_id=mCT181202.0
FT                   protein_id=mCP104124.0"
FT                   /db_xref="GOA:Q921S6"
FT                   /db_xref="InterPro:IPR002100"
FT                   /db_xref="InterPro:IPR022102"
FT                   /db_xref="MGI:MGI:99533"
FT                   /db_xref="UniProtKB/TrEMBL:Q921S6"
FT                   /protein_id="EDL15313.1"
FT                   /translation="MGRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIAL
FT                   IIFNHSNKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGFNGCDSPEPDGE
FT                   DSLEQSPLLEDKYRRASEELDGLFRRYGSSVPAPNFAMPVTVPVSNQSSMQFSNPSSSL
FT                   VTPSLVTSSLTDPRLLSPQQPALQRNSVSPGLPQRPASAGAMLGGDLNSANGACPSPVG
FT                   NGYVSARASPGLLPVANGNSLNKVIPAKSPPPPTHNTQLGAPSRKPDLRVITSQGGKGL
FT                   MHHLNNAQRLGVSQSTHSLTTPVVSVATPSLLSQGLPFSSMPTAYNTDYQLPSAELSSL
FT                   PAFSSPAGLALGNVTAWQQPQPPQQPQPPQPPQSQPQPPQPQPQQPPQQQPHLVPVSLS
FT                   NLIPGSPLPHVGAALTVTTHPHISIKSEPVSPSRERSPAPPPPAVFPAARPEPGEGLSS
FT                   PAGGSYETGDRDDGRGDFGPTLGLLRPAPEPEAEGSAVKRMRLDTWTLK"
FT   gene            complement(23527474..>23533699)
FT                   /locus_tag="mCG_145956"
FT                   /note="gene_id=mCG145956.0"
FT   mRNA            complement(join(23527474..23528172,23531765..23531849,
FT                   23533501..>23533699))
FT                   /locus_tag="mCG_145956"
FT                   /product="mCG145956"
FT                   /note="gene_id=mCG145956.0 transcript_id=mCT186064.0
FT                   created on 04-JUL-2003"
FT   CDS             complement(23527629..>23527937)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145956"
FT                   /product="mCG145956"
FT                   /note="gene_id=mCG145956.0 transcript_id=mCT186064.0
FT                   protein_id=mCP107586.0"
FT                   /protein_id="EDL15312.1"
FT                   /translation="KSFQTKLVRISRTFLNVQNTRKHHRTARKEIMKTNQQPHTWTHPD
FT                   PGARSVGDCQVWGRVSSWLAHPSLLPSFWDLNGGREFRFSLGISALLPHYIPPLLLM"
FT   gene            <23563212..23585856
FT                   /locus_tag="mCG_8840"
FT                   /note="gene_id=mCG8840.2"
FT   mRNA            join(<23563212..23563259,23565540..23565621,
FT                   23577000..23577181,23578868..23578952,23580166..23580333,
FT                   23581842..23581944,23583264..23583566,23584909..23585262,
FT                   23585582..23585856)
FT                   /locus_tag="mCG_8840"
FT                   /product="mCG8840"
FT                   /note="gene_id=mCG8840.2 transcript_id=mCT9434.2 created on
FT                   28-MAR-2003"
FT   CDS             join(<23577106..23577181,23578868..23578952,
FT                   23580166..23580333,23581842..23581851)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8840"
FT                   /product="mCG8840"
FT                   /note="gene_id=mCG8840.2 transcript_id=mCT9434.2
FT                   protein_id=mCP22815.2"
FT                   /protein_id="EDL15311.1"
FT                   /translation="DIECSDQLKLKQAFGIIYNPERDKADPRGLKAMGDVEGAEESSWK
FT                   DQQETDRVRFLECLVYVPGWRRHPWPCRGSVLVGKQTQPTLGPWFPCKKPSGFLEDTFP
FT                   GGSDSRAA"
FT   gene            complement(23599023..23610582)
FT                   /gene="Rhbg"
FT                   /locus_tag="mCG_8855"
FT                   /note="gene_id=mCG8855.1"
FT   mRNA            complement(join(23599023..23599346,23599491..23599564,
FT                   23600423..23600544,23601031..23601164,23601334..23601471,
FT                   23601713..23601879,23603330..23603477,23603585..23603735,
FT                   23604175..23604361,23610367..23610582))
FT                   /gene="Rhbg"
FT                   /locus_tag="mCG_8855"
FT                   /product="Rhesus blood group-associated B glycoprotein"
FT                   /note="gene_id=mCG8855.1 transcript_id=mCT9449.1 created on
FT                   09-AUG-2002"
FT   CDS             complement(join(23599278..23599346,23599491..23599564,
FT                   23600423..23600544,23601031..23601164,23601334..23601471,
FT                   23601713..23601879,23603330..23603477,23603585..23603735,
FT                   23604175..23604361,23610367..23610544))
FT                   /codon_start=1
FT                   /gene="Rhbg"
FT                   /locus_tag="mCG_8855"
FT                   /product="Rhesus blood group-associated B glycoprotein"
FT                   /note="gene_id=mCG8855.1 transcript_id=mCT9449.1
FT                   protein_id=mCP22850.1"
FT                   /protein_id="EDL15310.1"
FT                   /translation="MARVPRHRRLVLPLLCLLFQGATALLFAIFVRYNHETDAALWHWG
FT                   NHSNVDNEFYFRYPSFQDVHVMVFVGFGFLMVFLQRYGFSSVGFTFLVASLTLQWATLL
FT                   QGFLHSFHGGHIHVGVESLINADFCAGAVLISFGAVLGKTGPAQLLLMALLEAVLFSVN
FT                   EFILLSLLGVRDAGGSMTIHTFGAYFGLFLSRVLYRSQLEKSRHRQSSVYNSDLFAMIG
FT                   TIFLWVFWPSFNSAPTALGDGQHRTVVNTYYSLTASTLSTFALSALVSGDGRLDMVHVQ
FT                   NAALAGGVVVGTSSEMMLTPFGALAAGFLAGTVSTLGYKFFTPILESRFKLQDTCGVHN
FT                   LHGMPGVLGAILGVVVAALATHEAYGDGLQSVFPLIAKGQRSATSQAVYQLFGMFVTLV
FT                   FASVGGSLGGLLLRLPFLDSPPDSQCFEDQVYWEVPGEQETETQRPLRGGESDTRA"
FT   gene            complement(23638659..23652772)
FT                   /locus_tag="mCG_1032215"
FT                   /note="gene_id=mCG1032215.1"
FT   mRNA            complement(join(23638659..23638883,23642997..23643116,
FT                   23651280..23651339,23652713..23652772))
FT                   /locus_tag="mCG_1032215"
FT                   /product="mCG1032215, transcript variant mCT149919"
FT                   /note="gene_id=mCG1032215.1 transcript_id=mCT149919.1
FT                   created on 28-OCT-2002"
FT   mRNA            complement(join(23638659..23638883,23642997..23643116,
FT                   23651280..23651339,23652652..23652728))
FT                   /locus_tag="mCG_1032215"
FT                   /product="mCG1032215, transcript variant mCT175232"
FT                   /note="gene_id=mCG1032215.1 transcript_id=mCT175232.0
FT                   created on 28-OCT-2002"
FT   CDS             complement(join(23638666..23638883,23642997..23643116,
FT                   23651280..23651316))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032215"
FT                   /product="mCG1032215, isoform CRA_a"
FT                   /note="gene_id=mCG1032215.1 transcript_id=mCT149919.1
FT                   protein_id=mCP65731.1 isoform=CRA_a"
FT                   /protein_id="EDL15308.1"
FT                   /translation="MEQHTSNPTKEKAKEEDSVACFCPAKSSPSYIDLPANFTPANFLT
FT                   IQTKLSSGAGQKPKGCLGVLECMYANLQLQTQLAQRQIAILENLQASLSQPGSGRESKN
FT                   CSLPGLCCKLLLNHLPQFHK"
FT   CDS             complement(join(23638666..23638883,23642997..23643116,
FT                   23651280..23651316))
FT                   /codon_start=1
FT                   /locus_tag="mCG_1032215"
FT                   /product="mCG1032215, isoform CRA_a"
FT                   /note="gene_id=mCG1032215.1 transcript_id=mCT175232.0
FT                   protein_id=mCP98151.0 isoform=CRA_a"
FT                   /protein_id="EDL15309.1"
FT                   /translation="MEQHTSNPTKEKAKEEDSVACFCPAKSSPSYIDLPANFTPANFLT
FT                   IQTKLSSGAGQKPKGCLGVLECMYANLQLQTQLAQRQIAILENLQASLSQPGSGRESKN
FT                   CSLPGLCCKLLLNHLPQFHK"
FT   gene            23653024..23678044
FT                   /gene="Cct3"
FT                   /locus_tag="mCG_8828"
FT                   /note="gene_id=mCG8828.2"
FT   mRNA            join(23653024..23653155,23655231..23655292,
FT                   23656689..23656739,23656818..23656880,23658657..23658753,
FT                   23660902..23661019,23665050..23665236,23667562..23667711,
FT                   23669131..23669263,23669445..23669526,23674239..23674419,
FT                   23676353..23676598,23676907..23677038,23677337..23678044)
FT                   /gene="Cct3"
FT                   /locus_tag="mCG_8828"
FT                   /product="chaperonin subunit 3 (gamma)"
FT                   /note="gene_id=mCG8828.2 transcript_id=mCT9422.2 created on
FT                   09-AUG-2002"
FT   CDS             join(23653125..23653155,23655231..23655292,
FT                   23656689..23656739,23656818..23656880,23658657..23658753,
FT                   23660902..23661019,23665050..23665236,23667562..23667711,
FT                   23669131..23669263,23669445..23669526,23674239..23674419,
FT                   23676353..23676598,23676907..23677038,23677337..23677441)
FT                   /codon_start=1
FT                   /gene="Cct3"
FT                   /locus_tag="mCG_8828"
FT                   /product="chaperonin subunit 3 (gamma)"
FT                   /note="gene_id=mCG8828.2 transcript_id=mCT9422.2
FT                   protein_id=mCP22870.2"
FT                   /db_xref="GOA:Q3U4U6"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012719"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="MGI:MGI:104708"
FT                   /db_xref="UniProtKB/TrEMBL:Q3U4U6"
FT                   /protein_id="EDL15307.1"
FT                   /translation="MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKS
FT                   MMKMLLDPMGGIVMTNDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGE
FT                   MLSVAEHFLEQQMHPTVVISAYRMALDDMISTLKKISTPVDVNNREMMLSIINSSITTK
FT                   VISRWSSLACNIALDAVKTVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINK
FT                   DVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIHQLCED
FT                   IIQLKPDVVITEKGISDLAQHYLMRANVTAIRRVRKTDNNRIARACGARIVSRPEELRE
FT                   DDVGTGAGLLEIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCR
FT                   NVLLDPQLVPGGGASEMAVAHALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGAS
FT                   TIRLLTSLRAKHTQESCETWGVNGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLL
FT                   RIDDIVSGHKKKGDDQNRQTGAPDAGQE"
FT   gene            23680916..23684523
FT                   /gene="0610031J06Rik"
FT                   /locus_tag="mCG_8832"
FT                   /note="gene_id=mCG8832.1"
FT   mRNA            join(23680916..23681094,23681570..23681824,
FT                   23682008..23682205,23682304..23682522,23683750..23684006,
FT                   23684096..23684523)
FT                   /gene="0610031J06Rik"
FT                   /locus_tag="mCG_8832"
FT                   /product="RIKEN cDNA 0610031J06, transcript variant
FT                   mCT9426"
FT                   /note="gene_id=mCG8832.1 transcript_id=mCT9426.1 created on
FT                   25-MAR-2003"
FT   mRNA            join(23680955..23681094,23681570..23681867,
FT                   23684179..23684213)
FT                   /gene="0610031J06Rik"
FT                   /locus_tag="mCG_8832"
FT                   /product="RIKEN cDNA 0610031J06, transcript variant
FT                   mCT181565"
FT                   /note="gene_id=mCG8832.1 transcript_id=mCT181565.0 created
FT                   on 25-MAR-2003"
FT   CDS             join(23680975..23681094,23681570..23681824,
FT                   23682008..23682205,23682304..23682522,23683750..23684006,
FT                   23684096..23684261)
FT                   /codon_start=1
FT                   /gene="0610031J06Rik"
FT                   /locus_tag="mCG_8832"
FT                   /product="RIKEN cDNA 0610031J06, isoform CRA_b"
FT                   /note="gene_id=mCG8832.1 transcript_id=mCT9426.1
FT                   protein_id=mCP22818.1 isoform=CRA_b"
FT                   /protein_id="EDL15306.1"
FT                   /translation="MFRCWGPHWGWVPCAPTPWLLLSLLVCSAPFGLQGEETRQVSMEV
FT                   ISGWPNPQNLLHIRAVGSNSTLHYVWSSLGPPAVVLVATNTTQSVLSVNWSLLLSPDPA
FT                   GALMVLPKSSIQFSSALVFTRLLEFDSTNASEGAQPPGKPYPPYSLAKFSWNNITNSLD
FT                   LANLSADFQGRPVDDPTGAFANGSLTFKVQAFSRSGRPAQPPRLLHTADVCQLEVALVG
FT                   ASPRGNHSLFGLEVATLGQGPDCPSVNERNSIDDEYAPAVFQLNQLLWGSSPSGFMQWR
FT                   PVAFSEEERARESALPCQASTLHSTLASSLPHSPIVQAFFGSQNNFCAFNLTFGAPTGP
FT                   GYWDQYYLCWSMLLGMGFPPVDIFSPLVLGIMAVALGAPGLMFLGGGLFLLLRHRRYSE
FT                   YQSIN"
FT   CDS             join(23680975..23681094,23681570..23681836)
FT                   /codon_start=1
FT                   /gene="0610031J06Rik"
FT                   /locus_tag="mCG_8832"
FT                   /product="RIKEN cDNA 0610031J06, isoform CRA_a"
FT                   /note="gene_id=mCG8832.1 transcript_id=mCT181565.0
FT                   protein_id=mCP104487.0 isoform=CRA_a"
FT                   /protein_id="EDL15305.1"
FT                   /translation="MFRCWGPHWGWVPCAPTPWLLLSLLVCSAPFGLQGEETRQVSMEV
FT                   ISGWPNPQNLLHIRAVGSNSTLHYVWSSLGPPAVVLVATNTTQSVLSVNWSLLLSPDPA
FT                   GALMVLPKSSIQFSSALVFTRVRV"
FT   gene            complement(23684547..23692100)
FT                   /gene="Tmem79"
FT                   /locus_tag="mCG_133425"
FT                   /note="gene_id=mCG133425.2"
FT   mRNA            complement(join(23684547..23685825,23688392..23688605,
FT                   23688844..23689634,23691855..23692100))
FT                   /gene="Tmem79"
FT                   /locus_tag="mCG_133425"
FT                   /product="transmembrane protein 79, transcript variant
FT                   mCT171982"
FT                   /note="gene_id=mCG133425.2 transcript_id=mCT171982.0
FT                   created on 18-JUN-2003"
FT   mRNA            complement(join(23684547..23685825,23688392..23688605,
FT                   23688844..23689634,23690334..23690422))
FT                   /gene="Tmem79"
FT                   /locus_tag="mCG_133425"
FT                   /product="transmembrane protein 79, transcript variant
FT                   mCT134793"
FT                   /note="gene_id=mCG133425.2 transcript_id=mCT134793.1
FT                   created on 18-JUN-2003"
FT   mRNA            complement(join(23684547..23685825,23688392..23688605,
FT                   23688844..23689634,23690060..23690220))
FT                   /gene="Tmem79"
FT                   /locus_tag="mCG_133425"
FT                   /product="transmembrane protein 79, transcript variant
FT                   mCT171981"
FT                   /note="gene_id=mCG133425.2 transcript_id=mCT171981.1
FT                   created on 18-JUN-2003"
FT   CDS             complement(join(23685612..23685825,23688392..23688605,
FT                   23688844..23689591))
FT                   /codon_start=1
FT                   /gene="Tmem79"
FT                   /locus_tag="mCG_133425"
FT                   /product="transmembrane protein 79, isoform CRA_a"
FT                   /note="gene_id=mCG133425.2 transcript_id=mCT134793.1
FT                   protein_id=mCP65758.1 isoform=CRA_a"
FT                   /protein_id="EDL15302.1"
FT                   /translation="MTEPETLALLDMKEPETPEKSPPQALVLQSEEEGGTESPGTESLR
FT                   VGSSVGSPIVREGPEDGPDSTISEAATLPWGTDPHPSAPLPDPPGWRDIEPEPLESEAP
FT                   TKSEEPFKEDANLLPEKTVRAFVPIDLQCIERKPQEERILHRDAGPGELRNFLPARLSH
FT                   PEPPERKWAEAVVRPPGRSCGGCGSCGGREALRAVASVVAALIFFPCLLYGAYAFLPFD
FT                   APRLPTMSSRLVYTLRCGVFATFPIVLGLLVYGLSLLCFSALRPFGEPRREVEIHRQYV
FT                   AQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAISRLIYWLTFAVGRSFRGFGYG
FT                   LTFLPLLAMLVWNLYYMFVVEPERMLTASESRLDYPDHARSVSDYRPRSWG"
FT   CDS             complement(join(23685612..23685825,23688392..23688605,
FT                   23688844..23689591))
FT                   /codon_start=1
FT                   /gene="Tmem79"
FT                   /locus_tag="mCG_133425"
FT                   /product="transmembrane protein 79, isoform CRA_a"
FT                   /note="gene_id=mCG133425.2 transcript_id=mCT171981.1
FT                   protein_id=mCP94900.0 isoform=CRA_a"
FT                   /protein_id="EDL15303.1"
FT                   /translation="MTEPETLALLDMKEPETPEKSPPQALVLQSEEEGGTESPGTESLR
FT                   VGSSVGSPIVREGPEDGPDSTISEAATLPWGTDPHPSAPLPDPPGWRDIEPEPLESEAP
FT                   TKSEEPFKEDANLLPEKTVRAFVPIDLQCIERKPQEERILHRDAGPGELRNFLPARLSH
FT                   PEPPERKWAEAVVRPPGRSCGGCGSCGGREALRAVASVVAALIFFPCLLYGAYAFLPFD
FT                   APRLPTMSSRLVYTLRCGVFATFPIVLGLLVYGLSLLCFSALRPFGEPRREVEIHRQYV
FT                   AQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAISRLIYWLTFAVGRSFRGFGYG
FT                   LTFLPLLAMLVWNLYYMFVVEPERMLTASESRLDYPDHARSVSDYRPRSWG"
FT   CDS             complement(join(23685612..23685825,23688392..23688605,
FT                   23688844..23689591))
FT                   /codon_start=1
FT                   /gene="Tmem79"
FT                   /locus_tag="mCG_133425"
FT                   /product="transmembrane protein 79, isoform CRA_a"
FT                   /note="gene_id=mCG133425.2 transcript_id=mCT171982.0
FT                   protein_id=mCP94901.0 isoform=CRA_a"
FT                   /protein_id="EDL15304.1"
FT                   /translation="MTEPETLALLDMKEPETPEKSPPQALVLQSEEEGGTESPGTESLR
FT                   VGSSVGSPIVREGPEDGPDSTISEAATLPWGTDPHPSAPLPDPPGWRDIEPEPLESEAP
FT                   TKSEEPFKEDANLLPEKTVRAFVPIDLQCIERKPQEERILHRDAGPGELRNFLPARLSH
FT                   PEPPERKWAEAVVRPPGRSCGGCGSCGGREALRAVASVVAALIFFPCLLYGAYAFLPFD
FT                   APRLPTMSSRLVYTLRCGVFATFPIVLGLLVYGLSLLCFSALRPFGEPRREVEIHRQYV
FT                   AQSVQLFILYFFNLAVLSTYLPQDTLKLLPLLTGLFAISRLIYWLTFAVGRSFRGFGYG
FT                   LTFLPLLAMLVWNLYYMFVVEPERMLTASESRLDYPDHARSVSDYRPRSWG"
FT   gene            <23692233..23718285
FT                   /locus_tag="mCG_8836"
FT                   /note="gene_id=mCG8836.2"
FT   mRNA            join(<23692233..23692449,23697806..23697904,
FT                   23698389..23698512,23698828..23698984,23701311..23701400,
FT                   23702393..23702482,23703466..23703544,23705090..23705215,
FT                   23705324..23705392,23705964..23706172,23706645..23706782,
FT                   23706927..23707529,23708911..23709086,23709824..23709899,
FT                   23710480..23710655,23711526..23711684,23714601..23714660,
FT                   23714975..23715134,23715496..23715586,23716279..23716353,
FT                   23716702..23716840,23716973..23718285)
FT                   /locus_tag="mCG_8836"
FT                   /product="mCG8836, transcript variant mCT190920"
FT                   /note="gene_id=mCG8836.2 transcript_id=mCT190920.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23692235..23692449,23697806..23697904,
FT                   23698389..23698512,23698828..23698984,23701311..23701400,
FT                   23702393..23702482,23703466..23703544,23705090..23705215,
FT                   23705324..23705392,23705964..23706172,23706645..23706782,
FT                   23706927..23707529,23708911..23709086,23709824..23709899,
FT                   23710480..23710655,23711526..23711684,23714601..23714660,
FT                   23714975..23715134,23715496..23715586,23716279..23716353,
FT                   23716702..23716840,23716973..23717056)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8836"
FT                   /product="mCG8836, isoform CRA_a"
FT                   /note="gene_id=mCG8836.2 transcript_id=mCT190920.0
FT                   protein_id=mCP111926.0 isoform=CRA_a"
FT                   /protein_id="EDL15300.1"
FT                   /translation="QAAASQRWRPSRAGGSGGCGYSWRRQWRRQWWVAGACDQEVPSGP
FT                   GTMSQGPPPGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKAAYQEVFKPENVSLRN
FT                   KLRELCVKLMFLHPVDYGRKAEELLWRKVYYEVIQLIKTNKKHIHSRSTLECAYRTHLV
FT                   AGIGFYQHLLLYIQSHYQLELQCCIDWTHVTDPLMGFKKPVSASGKEMDWAQMACHRCL
FT                   VYLGDLSRYQNELAGVDTELLAERFYYQALSVAPQIGMPFNQLGTLAGSKYYNVEAMYC
FT                   YLRCIQSEVSFEGAYGNLKRLYDKAAKMYHQLKKSETRKLSPSKKRCKDIKRLLVNFMY
FT                   LQSLLQPKSSSVDSELTSLCQSVLEDFNLCLFYLPSSPNLGLTNEDEEECESGYAFLPD
FT                   LLIFQMAIICLMGVHSLKRAGSKHYSAAIAFTLALFSHLINHVNIRLQAELEEGENPVS
FT                   AFQSDGTDEPESKEALEKEEPEPEPPTVVPQADEGRKSRKHSRLSCLRRRRRHHPPKAG
FT                   DDSDLSEGFESDSSHDSAQASDGSDSGSDKSLEGRGTAFDAETDSEMNSQESRSDLEDM
FT                   EDEEGTRSPAQEPPQARSEVPDSLNGPLGPSEASIASNLQAMSTQMFQTKRCFRLAPTF
FT                   SNLLLQPTTEPNSVASHRPCVNGDMDKPLEPASEDGSESEGSESSNRSCRNERSLQEKL
FT                   QALMAEGLLPAVKVFLDWLRTNPDLIIVCAQSSQSLWNRLSVLLNLLPASAELQDSGLA
FT                   LCSEVQGLLEGCELPDLPASLLLPEDMALRNLPPLRAAHRRFNFDADRPLLSALEESVV
FT                   RICCIRSFGHFVARLQGSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMAEEEARRNR
FT                   LMRDMAQLRLQLEVSQLEGSLQQPKAQSAMSPYLIPDTQALCYHLPLIRQLATSGRFII
FT                   IIPRTVIDGLDLLKKEQPGARDGIRYLEAEFKKGNRYIRCQKEVGKSFERHKLKRQDAD
FT                   AWTLYKILDSCRQLTLAQGAGEEDPSGMVTIITGLHLDSPSALSGPMQAALQAAAHASV
FT                   DVKNVLDFYRQWKEIG"
FT   mRNA            join(23692263..23692449,23697806..23697904,
FT                   23698389..23698512,23698828..23698984,23701311..23701400,
FT                   23702393..23702482,23703466..23703544,23705090..23705215,
FT                   23705964..23706172,23706645..23706782,23706927..23707529,
FT                   23708911..23709086,23709824..23709899,23710480..23710655,
FT                   23711526..23711684,23714975..23715134,23715496..23715586,
FT                   23716279..23716353,23716702..23716840,23716973..23718285)
FT                   /locus_tag="mCG_8836"
FT                   /product="mCG8836, transcript variant mCT9430"
FT                   /note="gene_id=mCG8836.2 transcript_id=mCT9430.1 created on
FT                   31-OCT-2002"
FT   CDS             join(23692376..23692449,23697806..23697904,
FT                   23698389..23698512,23698828..23698984,23701311..23701400,
FT                   23702393..23702482,23703466..23703544,23705090..23705215,
FT                   23705964..23706172,23706645..23706782,23706927..23707529,
FT                   23708911..23709086,23709824..23709899,23710480..23710655,
FT                   23711526..23711684,23714975..23715134,23715496..23715586,
FT                   23716279..23716353,23716702..23716840,23716973..23717056)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8836"
FT                   /product="mCG8836, isoform CRA_b"
FT                   /note="gene_id=mCG8836.2 transcript_id=mCT9430.1
FT                   protein_id=mCP22860.2 isoform=CRA_b"
FT                   /protein_id="EDL15301.1"
FT                   /translation="MSQGPPPGESSEPEAKVLHTKRLYRAVVEAVHRLDLILCNKAAYQ
FT                   EVFKPENVSLRNKLRELCVKLMFLHPVDYGRKAEELLWRKVYYEVIQLIKTNKKHIHSR
FT                   STLECAYRTHLVAGIGFYQHLLLYIQSHYQLELQCCIDWTHVTDPLMGFKKPVSASGKE
FT                   MDWAQMACHRCLVYLGDLSRYQNELAGVDTELLAERFYYQALSVAPQIGMPFNQLGTLA
FT                   GSKYYNVEAMYCYLRCIQSEVSFEGAYGNLKRLYDKAAKMYHQLKKSETRKLSPSKKRS
FT                   VDSELTSLCQSVLEDFNLCLFYLPSSPNLGLTNEDEEECESGYAFLPDLLIFQMAIICL
FT                   MGVHSLKRAGSKHYSAAIAFTLALFSHLINHVNIRLQAELEEGENPVSAFQSDGTDEPE
FT                   SKEALEKEEPEPEPPTVVPQADEGRKSRKHSRLSCLRRRRRHHPPKAGDDSDLSEGFES
FT                   DSSHDSAQASDGSDSGSDKSLEGRGTAFDAETDSEMNSQESRSDLEDMEDEEGTRSPAQ
FT                   EPPQARSEVPDSLNGPLGPSEASIASNLQAMSTQMFQTKRCFRLAPTFSNLLLQPTTEP
FT                   NSVASHRPCVNGDMDKPLEPASEDGSESEGSESSNRSCRNERSLQEKLQALMAEGLLPA
FT                   VKVFLDWLRTNPDLIIVCAQSSQSLWNRLSVLLNLLPASAELQDSGLALCSEVQGLLEG
FT                   CELPDLPASLLLPEDMALRNLPPLRAAHRRFNFDADRPLLSALEESVVRICCIRSFGHF
FT                   VARLQGSILQFNPEVGIFVSIAQSEQESLLQQAQAQFRMLEVSQLEGSLQQPKAQSAMS
FT                   PYLIPDTQALCYHLPLIRQLATSGRFIIIIPRTVIDGLDLLKKEQPGARDGIRYLEAEF
FT                   KKGNRYIRCQKEVGKSFERHKLKRQDADAWTLYKILDSCRQLTLAQGAGEEDPSGMVTI
FT                   ITGLHLDSPSALSGPMQAALQAAAHASVDVKNVLDFYRQWKEIG"
FT   gene            23720539..23724491
FT                   /locus_tag="mCG_8849"
FT                   /note="gene_id=mCG8849.1"
FT   mRNA            join(23720539..23720571,23720976..23721051,
FT                   23721623..23721750,23721830..23722032,23722108..23722234,
FT                   23722853..23722949,23723168..23723318,23723638..23724491)
FT                   /locus_tag="mCG_8849"
FT                   /product="mCG8849, transcript variant mCT9443"
FT                   /note="gene_id=mCG8849.1 transcript_id=mCT9443.1 created on
FT                   27-MAR-2003"
FT   mRNA            join(23720539..23720571,23720976..23721051,
FT                   23721623..23721750,23722853..23722949,23723168..23723318,
FT                   23723638..23723937)
FT                   /locus_tag="mCG_8849"
FT                   /product="mCG8849, transcript variant mCT181575"
FT                   /note="gene_id=mCG8849.1 transcript_id=mCT181575.0 created
FT                   on 27-MAR-2003"
FT   CDS             join(23721001..23721051,23721623..23721750,
FT                   23721830..23722032,23722108..23722234,23722853..23722949,
FT                   23723168..23723318,23723638..23723912)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8849"
FT                   /product="mCG8849, isoform CRA_a"
FT                   /note="gene_id=mCG8849.1 transcript_id=mCT9443.1
FT                   protein_id=mCP22820.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q0VBT6"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:1916207"
FT                   /db_xref="UniProtKB/TrEMBL:Q0VBT6"
FT                   /protein_id="EDL15298.1"
FT                   /translation="MLSLKMPQLLRVHQVPRVFWEEGIMSGYRCPTSSALDCVLSSFQM
FT                   TNETVNIWTHFLPTWYFLWRLLALGSPGFRADPYHLPLLVFLLPACLYPFASCCAHTFS
FT                   SMSPRARHICYFLDYGALSLYSLGCAFPYAAYSMPASWLHSRLHQLFVPAAALNSFLCT
FT                   GLSCYSRFPELEYPGFSKALRTAAFAYPFLFDNLPLFYRLRLCWGGAHSCGRDALSSNH
FT                   GYHLLCALLSGFLFAARLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADMGSR
FT                   RAWLAVQEPTLGLGATVATLSLAVIGNLFIIAAFTASLLRMPGPCPLLQGSPLEEGLQA
FT                   KQQ"
FT   CDS             join(23721001..23721051,23721623..23721750,
FT                   23722853..23722949,23723168..23723318,23723638..23723912)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8849"
FT                   /product="mCG8849, isoform CRA_b"
FT                   /note="gene_id=mCG8849.1 transcript_id=mCT181575.0
FT                   protein_id=mCP104497.0 isoform=CRA_b"
FT                   /db_xref="GOA:D3Z1S5"
FT                   /db_xref="InterPro:IPR004254"
FT                   /db_xref="MGI:MGI:1916207"
FT                   /db_xref="UniProtKB/TrEMBL:D3Z1S5"
FT                   /protein_id="EDL15299.1"
FT                   /translation="MLSLKMPQLLRVHQVPRVFWEEGIMSGYRCPTSSALDCVLSSFQM
FT                   TNETVNIWTHFLPTWFPELEYPGFSKALRTAAFAYPFLFDNLPLFYRLRLCWGGAHSCG
FT                   RDALSSNHGYHLLCALLSGFLFAARLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEA
FT                   VLADMGSRRAWLAVQEPTLGLGATVATLSLAVIGNLFIIAAFTASLLRMPGPCPLLQGS
FT                   PLEEGLQAKQQ"
FT   gene            complement(23724565..23728684)
FT                   /locus_tag="mCG_133410"
FT                   /note="gene_id=mCG133410.4"
FT   mRNA            complement(join(23724565..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725557,23726077..23726127,
FT                   23727357..23727428,23728488..23728684))
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, transcript variant mCT181523"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT181523.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(23724565..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725557,23726077..23726185,
FT                   23727323..23727428,23728488..23728684))
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, transcript variant mCT171980"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT171980.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(23724565..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725557,23726077..23726312,
FT                   23727323..23727428,23728488..23728684))
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, transcript variant mCT181524"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT181524.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(23724565..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725557,23726077..23727428,
FT                   23728488..23728684))
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, transcript variant mCT190981"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT190981.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(23724565..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725557,23726077..23726312,
FT                   23728501..23728614))
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, transcript variant mCT171979"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT171979.1
FT                   created on 10-JUN-2004"
FT   mRNA            complement(join(23724565..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725780))
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, transcript variant mCT134778"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT134778.2
FT                   created on 10-JUN-2004"
FT   CDS             complement(join(23724705..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725485))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, isoform CRA_a"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT134778.2
FT                   protein_id=mCP65702.2 isoform=CRA_a"
FT                   /protein_id="EDL15292.1"
FT                   /translation="MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVN
FT                   RLRRYLGASVPSPDPLEPTRELCELDPACDELSNQYGLKTAYRRIYGITI"
FT   CDS             complement(join(23724705..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725485))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, isoform CRA_a"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT171979.1
FT                   protein_id=mCP94899.1 isoform=CRA_a"
FT                   /protein_id="EDL15293.1"
FT                   /translation="MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVN
FT                   RLRRYLGASVPSPDPLEPTRELCELDPACDELSNQYGLKTAYRRIYGITI"
FT   CDS             complement(join(23724705..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725485))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, isoform CRA_a"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT171980.1
FT                   protein_id=mCP94898.1 isoform=CRA_a"
FT                   /protein_id="EDL15294.1"
FT                   /translation="MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVN
FT                   RLRRYLGASVPSPDPLEPTRELCELDPACDELSNQYGLKTAYRRIYGITI"
FT   CDS             complement(join(23724705..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725485))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, isoform CRA_a"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT181523.1
FT                   protein_id=mCP104445.1 isoform=CRA_a"
FT                   /protein_id="EDL15295.1"
FT                   /translation="MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVN
FT                   RLRRYLGASVPSPDPLEPTRELCELDPACDELSNQYGLKTAYRRIYGITI"
FT   CDS             complement(join(23724705..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725485))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, isoform CRA_a"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT181524.1
FT                   protein_id=mCP104446.1 isoform=CRA_a"
FT                   /protein_id="EDL15296.1"
FT                   /translation="MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVN
FT                   RLRRYLGASVPSPDPLEPTRELCELDPACDELSNQYGLKTAYRRIYGITI"
FT   CDS             complement(join(23724705..23724837,23725044..23725101,
FT                   23725245..23725277,23725422..23725485))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133410"
FT                   /product="mCG133410, isoform CRA_a"
FT                   /note="gene_id=mCG133410.4 transcript_id=mCT190981.1
FT                   protein_id=mCP111938.1 isoform=CRA_a"
FT                   /protein_id="EDL15297.1"
FT                   /translation="MRTLSLLTLLALAALCLSDLTDATPTGPESDKAFMSKQEGNKVVN
FT                   RLRRYLGASVPSPDPLEPTRELCELDPACDELSNQYGLKTAYRRIYGITI"
FT   gene            <23731984..>23733037
FT                   /locus_tag="mCG_133422"
FT                   /note="gene_id=mCG133422.0"
FT   mRNA            join(<23731984..23732080,23732298..23732448,
FT                   23732763..>23733037)
FT                   /locus_tag="mCG_133422"
FT                   /product="mCG133422"
FT                   /note="gene_id=mCG133422.0 transcript_id=mCT134790.0
FT                   created on 31-OCT-2002"
FT   CDS             join(<23731985..23732080,23732298..23732448,
FT                   23732763..23733037)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133422"
FT                   /product="mCG133422"
FT                   /note="gene_id=mCG133422.0 transcript_id=mCT134790.0
FT                   protein_id=mCP65474.0"
FT                   /protein_id="EDL15291.1"
FT                   /translation="FPELEYPGFSKALRTAAFAYPFLFDNLPLFYRLRLCWGGAHSCGR
FT                   DALSSNPGYHLLCTLLSGFLCAARLLERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAV
FT                   LADMGSRRAWLAVQEPTLGLGATVATLSLAVIGNLFIIAAFTASFLRIPGPCPLLQGSP
FT                   LEEGLQAKQQ"
FT   gene            complement(23733695..23734657)
FT                   /locus_tag="mCG_133397"
FT                   /note="gene_id=mCG133397.0"
FT   mRNA            complement(join(23733695..23733961,23734168..23734225,
FT                   23734369..23734401,23734546..23734657))
FT                   /locus_tag="mCG_133397"
FT                   /product="mCG133397"
FT                   /note="gene_id=mCG133397.0 transcript_id=mCT134765.0
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(23733829..23733961,23734168..23734225,
FT                   23734369..23734401,23734546..23734609))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133397"
FT                   /product="mCG133397"
FT                   /note="gene_id=mCG133397.0 transcript_id=mCT134765.0
FT                   protein_id=mCP65921.1"
FT                   /protein_id="EDL15290.1"
FT                   /translation="MRTLSLLTLLALAALCLSDLTDAKPSGPESDKAFMSKQEGNKVVN
FT                   RLRRYLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI"
FT   gene            <23737570..>23738802
FT                   /locus_tag="mCG_133432"
FT                   /note="gene_id=mCG133432.1"
FT   mRNA            join(<23737570..23737849,23738058..23738208,
FT                   23738532..>23738802)
FT                   /locus_tag="mCG_133432"
FT                   /product="mCG133432"
FT                   /note="gene_id=mCG133432.1 transcript_id=mCT134800.1
FT                   created on 31-OCT-2002"
FT   CDS             join(<23737589..23737849,23738058..23738208,
FT                   23738532..>23738802)
FT                   /codon_start=1
FT                   /locus_tag="mCG_133432"
FT                   /product="mCG133432"
FT                   /note="gene_id=mCG133432.1 transcript_id=mCT134800.1
FT                   protein_id=mCP65846.1"
FT                   /protein_id="EDL15289.1"
FT                   /translation="DSLDPAHPASTSQWGHSHASTHLPSECGPSPLLAPDNLFLTYPAL
FT                   KINLLFLPLRFPELEYPGFSKALRTAAFAYPFLFDNLPLFYRLRLCWGGAHSCGRDSLS
FT                   SNHGYHLLCALLSGFLFAAHLPERLAPGRFDYIGHSHQLFHICAVLGTHFQLEAVLADM
FT                   GSRRAWLAVQEPTLGLGATVATLSLAVIGNLFIIAAFTASFLRIPGPCPLLQGSPLEEG
FT                   LQAKQ"
FT   gene            complement(23739460..23740392)
FT                   /locus_tag="mCG_133400"
FT                   /note="gene_id=mCG133400.0"
FT   mRNA            complement(join(23739460..23739726,23739933..23739990,
FT                   23740134..23740166,23740311..23740392))
FT                   /locus_tag="mCG_133400"
FT                   /product="mCG133400"
FT                   /note="gene_id=mCG133400.0 transcript_id=mCT134768.0
FT                   created on 12-AUG-2002"
FT   CDS             complement(join(23739594..23739726,23739933..23739990,
FT                   23740134..23740166,23740311..23740374))
FT                   /codon_start=1
FT                   /locus_tag="mCG_133400"
FT                   /product="mCG133400"
FT                   /note="gene_id=mCG133400.0 transcript_id=mCT134768.0
FT                   protein_id=mCP65940.1"
FT                   /protein_id="EDL15288.1"
FT                   /translation="MRTIFLLTLLTLAALCLSDLTDAKPSGPESDKAFMSKQEGNKVVN
FT                   RLRRYLGASVPSPDPLEPTREQCELNPACDELSDQYGLKTAYKRIYGITI"
FT   gene            complement(23749867..23766332)
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /note="gene_id=mCG8843.3"
FT   mRNA            complement(join(23749867..23750530,23751861..23752060,
FT                   23755095..23755195,23755671..23755776,23766115..23766314))
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /product="polyamine-modulated factor 1, transcript variant
FT                   mCT9437"
FT                   /note="gene_id=mCG8843.3 transcript_id=mCT9437.1 created on
FT                   25-MAR-2003"
FT   mRNA            complement(join(23750103..23750530,23751865..23752060,
FT                   23755095..23755195,23755671..23755776,23766115..23766330))
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /product="polyamine-modulated factor 1, transcript variant
FT                   mCT181570"
FT                   /note="gene_id=mCG8843.3 transcript_id=mCT181570.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(23750339..23750530,23751674..23751767,
FT                   23751861..23752060,23755095..23755195,23755671..23755776,
FT                   23766115..23766332))
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /product="polyamine-modulated factor 1, transcript variant
FT                   mCT181571"
FT                   /note="gene_id=mCG8843.3 transcript_id=mCT181571.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(23750468..23750530,23751865..23752060,
FT                   23766115..23766314))
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /product="polyamine-modulated factor 1, transcript variant
FT                   mCT181569"
FT                   /note="gene_id=mCG8843.3 transcript_id=mCT181569.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(23750477..23750530,23751865..23752060,
FT                   23766115..23766266))
FT                   /codon_start=1
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /product="polyamine-modulated factor 1, isoform CRA_a"
FT                   /note="gene_id=mCG8843.3 transcript_id=mCT181569.0
FT                   protein_id=mCP104492.0 isoform=CRA_a"
FT                   /protein_id="EDL15284.1"
FT                   /translation="MAEVSRDSEAAERGPEGSSPEAVPGDATIPRVKLLDAIVDTFLQK
FT                   LVADRRRPSGIPEKDLCSVMAPYFLKQQDTLCHQVRKQEAKNQELADAVLAGRRQVEEL
FT                   QQQVRALQQTWQALHREQRELLSVLRAPE"
FT   CDS             complement(join(23750477..23750530,23751865..23752060,
FT                   23755095..23755195,23755671..23755776,23766115..23766266))
FT                   /codon_start=1
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /product="polyamine-modulated factor 1, isoform CRA_b"
FT                   /note="gene_id=mCG8843.3 transcript_id=mCT181570.0
FT                   protein_id=mCP104491.0 isoform=CRA_b"
FT                   /protein_id="EDL15285.1"
FT                   /translation="MAEVSRDSEAAERGPEGSSPEAVPGDATIPRVKLLDAIVDTFLQK
FT                   LVADRSYERFTTCYKHFHQLNPEVTQRIYDKFVAQLQTSIREEISEIKEEGNLEAVLNS
FT                   LDKIIEEGRERGEPAWRPSGIPEKDLCSVMAPYFLKQQDTLCHQVRKQEAKNQELADAV
FT                   LAGRRQVEELQQQVRALQQTWQALHREQRELLSVLRAPE"
FT   CDS             complement(join(23750481..23750530,23751861..23752060,
FT                   23755095..23755195,23755671..23755776,23766115..23766266))
FT                   /codon_start=1
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /product="polyamine-modulated factor 1, isoform CRA_d"
FT                   /note="gene_id=mCG8843.3 transcript_id=mCT9437.1
FT                   protein_id=mCP22854.1 isoform=CRA_d"
FT                   /protein_id="EDL15287.1"
FT                   /translation="MAEVSRDSEAAERGPEGSSPEAVPGDATIPRVKLLDAIVDTFLQK
FT                   LVADRSYERFTTCYKHFHQLNPEVTQRIYDKFVAQLQTSIREEISEIKEEGNLEAVLNS
FT                   LDKIIEEGRERGEPAWRPSGIPEKDLCSVMAPYFLKQQDTLCHQVRKQEAKNQELADAV
FT                   LAGRRQVEELQQQVRALQQTWQASSTQRAEGAAVSAEGA"
FT   CDS             complement(join(23750491..23750530,23751674..23751767,
FT                   23751861..23752060,23755095..23755195,23755671..23755776,
FT                   23766115..23766266))
FT                   /codon_start=1
FT                   /gene="Pmf1"
FT                   /locus_tag="mCG_8843"
FT                   /product="polyamine-modulated factor 1, isoform CRA_c"
FT                   /note="gene_id=mCG8843.3 transcript_id=mCT181571.0
FT                   protein_id=mCP104493.0 isoform=CRA_c"
FT                   /protein_id="EDL15286.1"
FT                   /translation="MAEVSRDSEAAERGPEGSSPEAVPGDATIPRVKLLDAIVDTFLQK
FT                   LVADRSYERFTTCYKHFHQLNPEVTQRIYDKFVAQLQTSIREEISEIKEEGNLEAVLNS
FT                   LDKIIEEGRERGEPAWRPSGIPEKDLCSVMAPYFLKQQDTLCHQVRKQEAKNQELADAV
FT                   LAGRRQVEELQQQVRALQQTWQAKSLGTFAGTCEVGSSMPVLKSSLGSRSCAAARLYTE
FT                   SRGSCCQC"
FT   gene            complement(23766457..23781071)
FT                   /gene="B430110G05Rik"
FT                   /locus_tag="mCG_8854"
FT                   /note="gene_id=mCG8854.2"
FT   mRNA            complement(join(23766457..23768857,23771948..23772075,
FT                   23776463..23777100,23780808..23781071))
FT                   /gene="B430110G05Rik"
FT                   /locus_tag="mCG_8854"
FT                   /product="RIKEN cDNA B430110G05, transcript variant
FT                   mCT185664"
FT                   /note="gene_id=mCG8854.2 transcript_id=mCT185664.0 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(23766457..23768647,23768687..23768857,
FT                   23771948..23772075,23776463..23777100,23780808..>23781067))
FT                   /gene="B430110G05Rik"
FT                   /locus_tag="mCG_8854"
FT                   /product="RIKEN cDNA B430110G05, transcript variant
FT                   mCT190923"
FT                   /note="gene_id=mCG8854.2 transcript_id=mCT190923.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(23766457..23768857,23771948..23772075,
FT                   23776463..23777100,23780690..23781062))
FT                   /gene="B430110G05Rik"
FT                   /locus_tag="mCG_8854"
FT                   /product="RIKEN cDNA B430110G05, transcript variant
FT                   mCT9448"
FT                   /note="gene_id=mCG8854.2 transcript_id=mCT9448.2 created on
FT                   10-JUN-2003"
FT   CDS             complement(join(23768402..23768647,23768687..23768857,
FT                   23771948..23772075,23776463..23777100,23780808..>23780950))
FT                   /codon_start=1
FT                   /gene="B430110G05Rik"
FT                   /locus_tag="mCG_8854"
FT                   /product="RIKEN cDNA B430110G05, isoform CRA_b"
FT                   /note="gene_id=mCG8854.2 transcript_id=mCT190923.0
FT                   protein_id=mCP111931.0 isoform=CRA_b"
FT                   /protein_id="EDL15282.1"
FT                   /translation="EGKRPRCLGVLKDQRYLRFNLSRRQWISVCSAGLHRHGKPLCSFG
FT                   NERSPGTMEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRLQVQKGKS
FT                   LYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADYSQSNTVK
FT                   SLVAGGSASLVAQSITVPIDVVSQHLMMQRKGEKMGRFQVHGNLEGQGVIAFGQTKDII
FT                   RQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSRLCPQECPHIVFQAISG
FT                   PLAAATASILTNPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLMKGLSARIISATPS
FT                   TIVIVVGYESLKKLSLRPELAVVSHITLGQGRAERITDPVNTTTTHPSCSRLSVRDKRG
FT                   DFGLLLLQRFCAWLPSSPSFDFPCRSGPLTRSLYSVMATGPR"
FT   CDS             complement(join(23768666..23768857,23771948..23772075,
FT                   23776463..23777100,23780690..23780733))
FT                   /codon_start=1
FT                   /gene="B430110G05Rik"
FT                   /locus_tag="mCG_8854"
FT                   /product="RIKEN cDNA B430110G05, isoform CRA_c"
FT                   /note="gene_id=mCG8854.2 transcript_id=mCT9448.2
FT                   protein_id=mCP22817.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q3TMC4"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="MGI:MGI:2444391"
FT                   /db_xref="UniProtKB/TrEMBL:Q3TMC4"
FT                   /protein_id="EDL15283.1"
FT                   /translation="MPGDSELAVQEPDRRSPGTMEDKRNIQIIEWEHLDKKKFYVFGVA
FT                   MTMMIRVSVYPFTLIRTRLQVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLI
FT                   SGQCYVTTYELTRKFVADYSQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQRKGE
FT                   KMGRFQVHGNLEGQGVIAFGQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPF
FT                   YHFYAEQLSRLCPQECPHIVFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSIVLTF
FT                   RQLMAEEGPWGLMKGLSARIISATPSTIVIVVGYESLKKLSLRPELVDSRHW"
FT   CDS             complement(join(23768666..23768857,23771948..23772075,
FT                   23776463..23777087))
FT                   /codon_start=1
FT                   /gene="B430110G05Rik"
FT                   /locus_tag="mCG_8854"
FT                   /product="RIKEN cDNA B430110G05, isoform CRA_a"
FT                   /note="gene_id=mCG8854.2 transcript_id=mCT185664.0
FT                   protein_id=mCP106922.0 isoform=CRA_a"
FT                   /protein_id="EDL15281.1"
FT                   /translation="MEDKRNIQIIEWEHLDKKKFYVFGVAMTMMIRVSVYPFTLIRTRL
FT                   QVQKGKSLYHGTFDAFVKILRADGVAGLYRGFLVNTFTLISGQCYVTTYELTRKFVADY
FT                   SQSNTVKSLVAGGSASLVAQSITVPIDVVSQHLMMQRKGEKMGRFQVHGNLEGQGVIAF
FT                   GQTKDIIRQILRADGLRGFYRGYVASLLTYIPNSAVWWPFYHFYAEQLSRLCPQECPHI
FT                   VFQAISGPLAAATASILTNPMDVIRTRVQVEGKSSIVLTFRQLMAEEGPWGLMKGLSAR
FT                   IISATPSTIVIVVGYESLKKLSLRPELVDSRHW"
FT   gene            complement(23791919..23817435)
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /note="gene_id=mCG8826.1"
FT   mRNA            complement(join(23791919..23793209,23793760..23793857,
FT                   23794140..23794297,23794400..23794518,23796652..23796832,
FT                   23803945..23804095,23805634..23805806,23805942..23806066,
FT                   23806465..23806581,23807299..23807404,23807641..23807739,
FT                   23807973..23808035,23808924..23809084,23810632..23810799,
FT                   23817400..23817435))
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4A, transcript variant mCT9420"
FT                   /note="gene_id=mCG8826.1 transcript_id=mCT9420.0 created on
FT                   10-JUN-2003"
FT   mRNA            complement(join(23791919..23793209,23793760..23793857,
FT                   23794140..23794297,23794400..23794518,23796652..23796832,
FT                   23803945..23804095,23805634..23805806,23805942..23806066,
FT                   23806465..23806581,23807299..23807404,23807641..23807739,
FT                   23807973..23808035,23808924..23809084,23810632..23810799,
FT                   23815240..23815305))
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4A, transcript variant mCT181717"
FT                   /note="gene_id=mCG8826.1 transcript_id=mCT181717.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(23791919..23793209,23793760..23793857,
FT                   23794137..23794297,23794400..23794518,23796652..23796832,
FT                   23803945..23804095,23805634..23805806,23805942..23806066,
FT                   23806465..23806581,23807299..23807404,23807641..23807739,
FT                   23807973..23808035,23808924..23809084,23810632..23810799,
FT                   23815064..23815095))
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4A, transcript variant mCT181718"
FT                   /note="gene_id=mCG8826.1 transcript_id=mCT181718.1 created
FT                   on 10-JUN-2003"
FT   mRNA            complement(join(23791919..23793209,23793760..23793857,
FT                   23794140..23794297,23794400..23794518,23796652..23796832,
FT                   23803945..23804095,23805634..23805806,23805942..23806066,
FT                   23806465..23806581,23807299..23807404,23807641..23807739,
FT                   23807973..23808035,23808924..23809084,23810632..23810799,
FT                   23811501..23811694))
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4A, transcript variant mCT181719"
FT                   /note="gene_id=mCG8826.1 transcript_id=mCT181719.1 created
FT                   on 10-JUN-2003"
FT   CDS             complement(join(23792617..23793209,23793760..23793857,
FT                   23794140..23794297,23794400..23794518,23796652..23796832,
FT                   23803945..23804095,23805634..23805806,23805942..23806066,
FT                   23806465..23806581,23807299..23807404,23807641..23807739,
FT                   23807973..23808035,23808924..23809084,23810632..23810770))
FT                   /codon_start=1
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4A, isoform CRA_a"
FT                   /note="gene_id=mCG8826.1 transcript_id=mCT181717.1
FT                   protein_id=mCP104639.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q62178"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR002165"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:107560"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62178"
FT                   /protein_id="EDL15277.1"
FT                   /translation="MALPSLGQDSWSLLRVFFFQLFLLPSLPPASGTGGQGPMPRVKYH
FT                   AGDGHRALSFFQQKGLRDFDTLLLSDDGNTLYVGAREAVLALNIQNPGIPRLKNMIPWP
FT                   ASERKKTECAFKKKSNETQCFNFIRVLVSYNATHLYACGTFAFSPACTFIELQDSLLLP
FT                   ILIDKVMDGKGQSPFDPVHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDI
FT                   FLRWLHADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCKNDVGGEKLLQK
FT                   KWTTFLKAQLLCAQPGQLPFNIIRHAVLLPADSPSVSRIYAVFTSQWQVGGTRSSAVCA
FT                   FSLTDIERVFKGKYKELNKETSRWTTYRGSEVSPRPGSCSMGPSSDKALTFMKDHFLMD
FT                   EHVVGTPLLVKSGVEYTRLAVESARGLDGSSHVVMYLGTSTGSLHKAVVPQDSSAYLVE
FT                   EIQLSPDSEPVRNLQLAPAQGAVFAGFSGGIWRVPRANCSVYESCVDCVLARDPHCAWD
FT                   PESRLCSLLSGSTKPWKQDMERGNPEWVCTRGPMARSPRRQSPPQLIKEVLTVPNSILE
FT                   LPCPHLSALASYHWSHGRAKISEASATVYNGSLLLLPQDGVGGLYQCVATENGYSYPVV
FT                   SYWVDSQDQPLALDPELAGVPRERVQVPLTRVGGGASMAAQRSYWPHFLIVTVLLAIVL
FT                   LGVLTLLLASPLGALRARGKVQGCGMLPPREKAPLSRDQHLQPSKDHRTSASDVDADNN
FT                   HLGAEVA"
FT   CDS             complement(join(23792617..23793209,23793760..23793857,
FT                   23794140..23794297,23794400..23794518,23796652..23796832,
FT                   23803945..23804095,23805634..23805806,23805942..23806066,
FT                   23806465..23806581,23807299..23807404,23807641..23807739,
FT                   23807973..23808035,23808924..23809084,23810632..23810770))
FT                   /codon_start=1
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4A, isoform CRA_a"
FT                   /note="gene_id=mCG8826.1 transcript_id=mCT181719.1
FT                   protein_id=mCP104641.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q62178"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR002165"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:107560"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62178"
FT                   /protein_id="EDL15278.1"
FT                   /translation="MALPSLGQDSWSLLRVFFFQLFLLPSLPPASGTGGQGPMPRVKYH
FT                   AGDGHRALSFFQQKGLRDFDTLLLSDDGNTLYVGAREAVLALNIQNPGIPRLKNMIPWP
FT                   ASERKKTECAFKKKSNETQCFNFIRVLVSYNATHLYACGTFAFSPACTFIELQDSLLLP
FT                   ILIDKVMDGKGQSPFDPVHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDI
FT                   FLRWLHADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCKNDVGGEKLLQK
FT                   KWTTFLKAQLLCAQPGQLPFNIIRHAVLLPADSPSVSRIYAVFTSQWQVGGTRSSAVCA
FT                   FSLTDIERVFKGKYKELNKETSRWTTYRGSEVSPRPGSCSMGPSSDKALTFMKDHFLMD
FT                   EHVVGTPLLVKSGVEYTRLAVESARGLDGSSHVVMYLGTSTGSLHKAVVPQDSSAYLVE
FT                   EIQLSPDSEPVRNLQLAPAQGAVFAGFSGGIWRVPRANCSVYESCVDCVLARDPHCAWD
FT                   PESRLCSLLSGSTKPWKQDMERGNPEWVCTRGPMARSPRRQSPPQLIKEVLTVPNSILE
FT                   LPCPHLSALASYHWSHGRAKISEASATVYNGSLLLLPQDGVGGLYQCVATENGYSYPVV
FT                   SYWVDSQDQPLALDPELAGVPRERVQVPLTRVGGGASMAAQRSYWPHFLIVTVLLAIVL
FT                   LGVLTLLLASPLGALRARGKVQGCGMLPPREKAPLSRDQHLQPSKDHRTSASDVDADNN
FT                   HLGAEVA"
FT   CDS             complement(join(23792617..23793209,23793760..23793857,
FT                   23794140..23794297,23794400..23794518,23796652..23796832,
FT                   23803945..23804095,23805634..23805806,23805942..23806066,
FT                   23806465..23806581,23807299..23807404,23807641..23807739,
FT                   23807973..23808035,23808924..23809084,23810632..23810770))
FT                   /codon_start=1
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4A, isoform CRA_a"
FT                   /note="gene_id=mCG8826.1 transcript_id=mCT9420.0
FT                   protein_id=mCP22863.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q62178"
FT                   /db_xref="InterPro:IPR001627"
FT                   /db_xref="InterPro:IPR002165"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016201"
FT                   /db_xref="InterPro:IPR027231"
FT                   /db_xref="MGI:MGI:107560"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q62178"
FT                   /protein_id="EDL15279.1"
FT                   /translation="MALPSLGQDSWSLLRVFFFQLFLLPSLPPASGTGGQGPMPRVKYH
FT                   AGDGHRALSFFQQKGLRDFDTLLLSDDGNTLYVGAREAVLALNIQNPGIPRLKNMIPWP
FT                   ASERKKTECAFKKKSNETQCFNFIRVLVSYNATHLYACGTFAFSPACTFIELQDSLLLP
FT                   ILIDKVMDGKGQSPFDPVHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDI
FT                   FLRWLHADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCKNDVGGEKLLQK
FT                   KWTTFLKAQLLCAQPGQLPFNIIRHAVLLPADSPSVSRIYAVFTSQWQVGGTRSSAVCA
FT                   FSLTDIERVFKGKYKELNKETSRWTTYRGSEVSPRPGSCSMGPSSDKALTFMKDHFLMD
FT                   EHVVGTPLLVKSGVEYTRLAVESARGLDGSSHVVMYLGTSTGSLHKAVVPQDSSAYLVE
FT                   EIQLSPDSEPVRNLQLAPAQGAVFAGFSGGIWRVPRANCSVYESCVDCVLARDPHCAWD
FT                   PESRLCSLLSGSTKPWKQDMERGNPEWVCTRGPMARSPRRQSPPQLIKEVLTVPNSILE
FT                   LPCPHLSALASYHWSHGRAKISEASATVYNGSLLLLPQDGVGGLYQCVATENGYSYPVV
FT                   SYWVDSQDQPLALDPELAGVPRERVQVPLTRVGGGASMAAQRSYWPHFLIVTVLLAIVL
FT                   LGVLTLLLASPLGALRARGKVQGCGMLPPREKAPLSRDQHLQPSKDHRTSASDVDADNN
FT                   HLGAEVA"
FT   CDS             complement(join(23792617..23793209,23793760..23793857,
FT                   23794137..23794297,23794400..23794518,23796652..23796832,
FT                   23803945..23804095,23805634..23805806,23805942..23806066,
FT                   23806465..23806581,23807299..23807404,23807641..23807739,
FT                   23807973..23808035,23808924..23809084,23810632..23810770))
FT                   /codon_start=1
FT                   /gene="Sema4a"
FT                   /locus_tag="mCG_8826"
FT                   /product="sema domain, immunoglobulin domain (Ig),
FT                   transmembrane domain (TM) and short cytoplasmic domain,
FT                   (semaphorin) 4A, isoform CRA_b"
FT                   /note="gene_id=mCG8826.1 transcript_id=mCT181718.1
FT                   protein_id=mCP104640.1 isoform=CRA_b"
FT                   /protein_id="EDL15280.1"
FT                   /translation="MALPSLGQDSWSLLRVFFFQLFLLPSLPPASGTGGQGPMPRVKYH
FT                   AGDGHRALSFFQQKGLRDFDTLLLSDDGNTLYVGAREAVLALNIQNPGIPRLKNMIPWP
FT                   ASERKKTECAFKKKSNETQCFNFIRVLVSYNATHLYACGTFAFSPACTFIELQDSLLLP
FT                   ILIDKVMDGKGQSPFDPVHKHTAVLVDGMLYSGTMNNFLGSEPILMRTLGSQPVLKTDI
FT                   FLRWLHADASFVAAIPSTQVVYFFFEETASEFDFFEELYISRVAQVCKNDVGGEKLLQK
FT                   KWTTFLKAQLLCAQPGQLPFNIIRHAVLLPADSPSVSRIYAVFTSQWQVGGTRSSAVCA
FT                   FSLTDIERVFKGKYKELNKETSRWTTYRGSEVSPRPGSCSMGPSSDKALTFMKDHFLMD
FT                   EHVVGTPLLVKSGVEYTRLAVESARGLDGSSHVVMYLGTSTGSLHKAVVPQDSSAYLVE
FT                   EIQLSPDSEPVRNLQLAPAQGAVFAGFSGGIWRVPRANCSVYESCVDCVLARDPHCAWD
FT                   PESRLCSLLSGSTKWPWKQDMERGNPEWVCTRGPMARSPRRQSPPQLIKEVLTVPNSIL
FT                   ELPCPHLSALASYHWSHGRAKISEASATVYNGSLLLLPQDGVGGLYQCVATENGYSYPV
FT                   VSYWVDSQDQPLALDPELAGVPRERVQVPLTRVGGGASMAAQRSYWPHFLIVTVLLAIV
FT                   LLGVLTLLLASPLGALRARGKVQGCGMLPPREKAPLSRDQHLQPSKDHRTSASDVDADN
FT                   NHLGAEVA"
FT   gene            complement(23837421..23859583)
FT                   /gene="Lmna"
FT                   /locus_tag="mCG_8830"
FT                   /note="gene_id=mCG8830.2"
FT   mRNA            complement(join(23837421..23838371,23838617..23838883,
FT                   23839589..23839684,23840098..23840217,23840318..23840425,
FT                   23840886..23841108,23841198..23841418,23842475..23842600,
FT                   23842731..23842901,23843079..23843204,23844546..23844702,
FT                   23859024..23859583))
FT                   /gene="Lmna"
FT                   /locus_tag="mCG_8830"
FT                   /product="lamin A, transcript variant mCT171983"
FT                   /note="gene_id=mCG8830.2 transcript_id=mCT171983.0 created
FT                   on 09-AUG-2002"
FT   CDS             complement(join(23838345..23838371,23838617..23838883,
FT                   23839589..23839684,23840098..23840217,23840318..23840425,
FT                   23840886..23841108,23841198..23841418,23842475..23842600,
FT                   23842731..23842901,23843079..23843204,23844546..23844702,
FT                   23859024..23859379))
FT                   /codon_start=1
FT                   /gene="Lmna"
FT                   /locus_tag="mCG_8830"
FT                   /product="lamin A, isoform CRA_a"
FT                   /note="gene_id=mCG8830.2 transcript_id=mCT171983.0
FT                   protein_id=mCP94902.0 isoform=CRA_a"
FT                   /db_xref="GOA:P48678"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR001664"
FT                   /db_xref="InterPro:IPR018039"
FT                   /db_xref="MGI:MGI:96794"
FT                   /db_xref="PDB:1UFG"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48678"
FT                   /protein_id="EDL15275.1"
FT                   /translation="METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVY
FT                   IDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQL
FT                   ELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELH
FT                   DLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRH
FT                   ETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERN
FT                   SNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAE
FT                   KEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSR
FT                   GRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKS
FT                   NEDQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWASGAGATHSPPTDLVWKAQ
FT                   NTWGCGSSLRTALINSTGEEVAMRKLVRSLTMVEDNEDDDEDGEELLHHHRGSHCSGSG
FT                   DPAEYNLRSRTVLCGTCGQPADKAAGGAGAQVGGSISSGSSASSVTVTRSFRSVGGSGG
FT                   GSFGDNLVTRSYLLGNSSPRSQSSQNCSIM"
FT   mRNA            complement(join(23839477..23839684,23840098..23840217,
FT                   23840318..23840425,23840886..23841108,23841198..23841418,
FT                   23842475..23842600,23842731..23842901,23843079..23843204,
FT                   23844546..23844702,23849518..23849593))
FT                   /gene="Lmna"
FT                   /locus_tag="mCG_8830"
FT                   /product="lamin A, transcript variant mCT9424"
FT                   /note="gene_id=mCG8830.2 transcript_id=mCT9424.0 created on
FT                   08-AUG-2002"
FT   CDS             complement(join(23839568..23839684,23840098..23840217,
FT                   23840318..23840425,23840886..23841108,23841198..23841418,
FT                   23842475..23842600,23842731..23842901,23843079..23843204,
FT                   23844546..23844702,23849518..23849537))
FT                   /codon_start=1
FT                   /gene="Lmna"
FT                   /locus_tag="mCG_8830"
FT                   /product="lamin A, isoform CRA_b"
FT                   /note="gene_id=mCG8830.2 transcript_id=mCT9424.0
FT                   protein_id=mCP22812.1 isoform=CRA_b"
FT                   /protein_id="EDL15276.1"
FT                   /translation="MGNAEGRNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRT
FT                   LEGELHDLRGQVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELR
FT                   ETKRRHETRLVEIDNGKQREFESRLADALQELRAQHEDQVEQYKKELEKTYSAKLDNAR
FT                   QSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTS
FT                   RRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSP
FT                   TSQRSRGRASSHSSQSQGGGSVTKKRKLESSESRSSFSQHARTSGRVAVEEVDEEGKFV
FT                   RLRNKSNEDQSMGNWQIRRQNGDDPLMTYRFPPKFTLKAGQVVTIWASGAGATHSPPTD
FT                   LVWKAQNTWGCGSSLRTALINSTGEEVAMRKLVRSLTMVEDNEDDDEDGEELLHHHRVS
FT                   GSRR"
FT   gene            complement(23898153..>23904410)
FT                   /gene="Rab25"
FT                   /locus_tag="mCG_8834"
FT                   /note="gene_id=mCG8834.3"
FT   mRNA            complement(join(23898153..23898493,23898824..23898904,
FT                   23899443..23899636,23901184..23901379,23903748..23903894,
FT                   23904159..>23904410))
FT                   /gene="Rab25"
FT                   /locus_tag="mCG_8834"
FT                   /product="RAB25, member RAS oncogene family, transcript
FT                   variant mCT181566"
FT                   /note="gene_id=mCG8834.3 transcript_id=mCT181566.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(23898160..23898493,23898824..23898904,
FT                   23899443..23899636,23901184..23901379,23904159..23904406))
FT                   /gene="Rab25"
FT                   /locus_tag="mCG_8834"
FT                   /product="RAB25, member RAS oncogene family, transcript
FT                   variant mCT9427"
FT                   /note="gene_id=mCG8834.3 transcript_id=mCT9427.2 created on
FT                   25-MAR-2003"
FT   CDS             complement(join(23898366..23898493,23898824..23898904,
FT                   23899443..23899636,23901184..23901379,23904159..23904201))
FT                   /codon_start=1
FT                   /gene="Rab25"
FT                   /locus_tag="mCG_8834"
FT                   /product="RAB25, member RAS oncogene family, isoform CRA_b"
FT                   /note="gene_id=mCG8834.3 transcript_id=mCT9427.2
FT                   protein_id=mCP22821.2 isoform=CRA_b"
FT                   /db_xref="GOA:Q0PD30"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR003579"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:1858203"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PD30"
FT                   /protein_id="EDL15274.1"
FT                   /translation="MGNRTDEDYNFVFKVVLIGESGVGKTNLLSRFTRNEFSHDSRTTI
FT                   GVEFSTRTVMLGTAAVKAQIWDTAGLERYRAITSAYYRGAVGALLVFDLTKHQTYAVVE
FT                   RWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEACMFAENNGLLFLETSALDSTNVE
FT                   LAFQTVLKEIFAKVSKQKQNSTRTSAITLGNAQAGQDPGPGEKRACCISL"
FT   CDS             complement(join(23898366..23898493,23898824..23898904,
FT                   23899443..23899636,23901184..23901379,23903748..>23903856))
FT                   /codon_start=1
FT                   /gene="Rab25"
FT                   /locus_tag="mCG_8834"
FT                   /product="RAB25, member RAS oncogene family, isoform CRA_a"
FT                   /note="gene_id=mCG8834.3 transcript_id=mCT181566.0
FT                   protein_id=mCP104488.0 isoform=CRA_a"
FT                   /protein_id="EDL15273.1"
FT                   /translation="SPRDGSRTSERTFRVEGEASLFKRKKVISTSRCVGRVVLIGESGV
FT                   GKTNLLSRFTRNEFSHDSRTTIGVEFSTRTVMLGTAAVKAQIWDTAGLERYRAITSAYY
FT                   RGAVGALLVFDLTKHQTYAVVERWLKELYDHAEATIVVMLVGNKSDLSQAREVPTEEAC
FT                   MFAENNGLLFLETSALDSTNVELAFQTVLKEIFAKVSKQKQNSTRTSAITLGNAQAGQD
FT                   PGPGEKRACCISL"
FT   gene            complement(23906033..23909033)
FT                   /gene="Mapbpip"
FT                   /locus_tag="mCG_8835"
FT                   /note="gene_id=mCG8835.1"
FT   mRNA            complement(join(23906033..23906130,23906822..23906911,
FT                   23908491..23908653,23908932..23909033))
FT                   /gene="Mapbpip"
FT                   /locus_tag="mCG_8835"
FT                   /product="mitogen activated protein binding protein
FT                   interacting protein"
FT                   /note="gene_id=mCG8835.1 transcript_id=mCT9428.1 created on
FT                   08-AUG-2002"
FT   CDS             complement(join(23906074..23906130,23906822..23906911,
FT                   23908491..23908653,23908932..23908999))
FT                   /codon_start=1
FT                   /gene="Mapbpip"
FT                   /locus_tag="mCG_8835"
FT                   /product="mitogen activated protein binding protein
FT                   interacting protein"
FT                   /note="gene_id=mCG8835.1 transcript_id=mCT9428.1
FT                   protein_id=mCP22858.2"
FT                   /protein_id="EDL15272.1"
FT                   /translation="MLRPKALTQVLSQANTGGVQSTLLLNNEGSLLAYSGYGDTDARVT
FT                   AAIASNIWAAYDRNGNQAFNEDSLKFILMDCMEGRVAITRVANLLLCMYAKETVGFGML
FT                   KAKAQALVQYLEEPLTQVAAS"
FT   gene            23909852..23925854
FT                   /gene="Ubqln4"
FT                   /locus_tag="mCG_8833"
FT                   /note="gene_id=mCG8833.1"
FT   mRNA            join(23909852..23910051,23911473..23911624,
FT                   23911925..23912127,23912790..23913052,23915742..23915900,
FT                   23919225..23919450,23920488..23920627,23921125..23921208,
FT                   23921331..23921446,23921821..23922007,23924211..23925854)
FT                   /gene="Ubqln4"
FT                   /locus_tag="mCG_8833"
FT                   /product="ubiquilin 4"
FT                   /note="gene_id=mCG8833.1 transcript_id=mCT9429.1 created on
FT                   08-AUG-2002"
FT   CDS             join(23909944..23910051,23911473..23911624,
FT                   23911925..23912127,23912790..23913052,23915742..23915900,
FT                   23919225..23919450,23920488..23920627,23921125..23921208,
FT                   23921331..23921446,23921821..23922007,23924211..23924363)
FT                   /codon_start=1
FT                   /gene="Ubqln4"
FT                   /locus_tag="mCG_8833"
FT                   /product="ubiquilin 4"
FT                   /note="gene_id=mCG8833.1 transcript_id=mCT9429.1
FT                   protein_id=mCP22849.2"
FT                   /protein_id="EDL15271.1"
FT                   /translation="MAEPSGAETRPQIRVTVKTPKDKEEIVICDQASVKEFKEEISRRF
FT                   KAQQDQLVLIFAGKILKDGDTLSQHGIKDGLTVHLVIKTPQKAQDPVTAAASPPSTPDS
FT                   ASAPSTTPASPAAAPVQPCSSGNTTSDAGSGGGPSPVAAEGPSSATASILSGFGGILGL
FT                   GSLGLGSANFMELQQQMQRQLMSNPEMLSQIMENPLVQDMMSNPDLMRHMIMANPQMQQ
FT                   LMERNPEISHMLNNPELMRQTMELARNPAMMQEMMRNQDRALSNLESVPGGYNALRRMY
FT                   TDIQEPMFTAAREQFGNNPFSSLAGNSDNSSSQPLRTENREPLPNPWSPSPPTSQAPGS
FT                   GGEGTGGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAP
FT                   YMRTMMQTLAQNPDFAAQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNP
FT                   RAMQALLQIQQGLQTLQTEAPGLVPSLGSFGTPRTSVPLAGSNSGSSAEAPTSSPGVPA
FT                   TSPPSAGSNAQQQLMQQMIQLLSGSGNSQVPMPEVRFQQQLEQLNSMGFINREANLQAL
FT                   IATGGDINAAIERLLGSQLS"
FT   gene            complement(23932347..23933300)
FT                   /locus_tag="mCG_8837"
FT                   /note="gene_id=mCG8837.1"
FT   mRNA            complement(23932347..23933300)
FT                   /locus_tag="mCG_8837"
FT                   /product="mCG8837"
FT                   /note="gene_id=mCG8837.1 transcript_id=mCT9431.1 created on
FT                   31-OCT-2002"
FT   CDS             complement(23932517..23933251)
FT                   /codon_start=1
FT                   /locus_tag="mCG_8837"
FT                   /product="mCG8837"
FT                   /note="gene_id=mCG8837.1 transcript_id=mCT9431.1
FT                   protein_id=mCP22822.2"
FT                   /db_xref="InterPro:IPR019265"
FT                   /db_xref="MGI:MGI:3642446"
FT                   /db_xref="UniProtKB/TrEMBL:J3QNB0"
FT                   /protein_id="EDL15270.1"
FT                   /translation="MFRRKLTALDYHNPSGFKCKDETEFRNFNVWLEDQKIRHYKIEDR
FT                   GNLRNIHSSDWPKFFEKYLKDVNCPFKIQDQQEAIDWLLGLAVRLEYGDNAEKYKDLVP
FT                   DNRKNTDNAAKNAEPLINLDVNNPDFKAGVMALANLLQIQHHDDYLVMLKAIRILVQER
FT                   LTQDAVAKANQTKEGLPVALGKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEA
FT                   IVAVQAIIADPKTDHRLGKVGR"
FT   gene            23935715..23944796
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /note="gene_id=mCG8842.2"
FT   mRNA            join(23935715..23935794,23935988..23936142,
FT                   23937082..23937180,23939852..23939960,23943241..23943318,
FT                   23944257..23944795)
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /product="signal sequence receptor, beta, transcript
FT                   variant mCT9436"
FT                   /note="gene_id=mCG8842.2 transcript_id=mCT9436.1 created on
FT                   25-MAR-2003"
FT   mRNA            join(23935749..23935794,23935988..23936142,
FT                   23937082..23937146,23939875..23939960,23943241..23943318,
FT                   23944257..23944395)
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /product="signal sequence receptor, beta, transcript
FT                   variant mCT181568"
FT                   /note="gene_id=mCG8842.2 transcript_id=mCT181568.0 created
FT                   on 25-MAR-2003"
FT   mRNA            join(<23935777..23936142,23937082..23937180,
FT                   23939852..23939960,23943241..23943318,23944257..23944789)
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /product="signal sequence receptor, beta, transcript
FT                   variant mCT190954"
FT                   /note="gene_id=mCG8842.2 transcript_id=mCT190954.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<23935835..23936142,23937082..23937180,
FT                   23939852..23939960,23943241..23943318,23944257..23944367)
FT                   /codon_start=1
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /product="signal sequence receptor, beta, isoform CRA_c"
FT                   /note="gene_id=mCG8842.2 transcript_id=mCT190954.0
FT                   protein_id=mCP111927.0 isoform=CRA_c"
FT                   /protein_id="EDL15268.1"
FT                   /translation="PRLAGSAVHTAVAWARGCGPGGGAGVWRRTGCLAGSVSHAWVDCS
FT                   LCFFPKMRLLAVVVLALLAVSQAEEGARLLASKSLLNRYAVEGRDLTLQYNIYNVGSSA
FT                   ALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFNFTSATITY
FT                   LAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSS
FT                   KRKYDTPKPKKN"
FT   mRNA            join(<23935988..23936142,23937082..23937094,
FT                   23943268..23943318,23944257..23944796)
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /product="signal sequence receptor, beta, transcript
FT                   variant mCT181567"
FT                   /note="gene_id=mCG8842.2 transcript_id=mCT181567.0 created
FT                   on 25-MAR-2003"
FT   CDS             join(23935988..23936142,23937082..23937180,
FT                   23939852..23939960,23943241..23943318,23944257..23944367)
FT                   /codon_start=1
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /product="signal sequence receptor, beta, isoform CRA_d"
FT                   /note="gene_id=mCG8842.2 transcript_id=mCT9436.1
FT                   protein_id=mCP22853.2 isoform=CRA_d"
FT                   /protein_id="EDL15269.1"
FT                   /translation="MRLLAVVVLALLAVSQAEEGARLLASKSLLNRYAVEGRDLTLQYN
FT                   IYNVGSSAALDVELSDDSFPPEDFGIVSGMLNVKWDRIAPASNVSHTVVLRPLKAGYFN
FT                   FTSATITYLAQEDGPVVIGSTSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGI
FT                   PLLLWYSSKRKYDTPKPKKN"
FT   CDS             join(23935988..23936142,23937082..23937146,
FT                   23939875..23939960,23943241..23943318,23944257..23944367)
FT                   /codon_start=1
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /product="signal sequence receptor, beta, isoform CRA_b"
FT                   /note="gene_id=mCG8842.2 transcript_id=mCT181568.0
FT                   protein_id=mCP104490.0 isoform=CRA_b"
FT                   /protein_id="EDL15267.1"
FT                   /translation="MRLLAVVVLALLAVSQAEEGARLLASKSLLNRYAVEGRDLTLQYN
FT                   IYNVGSSAALDVELSDDSFPPEDFGIVSVVLRPLKAGYFNFTSATITYLAQEDGPVVIG
FT                   STSAPGQGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTPKPKK
FT                   N"
FT   CDS             join(23935988..23936142,23937082..23937094,
FT                   23943268..23943318,23944257..23944367)
FT                   /codon_start=1
FT                   /gene="Ssr2"
FT                   /locus_tag="mCG_8842"
FT                   /product="signal sequence receptor, beta, isoform CRA_a"
FT                   /note="gene_id=mCG8842.2 transcript_id=mCT181567.0
FT                   protein_id=mCP104489.0 isoform=CRA_a"
FT                   /protein_id="EDL15266.1"
FT                   /translation="MRLLAVVVLALLAVSQAEEGARLLASKSLLNRYAVEGRDLTLQYN
FT                   IYNVGSSAALDGGILAQREFDRRFSPHFLDWAAFGVMTLPSIGIPLLLWYSSKRKYDTP
FT                   KPKKN"
FT   gene            <23963875..24004497
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /note="gene_id=mCG8844.3"
FT   mRNA            join(<23963875..23964156,23970714..23970831,
FT                   23971689..23971728,23972770..23972863,23985990..23986134,
FT                   23988114..23988181,23988479..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995770,23996561..23996628,
FT                   23998700..23998900,23999200..23999313,23999423..23999490,
FT                   23999619..23999654,23999836..23999886,24000064..24000507,
FT                   24002451..24002634,24003064..24004487)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT171984"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT171984.1 created
FT                   on 07-NOV-2003"
FT   mRNA            join(23964011..23964156,23970714..23970831,
FT                   23971689..23971728,23972770..23972863,23985990..23986134,
FT                   23988114..23988181,23988479..23988536,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995770,23996561..23996628,
FT                   23998700..23998900,23999200..23999490,23999619..23999654,
FT                   23999836..23999886,24000064..24000507,24002451..24002634,
FT                   24003064..24004324)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT186808"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186808.0 created
FT                   on 07-NOV-2003"
FT   CDS             join(<23964013..23964156,23970714..23970831,
FT                   23971689..23971728,23972770..23972863,23985990..23986134,
FT                   23988114..23988181,23988479..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995770,23996561..23996628,
FT                   23998700..23998900,23999200..23999313,23999423..23999490,
FT                   23999619..23999654,23999836..23999886,24000064..24000507,
FT                   24002451..24002634,24003064..24003137)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_a"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT171984.1
FT                   protein_id=mCP94903.0 isoform=CRA_a"
FT                   /protein_id="EDL15256.1"
FT                   /translation="RRLQSSECPGSQEAPFLQSLEELGTPLGAQQQEQQQGQEQQRGQP
FT                   FHRGQSFCYPSAASSVPSVTGMLSKAVSMSDINLLSDCSDPNGNSPQSYVTDLSKCGKQ
FT                   LEEDSGTWAGSSLRRTFSFLLGMTGRDKTREKEKMKEAKDARYTNGHLFTTISVSGMTM
FT                   CYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLRNNTALQSVSLR
FT                   SKTTTRERPTSAIYPSDSFRQSLLGSRRGLSSLSLAKSVSTTNIAGHFNDESPLGLRQI
FT                   LSQSTDSLNMRNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDSSFLQQ
FT                   HKKEVMKKQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPCVDELS
FT                   DIHTRFLNQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHT
FT                   KALKLYKELYARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNS
FT                   HGVEEEYQDLASALGLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFG
FT                   RDELLRRKLIHEGCLLWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKPSVVSL
FT                   QNLIVRDIANQAKGMFLISSGPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSREDFPLI
FT                   ETEDKAYLRRIKTKLQQKNQALVELLQKNVELFAEMVHFQALKAGFVGMPPPALPRGLF
FT                   RLESFESLRGERLLKDALREVEGLKDLLLGPCVDLPMTSREPALPLDSDSGSCPGVTAN
FT                   GEARTFNGSIELCRADSDSSQKDRNGNQLRSPQEEVLQPLINLYGLLHGLQAVVVQQER
FT                   LMEALFPEGPERWEKLSRANSRDGEAGRAAVASVTPEKQATELALLQRQHTLLQEELRR
FT                   CQRLGEERATEAGSLEARLRESEQARALLEREAEEIRRQLAALGQNEPLPAEAPWARRP
FT                   LDPRRRSLPAGDALYLSFNPPQPSRGHDRLDLPVTVRSLHRPFDDREAQELGSPEDRLQ
FT                   DSSDPDTGSEEEVSSRLSPPHSPRDFTRMQDIPEETESRDGEPTASES"
FT   CDS             join(23970768..23970831,23971689..23971728,
FT                   23972770..23972863,23985990..23986134,23988114..23988181,
FT                   23988479..23988536,23989116..23989245,23989461..23989570,
FT                   23989703..23989849,23990613..23990863,23991186..23991311,
FT                   23991804..23991921,23992058..23992306,23994579..23994655,
FT                   23995601..23995770,23996561..23996628,23998700..23998900,
FT                   23999200..23999330)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_f"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186808.0
FT                   protein_id=mCP108041.0 isoform=CRA_f"
FT                   /protein_id="EDL15262.1"
FT                   /translation="MLSKAVSMSDINLLSDCSDPNGNSPQSYVTDLSKCGKQLEEDSGT
FT                   WAGSSLRRTFSFLLGMTGRDKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKS
FT                   ITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLRNNTALQSVSLRTTTRERP
FT                   TSAIYPSDSFRQSLLGSRRGLSSLSLAKSVSTTNIAGHFNDESPLGLRQILSQSTDSLN
FT                   MRNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDSSFLQQHKKEVMKKQ
FT                   DVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPCVDELSDIHTRFLNQ
FT                   LLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHTKALKLYKEL
FT                   YARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNSHGVEEEYQD
FT                   LASALGLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGRDELLRRKL
FT                   IHEGCLLWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKPSVVSLQNLIVRDIA
FT                   NQAKGMFLISSGPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSREDFPLIETEDKAYLR
FT                   RIKTKLQQKNQALVELLQKNVELFAEMVHFQALKAGFVGMPPPALPRGLFRLESFESLR
FT                   GERLLKDALREVEGLKDLLLGPCVDLPMTSREPALPLDSDSGSCPGVTASEYGA"
FT   mRNA            join(23971624..23971728,23972770..23972863,
FT                   23985990..23986134,23988114..23988181,23988479..23988542,
FT                   23989116..23989245,23989461..23989570,23989703..23989849,
FT                   23990613..23990863,23991186..23991311,23991804..23991921,
FT                   23992058..23992306,23994579..23994655,23995601..23995770,
FT                   23996561..23996628,23998700..23998900,23999200..23999313,
FT                   23999423..23999490,23999619..23999654,23999836..23999886,
FT                   24000064..24000507,24002451..24002634,24003064..24004497)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT186802"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186802.0 created
FT                   on 07-NOV-2003"
FT   mRNA            join(23972458..23972665,23972770..23972863,
FT                   23985990..23986134,23988114..23988181,23988479..23988542,
FT                   23989116..23989245,23989498..23989570,23989703..23989849,
FT                   23990613..23990863,23991186..23991311,23991804..23991921,
FT                   23992058..23992306,23994579..23994655,23995601..23995770,
FT                   23996561..23996628,23998700..23998900,23999200..23999313,
FT                   23999423..23999490,23999619..23999654,23999836..23999886,
FT                   24000064..24000507,24002451..24002634,24003064..24004324)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT186805"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186805.0 created
FT                   on 07-NOV-2003"
FT   CDS             join(23972846..23972863,23985990..23986134,
FT                   23988114..23988181,23988479..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995770,23996561..23996628,
FT                   23998700..23998900,23999200..23999313,23999423..23999490,
FT                   23999619..23999654,23999836..23999886,24000064..24000507,
FT                   24002451..24002634,24003064..24003137)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_b"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186802.0
FT                   protein_id=mCP108042.0 isoform=CRA_b"
FT                   /db_xref="GOA:H3BJ40"
FT                   /db_xref="InterPro:IPR000219"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002219"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR015721"
FT                   /db_xref="MGI:MGI:103264"
FT                   /db_xref="UniProtKB/TrEMBL:H3BJ40"
FT                   /protein_id="EDL15257.1"
FT                   /translation="MTGRDKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
FT                   TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLRNNTALQSVSLRSKTTTRER
FT                   PTSAIYPSDSFRQSLLGSRRGLSSLSLAKSVSTTNIAGHFNDESPLGLRQILSQSTDSL
FT                   NMRNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDSSFLQQHKKEVMKK
FT                   QDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPCVDELSDIHTRFLN
FT                   QLLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHTKALKLYKE
FT                   LYARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNSHGVEEEYQ
FT                   DLASALGLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGRDELLRRK
FT                   LIHEGCLLWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKPSVVSLQNLIVRDI
FT                   ANQAKGMFLISSGPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSREDFPLIETEDKAYL
FT                   RRIKTKLQQKNQALVELLQKNVELFAEMVHFQALKAGFVGMPPPALPRGLFRLESFESL
FT                   RGERLLKDALREVEGLKDLLLGPCVDLPMTSREPALPLDSDSGSCPGVTANGEARTFNG
FT                   SIELCRADSDSSQKDRNGNQLRSPQEEVLQPLINLYGLLHGLQAVVVQQERLMEALFPE
FT                   GPERWEKLSRANSRDGEAGRAAVASVTPEKQATELALLQRQHTLLQEELRRCQRLGEER
FT                   ATEAGSLEARLRESEQARALLEREAEEIRRQLAALGQNEPLPAEAPWARRPLDPRRRSL
FT                   PAGDALYLSFNPPQPSRGHDRLDLPVTVRSLHRPFDDREAQELGSPEDRLQDSSDPDTG
FT                   SEEEVSSRLSPPHSPRDFTRMQDIPEETESRDGEPTASES"
FT   mRNA            join(23977333..23977516,23985990..23986134,
FT                   23988114..23988181,23988479..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995814)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT9438"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT9438.1 created on
FT                   07-NOV-2003"
FT   CDS             join(23977454..23977516,23985990..23986134,
FT                   23988114..23988181,23988479..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995774)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_g"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT9438.1
FT                   protein_id=mCP22862.1 isoform=CRA_g"
FT                   /protein_id="EDL15263.1"
FT                   /translation="MSRIESLTRARIDRSKEQATKTREKEKMKEAKDARYTNGHLFTTI
FT                   SVSGMTMCYACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLRNNTA
FT                   LQSVSLRSKTTTRERPTSAIYPSDSFRQSLLGSRRGLSSLSLAKSVSTTNIAGHFNDES
FT                   PLGLRQILSQSTDSLNMRNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAV
FT                   DSSFLQQHKKEVMKKQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLF
FT                   PCVDELSDIHTRFLNQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYS
FT                   EFCSRHTKALKLYKELYARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLI
FT                   NRILQNSHGVEEEYQDLASALGLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPV
FT                   PGKGPFGRDELLRRKLIHEGCLLWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLD
FT                   KPSVVSLQNLIVRDIANQAKGMFLISSGPPEMYEVHAASRDDRTTWIRVIQQSVRL"
FT   mRNA            join(23977742..23977794,23985990..23986134,
FT                   23988114..23988536,23989116..23989263)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT186807"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186807.0 created
FT                   on 07-NOV-2003"
FT   mRNA            join(23978652..23978792,23985990..23986134,
FT                   23988114..23988181,23988479..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995770,23996561..23996628,
FT                   23998700..23998900,23999200..23999313,23999423..23999490,
FT                   23999619..23999654,23999836..23999886,24000064..24000507,
FT                   24002451..24002634,24003064..24004324)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT186806"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186806.0 created
FT                   on 07-NOV-2003"
FT   mRNA            join(23985695..23985766,23985990..23986134,
FT                   23988114..23988181,23988479..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995770,23996561..23996628,
FT                   23996754..23996986)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT186801"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186801.0 created
FT                   on 07-NOV-2003"
FT   CDS             join(23985728..23985766,23985990..23986134,
FT                   23988114..23988181,23988479..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995770,23996561..23996628,
FT                   23996754..23996758)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_h"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186801.0
FT                   protein_id=mCP108046.0 isoform=CRA_h"
FT                   /protein_id="EDL15264.1"
FT                   /translation="MSGNRRQPSRRGQTREKEKMKEAKDARYTNGHLFTTISVSGMTMC
FT                   YACNKSITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLRNNTALQSVSLRS
FT                   KTTTRERPTSAIYPSDSFRQSLLGSRRGLSSLSLAKSVSTTNIAGHFNDESPLGLRQIL
FT                   SQSTDSLNMRNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDSSFLQQH
FT                   KKEVMKKQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPCVDELSD
FT                   IHTRFLNQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHTK
FT                   ALKLYKELYARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNSH
FT                   GVEEEYQDLASALGLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGR
FT                   DELLRRKLIHEGCLLWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKPSVVSLQ
FT                   NLIVRDIANQAKGMFLISSGPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSREDFPLIE
FT                   TEDKAYLRRIKS"
FT   CDS             join(23986008..23986134,23988114..23988181,
FT                   23988479..23988542,23989116..23989245,23989461..23989570,
FT                   23989703..23989849,23990613..23990863,23991186..23991311,
FT                   23991804..23991921,23992058..23992306,23994579..23994655,
FT                   23995601..23995770,23996561..23996628,23998700..23998900,
FT                   23999200..23999313,23999423..23999490,23999619..23999654,
FT                   23999836..23999886,24000064..24000507,24002451..24002634,
FT                   24003064..24003137)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_i"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186806.0
FT                   protein_id=mCP108040.0 isoform=CRA_i"
FT                   /protein_id="EDL15265.1"
FT                   /translation="MKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPTCN
FT                   VTIHNRCKDTLANCTKVKQKQQKAALLRNNTALQSVSLRSKTTTRERPTSAIYPSDSFR
FT                   QSLLGSRRGLSSLSLAKSVSTTNIAGHFNDESPLGLRQILSQSTDSLNMRNRTLSVESL
FT                   IDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDSSFLQQHKKEVMKKQDVIYELIQTEL
FT                   HHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPCVDELSDIHTRFLNQLLERRRQALCP
FT                   GSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHTKALKLYKELYARDKRFQQFI
FT                   RKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNSHGVEEEYQDLASALGLVKEL
FT                   LSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGRDELLRRKLIHEGCLLWKTA
FT                   TGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKPSVVSLQNLIVRDIANQAKGMFLISS
FT                   GPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSREDFPLIETEDKAYLRRIKTKLQQKNQ
FT                   ALVELLQKNVELFAEMVHFQALKAGFVGMPPPALPRGLFRLESFESLRGERLLKDALRE
FT                   VEGLKDLLLGPCVDLPMTSREPALPLDSDSGSCPGVTANGEARTFNGSIELCRADSDSS
FT                   QKDRNGNQLRSPQEEVLQPLINLYGLLHGLQAVVVQQERLMEALFPEGPERWEKLSRAN
FT                   SRDGEAGRAAVASVTPEKQATELALLQRQHTLLQEELRRCQRLGEERATEAGSLEARLR
FT                   ESEQARALLEREAEEIRRQLAALGQNEPLPAEAPWARRPLDPRRRSLPAGDALYLSFNP
FT                   PQPSRGHDRLDLPVTVRSLHRPFDDREAQELGSPEDRLQDSSDPDTGSEEEVSSRLSPP
FT                   HSPRDFTRMQDIPEETESRDGEPTASES"
FT   CDS             join(23986008..23986134,23988114..23988190)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_e"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186807.0
FT                   protein_id=mCP108045.0 isoform=CRA_e"
FT                   /protein_id="EDL15261.1"
FT                   /translation="MKEAKDARYTNGHLFTTISVSGMTMCYACNKSITAKEALICPTCN
FT                   VTIHNRCKDTLANCTKVKQKVS"
FT   mRNA            join(23988399..23988542,23989116..23989245,
FT                   23989461..23989570,23989703..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992306,
FT                   23994579..23994655,23995601..23995770,23996561..23996628,
FT                   23998700..23998900,23999200..23999313,23999423..23999490,
FT                   23999619..23999654,23999836..23999886,24000064..24000507,
FT                   24002451..24002634,24003064..24004324)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT186803"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186803.0 created
FT                   on 07-NOV-2003"
FT   mRNA            join(23989121..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23993877,
FT                   23993984..23994124)
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, transcript variant mCT186804"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186804.0 created
FT                   on 07-NOV-2003"
FT   CDS             join(23989528..23989570,23989703..23989849,
FT                   23990613..23990863,23991186..23991311,23991804..23991921,
FT                   23992058..23992306,23994579..23994655,23995601..23995770,
FT                   23996561..23996628,23998700..23998900,23999200..23999313,
FT                   23999423..23999490,23999619..23999654,23999836..23999886,
FT                   24000064..24000507,24002451..24002634,24003064..24003137)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_c"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186803.0
FT                   protein_id=mCP108044.0 isoform=CRA_c"
FT                   /protein_id="EDL15258.1"
FT                   /translation="MRNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDS
FT                   SFLQQHKKEVMKKQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPC
FT                   VDELSDIHTRFLNQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEF
FT                   CSRHTKALKLYKELYARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINR
FT                   ILQNSHGVEEEYQDLASALGLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPG
FT                   KGPFGRDELLRRKLIHEGCLLWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKP
FT                   SVVSLQNLIVRDIANQAKGMFLISSGPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSRE
FT                   DFPLIETEDKAYLRRIKTKLQQKNQALVELLQKNVELFAEMVHFQALKAGFVGMPPPAL
FT                   PRGLFRLESFESLRGERLLKDALREVEGLKDLLLGPCVDLPMTSREPALPLDSDSGSCP
FT                   GVTANGEARTFNGSIELCRADSDSSQKDRNGNQLRSPQEEVLQPLINLYGLLHGLQAVV
FT                   VQQERLMEALFPEGPERWEKLSRANSRDGEAGRAAVASVTPEKQATELALLQRQHTLLQ
FT                   EELRRCQRLGEERATEAGSLEARLRESEQARALLEREAEEIRRQLAALGQNEPLPAEAP
FT                   WARRPLDPRRRSLPAGDALYLSFNPPQPSRGHDRLDLPVTVRSLHRPFDDREAQELGSP
FT                   EDRLQDSSDPDTGSEEEVSSRLSPPHSPRDFTRMQDIPEETESRDGEPTASES"
FT   CDS             join(23989528..23989570,23989703..23989849,
FT                   23990613..23990863,23991186..23991311,23991804..23991921,
FT                   23992058..23992306,23994579..23994655,23995601..23995770,
FT                   23996561..23996628,23998700..23998900,23999200..23999313,
FT                   23999423..23999490,23999619..23999654,23999836..23999886,
FT                   24000064..24000507,24002451..24002634,24003064..24003137)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_c"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186805.0
FT                   protein_id=mCP108043.0 isoform=CRA_c"
FT                   /protein_id="EDL15260.1"
FT                   /translation="MRNRTLSVESLIDEGVEVFYNELMSDFEMDEKDFEADSWSLAVDS
FT                   SFLQQHKKEVMKKQDVIYELIQTELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPC
FT                   VDELSDIHTRFLNQLLERRRQALCPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEF
FT                   CSRHTKALKLYKELYARDKRFQQFIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINR
FT                   ILQNSHGVEEEYQDLASALGLVKELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPG
FT                   KGPFGRDELLRRKLIHEGCLLWKTATGRFKDVLLLLMTDVLVFLQEKDQKYIFTSLDKP
FT                   SVVSLQNLIVRDIANQAKGMFLISSGPPEMYEVHAASRDDRTTWIRVIQQSVRLCPSRE
FT                   DFPLIETEDKAYLRRIKTKLQQKNQALVELLQKNVELFAEMVHFQALKAGFVGMPPPAL
FT                   PRGLFRLESFESLRGERLLKDALREVEGLKDLLLGPCVDLPMTSREPALPLDSDSGSCP
FT                   GVTANGEARTFNGSIELCRADSDSSQKDRNGNQLRSPQEEVLQPLINLYGLLHGLQAVV
FT                   VQQERLMEALFPEGPERWEKLSRANSRDGEAGRAAVASVTPEKQATELALLQRQHTLLQ
FT                   EELRRCQRLGEERATEAGSLEARLRESEQARALLEREAEEIRRQLAALGQNEPLPAEAP
FT                   WARRPLDPRRRSLPAGDALYLSFNPPQPSRGHDRLDLPVTVRSLHRPFDDREAQELGSP
FT                   EDRLQDSSDPDTGSEEEVSSRLSPPHSPRDFTRMQDIPEETESRDGEPTASES"
FT   CDS             join(23989729..23989849,23990613..23990863,
FT                   23991186..23991311,23991804..23991921,23992058..23992620)
FT                   /codon_start=1
FT                   /gene="Arhgef2"
FT                   /locus_tag="mCG_8844"
FT                   /product="rho/rac guanine nucleotide exchange factor (GEF)
FT                   2, isoform CRA_d"
FT                   /note="gene_id=mCG8844.3 transcript_id=mCT186804.0
FT                   protein_id=mCP108047.0 isoform=CRA_d"
FT                   /protein_id="EDL15259.1"
FT                   /translation="MSDFEMDEKDFEADSWSLAVDSSFLQQHKKEVMKKQDVIYELIQT
FT                   ELHHVRTLKIMTRLFRTGMLEELQMEPEVVQGLFPCVDELSDIHTRFLNQLLERRRQAL
FT                   CPGSTRNFVIHRLGDLLISQFSGSNAEQMRKTYSEFCSRHTKALKLYKELYARDKRFQQ
FT                   FIRKMTRSAVLKRHGVQECILLVTQRITKYPVLINRILQNSHGVEEEYQDLASALGLVK
FT                   ELLSNVDQDVHELEKEARLQEIYNRMDPRAQTPVPGKGPFGRDELLRRKLIHEGCLLWK
FT                   TATGRFKGQWCSQWTSELDILCELQSPLGTIFTAFGLARGRVRGKTHCCRGANSGQNPN
FT                   KNASWRPRVRIEHREGLRGWRRATGLQGCVGVGGRGCQSALSQAHLSEFICS"
FT   gene            complement(<24008333..>24009577)
FT                   /gene="Rxfp4"
FT                   /locus_tag="mCG_142728"
FT                   /note="gene_id=mCG142728.0"
FT   mRNA            complement(<24008333..>24009577)
FT                   /gene="Rxfp4"
FT                   /locus_tag="mCG_142728"
FT                   /product="relaxin family peptide receptor 4"
FT                   /note="gene_id=mCG142728.0 transcript_id=mCT181970.0
FT                   created on 17-APR-2003"
FT   CDS             complement(24008333..24009577)
FT                   /codon_start=1
FT                   /gene="Rxfp4"
FT                   /locus_tag="mCG_142728"
FT                   /product="relaxin family peptide receptor 4"
FT                   /note="gene_id=mCG142728.0 transcript_id=mCT181970.0
FT                   protein_id=mCP104892.0"
FT                   /db_xref="GOA:Q5Y985"
FT                   /db_xref="InterPro:IPR000248"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2182926"
FT                   /db_xref="UniProtKB/TrEMBL:Q5Y985"
FT                   /protein_id="EDL15255.1"
FT                   /translation="MATSNSSASLPTLFWVNGSGDSVLSTDGAAMPVQFLVLRIMVALA
FT                   YGLVGIIGLLGNLAVLWVLGNCGQRVPGLSSDTFVFSLALADLGLALTLPFWATESAMD
FT                   FHWPFGSALCKVVLTTTVLSIYASTFLITALSIARYWVVAMAVGPGSHLSVFWARVVTL
FT                   AVWVAAALVTVPTAIFGAEVELWGVCLCLLRFPSRYWLGAYQLQRVVLAFIVPLGVITT
FT                   SYLLLLAFLERQQRCRPRQWQDSRVVARSVRVLVASFALCWVPNHVVTLWEILVRFDLV
FT                   PWDSTFYTFHTYILPITTCLAHSNSCLNPVIYCLLRREPQQVLVSSFRALWSRLWPQRK
FT                   ACMEQMALKEVGGRTVASTQESGSSRTHTNTMEHLDEGCSLNTLLSETYQGQSPQILGR
FT                   SSCSLSQAAVSPGEV"
FT   gene            24043501..24070403
FT                   /gene="2810403A07Rik"
FT                   /locus_tag="mCG_8852"
FT                   /note="gene_id=mCG8852.1"
FT   mRNA            join(24043501..24043580,24044037..24044259,
FT                   24046868..24046996,24047317..24047396,24050541..24050593,
FT                   24050886..24051049,24054046..24054257,24056330..24056390,
FT                   24057432..24057489,24057742..24057995,24066254..24066415,
FT                   24067305..24067417,24068236..24068327,24069105..24069212,
FT                   24070033..24070403)
FT                   /gene="2810403A07Rik"
FT                   /locus_tag="mCG_8852"
FT                   /product="RIKEN cDNA 2810403A07, transcript variant
FT                   mCT9446"
FT                   /note="gene_id=mCG8852.1 transcript_id=mCT9446.2 created on
FT                   25-MAR-2003"
FT   mRNA            join(24043509..24043580,24044037..24044259,
FT                   24046868..24046996,24047317..24047396,24050541..24050593,
FT                   24050886..24051049,24054046..24054257,24056330..24056390,
FT                   24057432..24057489,24057742..24057995,24066254..24066415,
FT                   24067305..24067417,24068236..24068327,24069105..24070397)
FT                   /gene="2810403A07Rik"
FT                   /locus_tag="mCG_8852"
FT                   /product="RIKEN cDNA 2810403A07, transcript variant
FT                   mCT181576"
FT                   /note="gene_id=mCG8852.1 transcript_id=mCT181576.0 created
FT                   on 25-MAR-2003"
FT   CDS             join(24043543..24043580,24044037..24044259,
FT                   24046868..24046996,24047317..24047396,24050541..24050593,
FT                   24050886..24051049,24054046..24054257,24056330..24056390,
FT                   24057432..24057489,24057742..24057995,24066254..24066415,
FT                   24067305..24067417,24068236..24068327,24069105..24069212,
FT                   24070033..24070085)
FT                   /codon_start=1
FT                   /gene="2810403A07Rik"
FT                   /locus_tag="mCG_8852"
FT                   /product="RIKEN cDNA 2810403A07, isoform CRA_b"
FT                   /note="gene_id=mCG8852.1 transcript_id=mCT9446.2
FT                   protein_id=mCP22831.1 isoform=CRA_b"
FT                   /protein_id="EDL15254.1"
FT                   /translation="MSAGSATHPAAGGRRSKWDQPAPAPLLFLPPTAPGGEVAGSGASP
FT                   GGATTAAAPSGALDAAAAVAAKINAMLMAKGKLKPSQNAAEKLQAPGKSLTSNKSKDDL
FT                   VVAEVEINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYL
FT                   HVQGQTRELVDRAVNRIKEIITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAINQ
FT                   KPSFQSGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSG
FT                   CIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG
FT                   YTQPSAISSIPPQPPYYPSNGYQSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPA
FT                   LPTGVPPVPTQYPITQVQPPASTGQSPISAPFIPAAPVKTALPTGPQPQPQLPAQPQSQ
FT                   KRRFTEELPDERDSGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQ
FT                   LMPPPAFPVTGIKTESDERNGSGALAGSHDYPAKKMKTAEKGFGLVAYAADSSDEEEEH
FT                   GGHKNAKLAAARRGMWCHRQDGD"
FT   CDS             join(24043543..24043580,24044037..24044259,
FT                   24046868..24046996,24047317..24047396,24050541..24050593,
FT                   24050886..24051049,24054046..24054257,24056330..24056390,
FT                   24057432..24057489,24057742..24057995,24066254..24066415,
FT                   24067305..24067417,24068236..24068327,24069105..24069304)
FT                   /codon_start=1
FT                   /gene="2810403A07Rik"
FT                   /locus_tag="mCG_8852"
FT                   /product="RIKEN cDNA 2810403A07, isoform CRA_a"
FT                   /note="gene_id=mCG8852.1 transcript_id=mCT181576.0
FT                   protein_id=mCP104498.0 isoform=CRA_a"
FT                   /protein_id="EDL15253.1"
FT                   /translation="MSAGSATHPAAGGRRSKWDQPAPAPLLFLPPTAPGGEVAGSGASP
FT                   GGATTAAAPSGALDAAAAVAAKINAMLMAKGKLKPSQNAAEKLQAPGKSLTSNKSKDDL
FT                   VVAEVEINDVPLTCRNLLTRGQTQDEISRLSGAAVSTRGRFMTTEEKAKVGPGDRPLYL
FT                   HVQGQTRELVDRAVNRIKEIITNGVVKAATGTSPTFNGATVTVYHQPAPIAQLSPAINQ
FT                   KPSFQSGMHYVQDKLFVGLEHAVPTFNVKEKVEGPGCSYLQHIQIETGAKVFLRGKGSG
FT                   CIEPASGREAFEPMYIYISHPKPEGLAAAKKLCENLLQTVHAEYSRFVNQINTAVPLPG
FT                   YTQPSAISSIPPQPPYYPSNGYQSGYPVVPPPQQPVQPPYGVPSIVPPAVSLAPGVLPA
FT                   LPTGVPPVPTQYPITQVQPPASTGQSPISAPFIPAAPVKTALPTGPQPQPQLPAQPQSQ
FT                   KRRFTEELPDERDSGLLGYQHGPIHMTNLGTGFSSQNEIEGAGSKPASSSGKERERDRQ
FT                   LMPPPAFPVTGIKTESDERNGSGALAGSHDYPAKKMKTAEKGFGLVAYAADSSDEEEEH
FT                   GGHKNASSFPQGWSLGYQYPSSQPRAKQQMPFWMAP"
FT   gene            24074897..24088798
FT                   /gene="Rit1"
FT                   /locus_tag="mCG_8846"
FT                   /note="gene_id=mCG8846.2"
FT   mRNA            join(24074897..24074973,24075342..24075486,
FT                   24075618..24075674,24083740..24083813,24084025..24084216,
FT                   24086861..24088798)
FT                   /gene="Rit1"
FT                   /locus_tag="mCG_8846"
FT                   /product="Ras-like without CAAX 1, transcript variant
FT                   mCT9440"
FT                   /note="gene_id=mCG8846.2 transcript_id=mCT9440.2 created on
FT                   25-MAR-2003"
FT   mRNA            join(24074921..24074973,24075342..24075486,
FT                   24075618..24075674,24083740..24084216,24086861..24088798)
FT                   /gene="Rit1"
FT                   /locus_tag="mCG_8846"
FT                   /product="Ras-like without CAAX 1, transcript variant
FT                   mCT181572"
FT                   /note="gene_id=mCG8846.2 transcript_id=mCT181572.0 created
FT                   on 25-MAR-2003"
FT   mRNA            join(24074939..24074973,24075342..24075486,
FT                   24075589..24075674,24083740..24083813,24084025..24084216,
FT                   24086861..24087212)
FT                   /gene="Rit1"
FT                   /locus_tag="mCG_8846"
FT                   /product="Ras-like without CAAX 1, transcript variant
FT                   mCT181573"
FT                   /note="gene_id=mCG8846.2 transcript_id=mCT181573.0 created
FT                   on 25-MAR-2003"
FT   CDS             join(24075381..24075486,24075618..24075674,
FT                   24083740..24083813,24084025..24084216,24086861..24087091)
FT                   /codon_start=1
FT                   /gene="Rit1"
FT                   /locus_tag="mCG_8846"
FT                   /product="Ras-like without CAAX 1, isoform CRA_c"
FT                   /note="gene_id=mCG8846.2 transcript_id=mCT9440.2
FT                   protein_id=mCP22869.1 isoform=CRA_c"
FT                   /protein_id="EDL15252.1"
FT                   /translation="MESGARPIGSSCSSPAALSREYKLVMLGAGGVGKSAMTMQFISHR
FT                   FPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQAEFTAMRDQYMRAGEGFIICYSITD
FT                   RRSFHEVREFKQLIYRVRRTDDTPVVLVGNKSDLKQLRQVSKEEGLSLAREFSCPFFET
FT                   SAAYRYYIDDVFHALVREIRKKEKELVLAMEKKAKPKNSVWKRLKSPFRRKKDSVT"
FT   CDS             join(24075381..24075486,24075618..24075674,
FT                   24083740..24083849)
FT                   /codon_start=1
FT                   /gene="Rit1"
FT                   /locus_tag="mCG_8846"
FT                   /product="Ras-like without CAAX 1, isoform CRA_a"
FT                   /note="gene_id=mCG8846.2 transcript_id=mCT181572.0
FT                   protein_id=mCP104495.0 isoform=CRA_a"
FT                   /db_xref="GOA:G5E8W6"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="MGI:MGI:108053"
FT                   /db_xref="UniProtKB/TrEMBL:G5E8W6"
FT                   /protein_id="EDL15250.1"
FT                   /translation="MESGARPIGSSCSSPAALSREYKLVMLGAGGVGKSAMTMQFISHR
FT                   FPEDHDPTIEDAYKIRIRIDDEPANLDILDTAGQVLNPEPSEQCL"
FT   CDS             join(24075381..24075486,24075589..24075596)
FT                   /codon_start=1
FT                   /gene="Rit1"
FT                   /locus_tag="mCG_8846"
FT                   /product="Ras-like without CAAX 1, isoform CRA_b"
FT                   /note="gene_id=mCG8846.2 transcript_id=mCT181573.0
FT                   protein_id=mCP104494.0 isoform=CRA_b"
FT                   /db_xref="GOA:G3UWE0"
FT                   /db_xref="MGI:MGI:108053"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWE0"
FT                   /protein_id="EDL15251.1"
FT                   /translation="MESGARPIGSSCSSPAALSREYKLVMLGAGGVGKSVS"
FT   gene            complement(24107429..>24123502)
FT                   /gene="Syt11"
FT                   /locus_tag="mCG_8848"
FT                   /note="gene_id=mCG8848.3"
FT   mRNA            complement(join(24107429..24108898,24109667..24109790,
FT                   24122665..>24123502))
FT                   /gene="Syt11"
FT                   /locus_tag="mCG_8848"
FT                   /product="synaptotagmin XI, transcript variant mCT9442"
FT                   /note="gene_id=mCG8848.3 transcript_id=mCT9442.3 created on
FT                   25-MAR-2003"
FT   mRNA            complement(join(24108191..24108898,24109670..24109790,
FT                   24122665..>24123501))
FT                   /gene="Syt11"
FT                   /locus_tag="mCG_8848"
FT                   /product="synaptotagmin XI, transcript variant mCT181574"
FT                   /note="gene_id=mCG8848.3 transcript_id=mCT181574.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(24108588..24108898,24109670..24109790,
FT                   24122665..>24123501))
FT                   /codon_start=1
FT                   /gene="Syt11"
FT                   /locus_tag="mCG_8848"
FT                   /product="synaptotagmin XI, isoform CRA_a"
FT                   /note="gene_id=mCG8848.3 transcript_id=mCT181574.0
FT                   protein_id=mCP104496.0 isoform=CRA_a"
FT                   /protein_id="EDL15248.1"
FT                   /translation="SLSSDVSPVAAGLIGASVLVVCVSVTVFVWTCCHQQAEKKHKTPP
FT                   YKFIHMLKGISIYPETLSNKKKIIKVRRDKDGPRRESGRGNLLINAESGLLSHDKDPRG
FT                   PSPASCMDQLPIKRDYGEELRSPMTSLTPGESKATSPSSPEEDVMLGSLTFSVDYNFPK
FT                   KALVVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFY
FT                   GIPYSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKC
FT                   ISRGELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSDPYVKVNVYYGRKRIAKKKTH
FT                   VKKCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGA
FT                   EHWREVCESPRKPIAKWHSLSEY"
FT   CDS             complement(join(24108588..24108898,24109667..24109790,
FT                   24122665..>24123492))
FT                   /codon_start=1
FT                   /gene="Syt11"
FT                   /locus_tag="mCG_8848"
FT                   /product="synaptotagmin XI, isoform CRA_b"
FT                   /note="gene_id=mCG8848.3 transcript_id=mCT9442.3
FT                   protein_id=mCP22877.0 isoform=CRA_b"
FT                   /protein_id="EDL15249.1"
FT                   /translation="SDVSPVAAGLIGASVLVVCVSVTVFVWTCCHQQAEKKHKTPPYKF
FT                   IHMLKGISIYPETLSNKKKIIKVRRDKDGPRRESGRGNLLINAESGLLSHDKDPRGPSP
FT                   ASCMDQLPIKRDYGEELRSPMTSLTPGESKATSPSSPEEDVMLGSLTFSVDYNFPKKAL
FT                   VVTIQEAHGLPVMDDQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIP
FT                   YSQLQDLVLHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISR
FT                   GELQVSLSYQPVAQRMTVVVLKARHLPKMDITGLSGNPYVKVNVYYGRKRIAKKKTHVK
FT                   KCTLNPVFNESFIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEH
FT                   WREVCESPRKPIAKWHSLSEY"
FT   gene            <24204597..>24221863
FT                   /locus_tag="mCG_17560"
FT                   /note="gene_id=mCG17560.1"
FT   mRNA            join(<24204597..24204807,24212854..24213047,
FT                   24213877..24213951,24214066..24214116,24214670..24214720,
FT                   24215379..24215477,24216638..24216757,24217140..24217310,
FT                   24221671..>24221863)
FT                   /locus_tag="mCG_17560"
FT                   /product="mCG17560"
FT                   /note="gene_id=mCG17560.1 transcript_id=mCT14216.1 created
FT                   on 31-OCT-2002"
FT   CDS             join(24204597..24204807,24212854..24213047,
FT                   24213877..24213951,24214066..24214116,24214670..24214720,
FT                   24215379..24215477,24216638..24216757,24217140..24217310,
FT                   24221671..>24221863)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17560"
FT                   /product="mCG17560"
FT                   /note="gene_id=mCG17560.1 transcript_id=mCT14216.1
FT                   protein_id=mCP17215.1"
FT                   /protein_id="EDL15247.1"
FT                   /translation="MFAILLGELELRSDGEVPLLSSSSQSAKPGAQPRKSVQPDGSAFP
FT                   QDKPLGPLVRQAEEEMEDGGLFIPTEEQDSEESDKKKKTKKGTKRKRDGKGPEQGTMVY
FT                   DPKLDDMLDRTLEDGAKQHNLTAVNVRNILHEVITNEHVVAMMKAAISETEDMPLFEPK
FT                   MTRSKLKEVVEKGVVIPTWNISPIKKASEIKQPPQFVDIHLEEDDSSDEEYSPDEEEED
FT                   ETAEESLLESDVESTASSPRGVKRSRLRLSSEVAETDEESGMLSEVEKAATPALRHISA
FT                   EVVPMGPPPPPKPKQSRDSVFMEKLDAVDEELASSPVCMDSFQPMEDSLIAFRTRSKMP
FT                   LKDVPLGQLEAELQAPDITPDMYDPNTADDEDWKQWLGGLINDDVENE"
FT   gene            24240334..24265175
FT                   /locus_tag="mCG_17558"
FT                   /note="gene_id=mCG17558.1"
FT   mRNA            join(24240334..24240485,24249378..24249494,
FT                   24249756..24250912,24251127..24251508,24253234..24253489,
FT                   24253740..24253818,24253924..24254203,24255060..24255257,
FT                   24256708..24256851,24257861..24258004,24258086..24258205,
FT                   24260557..24260667,24262478..24262688,24263293..24263713,
FT                   24263793..24263895,24264315..24265175)
FT                   /locus_tag="mCG_17558"
FT                   /product="mCG17558"
FT                   /note="gene_id=mCG17558.1 transcript_id=mCT14214.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(24240399..24240485,24249378..24249494,
FT                   24249756..24250912,24251127..24251508,24253234..24253489,
FT                   24253740..24253818,24253924..24254203,24255060..24255257,
FT                   24256708..24256851,24257861..24258004,24258086..24258205,
FT                   24260557..24260667,24262478..24262688,24263293..24263713,
FT                   24263793..24263895,24264315..24264464)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17558"
FT                   /product="mCG17558"
FT                   /note="gene_id=mCG17558.1 transcript_id=mCT14214.2
FT                   protein_id=mCP17287.2"
FT                   /protein_id="EDL15246.1"
FT                   /translation="MYPELLPICSLKANNPRDKTIFTKAEDKYFYKKTKQLPVLVRCCE
FT                   EIQPHQWKPPFEKEEHRLPFWLKASLQSIQDELRNISEGATEGGSVTTATESSTDQHLQ
FT                   KASPALGDEPQYPLLLPKGVVLKLKPGSKRFSRKAWRQKRPLVQKPLLIQPSPSVQPVF
FT                   NPGKMATWPTQSEVPPSNTVVQIPHLIQPAAVLQTLPGFPSVGVRGEDGFESPTALPAM
FT                   PCGSEARTTFPLSETQSAPPSCSAPKLMLPSLAPSKFRKPYVRRKPTRRKGAKVSPCVK
FT                   PAPIIHPTPVIFTVPATTVKVVSIGGGCNMIQPVSAAVAPSPQTIPITTLLVNPTTFPC
FT                   SLNQPLVASSISPLIVSSNPLTLPVTSIPEDKAQVKLDVAEGKNAPQNPESKLKPQELT
FT                   PLCTTVFSKEEPKSWHSSADTGSQEAFSESSACSWAVVKTEARKALLKRMPVAGRRSRV
FT                   EPSEMSKQTVLQREDTQAAKSPSVPQDAAAEGRTSSHASRGLPKSTPSSMGQGGGLSGP
FT                   PGKLEDSVNADGQSVGTPAGPDTGGEKDGLEEEEEEDFDDLTQDEEDELSSASEESVLS
FT                   VPELQETMEKLTWLASERRMSQEGESEEENSQEENSEPEEEEEEEAEGMETLQKEDEVN
FT                   DEAVGDAAKKPPSTLASPQTAPEIETSIAPAGSSGGISVRPPLPLPSLGLLSQLQNSCC
FT                   AVILVGVHGVAFTLDSTVSGIEKESFSLLQGESIKAAGKGRSSHRARNKRGSRARASKD
FT                   TSKLLLLYDEDILDRDPLREQKDLAFAQAYLTRVREALQHTPGKYEDFLQIIYEFESST
FT                   QMHSAVDLFKSLQTLLQDWPQLLKDFAAFLLPEQALSCGLFEEQQAFEKSRKFLRQLEI
FT                   CFAENPSHHQKIIKVLQGCADCLPQDIAELKTQMWQLLRGHDHLQDEFSIFFDHLRPAA
FT                   SRMGDFEEINWTEEKEYEFDGFEEVILPDVEEDEEPAKVSTASKSKRRKEIGVQHQDKD
FT                   TEWPEAAKDCSCSCHEGGPESKLKKSKRRNCHCSSKVCDSKPYKSKEPPELVGSGPLHE
FT                   ASTVPGSKEAGQGKDMLEEEILEEQENMEVTQSKTARTTRKGEAPAPEGEDQRAAANSE
FT                   TIAPHREASETERLPETVEHPAPLPSPVSTRTRDTGRRHICGKAGSQSWLIESRAEAEA
FT                   AHVAAPICEKSSGARASEAAPKTAREVLAEDSGTQGMGPEGALPKASEATVCANNSKVS
FT                   STGEKVVLWTREADRVILTMCQEQGAQPHTFSVISQQLGNKTPVEVSHRFRELMQLFHT
FT                   ACEASSEDEDDATSTSNADQLSDHGDLLSEEELDE"
FT   gene            complement(24264474..24268998)
FT                   /gene="Msto1"
FT                   /locus_tag="mCG_17551"
FT                   /note="gene_id=mCG17551.1"
FT   mRNA            complement(join(24264474..24264987,24265207..24265316,
FT                   24265703..24265887,24265960..24266091,24266364..24266516,
FT                   24266614..24266748,24266841..24266958,24267103..24267190,
FT                   24267314..24267377,24267780..24267855,24267935..24268004,
FT                   24268644..24268779,24268870..24268998))
FT                   /gene="Msto1"
FT                   /locus_tag="mCG_17551"
FT                   /product="misato homolog 1 (Drosophila), transcript variant
FT                   mCT14208"
FT                   /note="gene_id=mCG17551.1 transcript_id=mCT14208.2 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(24264721..24264987,24265207..24265316,
FT                   24265391..24265495,24265703..24265887,24265960..24266091,
FT                   24266364..24266516,24266614..24266748,24266841..24266958,
FT                   24267103..24267190,24267314..24267377,24267780..24267855,
FT                   24267935..24268004,24268644..24268779,24268870..24268997))
FT                   /gene="Msto1"
FT                   /locus_tag="mCG_17551"
FT                   /product="misato homolog 1 (Drosophila), transcript variant
FT                   mCT181517"
FT                   /note="gene_id=mCG17551.1 transcript_id=mCT181517.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(24264773..24264987,24265207..24265316,
FT                   24265703..24265887,24265960..24266091,24266364..24266516,
FT                   24266614..24266748,24266841..24266958,24267103..24267190,
FT                   24267314..24267377,24267780..24267855,24267935..24268004,
FT                   24268644..24268779,24268870..24268953))
FT                   /codon_start=1
FT                   /gene="Msto1"
FT                   /locus_tag="mCG_17551"
FT                   /product="misato homolog 1 (Drosophila), isoform CRA_a"
FT                   /note="gene_id=mCG17551.1 transcript_id=mCT14208.2
FT                   protein_id=mCP17271.2 isoform=CRA_a"
FT                   /protein_id="EDL15244.1"
FT                   /translation="MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPGEL
FT                   CPDVLYRTGRTLHGQETYTPRLILMDLKGSLNTLKEEGNLYRDRQLEAAVAWQGKLSTH
FT                   REDAQPKNPNLQGLLSAEGVRSSDGAWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSI
FT                   CVIHKYHHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHD
FT                   GFSGVGAKTAELLQDEYAGRGVLTWGLLPGPYSLGEPQKNIYRLLNTAFGLVHLTGYSS
FT                   FVCPLSLGGNLGLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRLRSSMVTMA
FT                   HLADVLSFSGKKVVTAEAIIPFPLVRGQSLPDILTQLGEATPWTSLSACGDSAGHRCFA
FT                   QSVVLRGIDRASHTSSSHLLLTPCKVAPPYPHFFSSFSQKGLAMDSTPKGAAVQSIPVF
FT                   GALRSTSSLHRTLGDLAEELSRLDLRRWASFMDAGVEQDDMEEMLHELHRLAQCYQEGD
FT                   SLSN"
FT   CDS             complement(join(24264773..24264987,24265207..24265316,
FT                   24265391..24265495,24265703..24265887,24265960..24266091,
FT                   24266364..24266516,24266614..24266748,24266841..24266958,
FT                   24267103..24267190,24267314..24267377,24267780..24267855,
FT                   24267935..24268004,24268644..24268779,24268870..24268953))
FT                   /codon_start=1
FT                   /gene="Msto1"
FT                   /locus_tag="mCG_17551"
FT                   /product="misato homolog 1 (Drosophila), isoform CRA_b"
FT                   /note="gene_id=mCG17551.1 transcript_id=mCT181517.0
FT                   protein_id=mCP104439.0 isoform=CRA_b"
FT                   /protein_id="EDL15245.1"
FT                   /translation="MAGGAREVLTLQLGHFAGFVGAHWWNQQDAALGRMAEDEESPGEL
FT                   CPDVLYRTGRTLHGQETYTPRLILMDLKGSLNTLKEEGNLYRDRQLEAAVAWQGKLSTH
FT                   REDAQPKNPNLQGLLSAEGVRSSDGAWRAKLIQNIQNGKENSIKVWSDFLRVHLHPRSI
FT                   CVIHKYHHDGETGRLEAFGQGESVLKEPRYLEELEDRLHFYVEECDYLQGFQLLCDLHD
FT                   GFSGVGAKTAELLQDEYAGRGVLTWGLLPGPYSLGEPQKNIYRLLNTAFGLVHLTGYSS
FT                   FVCPLSLGGNLGLRPKPPVNFPSLHYDATLPFHCSAILATALDTVTVPYRLRSSMVTMA
FT                   HLADVLSFSGKKVVTAEAIIPFPLVRGQSLPDILTQLGEATPWTSLSACGDSAGHRCFA
FT                   QSVVLRGIDRASHTSKLNPGTPLPSALHACASGEEVLAQYLQQQHPRVLSSSHLLLTPC
FT                   KVAPPYPHFFSSFSQKGLAMDSTPKGAAVQSIPVFGALRSTSSLHRTLGDLAEELSRLD
FT                   LRRWASFMDAGVEQDDMEEMLHELHRLAQCYQEGDSLSN"
FT   gene            complement(24278608..24305441)
FT                   /gene="Dap3"
FT                   /locus_tag="mCG_17537"
FT                   /note="gene_id=mCG17537.2"
FT   mRNA            complement(join(24278608..24278990,24280371..24280488,
FT                   24281349..24281438,24282088..24282147,24283286..24283444,
FT                   24283524..24283604,24284473..24284603,24285553..24285645,
FT                   24285989..24286097,24288646..24288747,24291230..24291334,
FT                   24297856..24297909,24304949..24305441))
FT                   /gene="Dap3"
FT                   /locus_tag="mCG_17537"
FT                   /product="death associated protein 3, transcript variant
FT                   mCT14193"
FT                   /note="gene_id=mCG17537.2 transcript_id=mCT14193.2 created
FT                   on 08-AUG-2002"
FT   mRNA            complement(join(24278713..24278990,24280371..24280488,
FT                   24282088..24282147,24283286..24283444,24283524..24283604,
FT                   24284473..24284603,24285553..24285645,24285989..24286097,
FT                   24288646..24288747,24291230..24291334,24297856..24297909,
FT                   24304949..>24305033))
FT                   /gene="Dap3"
FT                   /locus_tag="mCG_17537"
FT                   /product="death associated protein 3, transcript variant
FT                   mCT190922"
FT                   /note="gene_id=mCG17537.2 transcript_id=mCT190922.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(24278905..24278990,24280371..24280488,
FT                   24282088..24282147,24283286..24283444,24283524..24283604,
FT                   24284473..24284603,24285553..24285645,24285989..24286097,
FT                   24288646..24288747,24291230..24291334,24297856..24297909,
FT                   24304949..>24305032))
FT                   /codon_start=1
FT                   /gene="Dap3"
FT                   /locus_tag="mCG_17537"
FT                   /product="death associated protein 3, isoform CRA_b"
FT                   /note="gene_id=mCG17537.2 transcript_id=mCT190922.0
FT                   protein_id=mCP111884.0 isoform=CRA_b"
FT                   /protein_id="EDL15243.1"
FT                   /translation="TTAGRVPGIQPLAVCAGHRSRSPSVGLMRAKTMLTGITRLFSRVQ
FT                   KLDPRCFLHMSVQATQNSQVPAERPRTVSRTSDSDPAKHGEQHEGQHYSIPLQDLKTVF
FT                   PHGLPPRYMMQVKTFGEACLMVRKPALELLGYLKNTNFAHPAVRYLLYGEKGTGKTLSL
FT                   CHAVHFCARHDWLILHIPDAHLWVKNCRELLQSTHNKQRFDQPLEASTWLKNFKTTNER
FT                   FLSQIKVQEKYVWNKRESTEKGSPLGEVVEQGLTRVRNATDAVGVVLKELKAQSALGLF
FT                   HLLVAVDGVNALWGRTTLKKEDRTLIAPEELSLVHNLRKMVKNDWEGFNALEPFLPILI
FT                   PNYNPKEFESSFQYYLENNWLQHEKASTEEGRKELRFLSNCNPEQLERLCASL"
FT   CDS             complement(join(24278905..24278990,24280371..24280488,
FT                   24281349..24281438,24282088..24282147,24283286..24283444,
FT                   24283524..24283604,24284473..24284603,24285553..24285645,
FT                   24285989..24286097,24288646..24288747,24291230..24291334,
FT                   24297856..24297897))
FT                   /codon_start=1
FT                   /gene="Dap3"
FT                   /locus_tag="mCG_17537"
FT                   /product="death associated protein 3, isoform CRA_a"
FT                   /note="gene_id=mCG17537.2 transcript_id=mCT14193.2
FT                   protein_id=mCP17258.2 isoform=CRA_a"
FT                   /protein_id="EDL15242.1"
FT                   /translation="MLTGITRLFSRVQKLDPRCFLHMSVQATQNSQVPAERPRTVSRTS
FT                   DSDPAKHGEQHEGQHYSIPLQDLKTVFPHGLPPRYMMQVKTFGEACLMVRKPALELLGY
FT                   LKNTNFAHPAVRYLLYGEKGTGKTLSLCHAVHFCARHDWLILHIPDAHLWVKNCRELLQ
FT                   STHNKQRFDQPLEASTWLKNFKTTNERFLSQIKVQEKYVWNKRESTEKGSPLGEVVEQG
FT                   LTRVRNATDAVGVVLKELKAQSALGLFHLLVAVDGVNALWGRTTLKKEDRTLIAPEELS
FT                   LVHNLRKMVKNDWHGGAIVLSLSQTGSLFKSRTAYLPHELLGKEGFNALEPFLPILIPN
FT                   YNPKEFESSFQYYLENNWLQHEKASTEEGRKELRFLSNCNPEQLERLCASL"
FT   gene            24305890..24434384
FT                   /gene="Ash1l"
FT                   /locus_tag="mCG_17545"
FT                   /note="gene_id=mCG17545.1"
FT   mRNA            join(24305890..24306030,24320697..24321213,
FT                   24336112..24340669,24356503..24356604,24361863..24362598,
FT                   24377711..24377890,24381092..24381186,24390144..24390252,
FT                   24398094..24398300,24398472..24398618,24406868..24406976,
FT                   24407622..24407786,24407956..24408050,24409306..24409460,
FT                   24413473..24413625,24418636..24418690,24418771..24418903,
FT                   24421165..24421413,24422148..24422234,24423980..24424070,
FT                   24425219..24425357,24425465..24425637,24427437..24427603,
FT                   24429735..24429775,24430986..24431287,24432001..24434384)
FT                   /gene="Ash1l"
FT                   /locus_tag="mCG_17545"
FT                   /product="ash1 (absent, small, or homeotic)-like
FT                   (Drosophila)"
FT                   /note="gene_id=mCG17545.1 transcript_id=mCT14195.1 created
FT                   on 06-AUG-2002"
FT   CDS             join(24320797..24321213,24336112..24340669,
FT                   24356503..24356604,24361863..24362598,24377711..24377890,
FT                   24381092..24381186,24390144..24390252,24398094..24398300,
FT                   24398472..24398618,24406868..24406976,24407622..24407786,
FT                   24407956..24408050,24409306..24409460,24413473..24413625,
FT                   24418636..24418690,24418771..24418903,24421165..24421413,
FT                   24422148..24422234,24423980..24424070,24425219..24425357,
FT                   24425465..24425637,24427437..24427603,24429735..24429775,
FT                   24430986..24431287,24432001..24432092)
FT                   /codon_start=1
FT                   /gene="Ash1l"
FT                   /locus_tag="mCG_17545"
FT                   /product="ash1 (absent, small, or homeotic)-like
FT                   (Drosophila)"
FT                   /note="gene_id=mCG17545.1 transcript_id=mCT14195.1
FT                   protein_id=mCP17224.2"
FT                   /protein_id="EDL15241.1"
FT                   /translation="MDPRNTAMLGLGSDSEGFSRKSPSTINPGTLASKREAEIEGATEE
FT                   EDPRKRNRERGTEAGKEDGSTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLEN
FT                   YVCRPAIKTTIKHSRKALKSGKMTDEKNEHCPSKWDSSKLFKKAGDATAIDCQAEESIH
FT                   LHSQGESNPLSKKLSPVHSQMADYISAAPSLVGSRDPDIKDRALLNGGTSVTEKLAQLI
FT                   ATCPPSKSSKAKPKKLGTGTTVGLVSKDLIRKPGVGSIAGIIHKDLIKKPALSTAVGLV
FT                   TKDPGKKPMFNAAVGLINKDSVKKLGTGTTAVFINKDLGKKPGAITTVGLLSKESGKKL
FT                   GIGIVPGLVNKESGKKLGLGTVVGLVNKELGKKLSSTVGLVAKDVTKKIVASSAMGLVN
FT                   KDIGKKLLNCPMAGQLGSKDALNLKSEALLPTQEQLKASCSANISNHDSQELPESLKDS
FT                   ATGKAFEKSVMRHSKESMLEKFSVRKEITNLEKEMFNEGTCIQQDNFSSSERGAFETSK
FT                   HEKQPPVYCTSPDFQIGGASDASTAKSPFSAVGESNLPSSSPTVSVNPVTRSPPEASSQ
FT                   LVPNPLLLNSTAEQMEEISESIGKSQFTAESTHLNVGHRSLGHSLSIECKGIDKELNES
FT                   KNTHLDIPRISSSLGKKPSLTSDSGIHAITPSVVNFTSLFSNKPFLKLGAVTAPDKHCQ
FT                   VAESLSSSFQSKPLKKRKGRKPRWTKVVARSTCRSPKGLDLERSELFKNVSCSSLSNSS
FT                   EPAKFMKTIGASSFVDHDFLKRRLPKLSKSSAPSLALLTDSEKPSHKSFITHKLSSSMC
FT                   VTSDLLSDIYKPKRGRPKSKEMPQLEGPPKRTLKIPASKVFSLQSKEEQEPPILQPEIE
FT                   IPSFKQSLSVSPFPKKRGRPKRQMRSPVKMKPPVLSVAPFVATESPSKLESESENHRSS
FT                   SDFFESEDQLQDTDDLDDSHRQSVCSMSDLEMEPDKKISKRNNGQLMKTIIRKINKMKT
FT                   LKRKKLLNQILSSSVESSNKGKVQSKLHNTVSSLAATFGSKLGQQINVSKKGTIYIGKR
FT                   RGRKPKTVLNGLLSGSPASLAVLEQTAQQAAGSALGQILPPLLPSPASSSEILPSPICS
FT                   QSSGTSGGQSPVSSDAGFVEPSSVPYLHVHSRQGSMIQTLAMKKASKGRRRLSPPTLLP
FT                   NSPSHLSELTSLKEATPSPVSESHSDETIPSDSGIGTDNNSTSDRAEKFCGQKKRRHSF
FT                   EHISLIPPETSTVLNSLKEKHKHKCKRRSHDYLSYDKMKRQKRKRKKKYPQLRNRQDPD
FT                   FIAELEELISRLSEIRITHRSHHFIPRDLLPTIFRINFNSFYTHPSFPLDPLHYIRKPD
FT                   LKKKRGRPPKMREAMAEMPFMHSLSFPLSSTGFYPSYGMPYSPSPLTAAPIGLGYYGRY
FT                   PPTLYPPPPSPSFTTPLPPPSYMHAGHLLLNPTKYHKKKHKLLRQEAFLTTSRTPLLSM
FT                   STYPSVPPEMAYGWMVEHKHRHRHKHREHRSEQPQVSMDSGSSRSVLESLKRYRFGKDT
FT                   VGDRYKHKEKHRCHMSCPHLSPSKNLINREEQWVSREPSESSSLALGLQTPLQIDCSES
FT                   SPSLSLGGFTPNSEPASSDEHMNLFTSAIGSCRVSNPNSSCRKKLTDSPGLFPVQDTAL
FT                   NRPHRKEPLPSSERAIQSLAGSQSASDKPSQRSSESTNCSPTRKRSSSESTSSTVNGVP
FT                   SRSPRLVASMDDSVDSLLQRIVHHDEQESMEKNGDASITTVSAPPSSSPGHSYSKERAL
FT                   GKSDSLLVPAVPNDSCSNIPLLSEKSASRCSPHHIKRSVVEAMQRQARKMCNYDKILAT
FT                   KKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPLQAVVSMQAFQAAQFVSPELN
FT                   EGEDMSLHLSPDTVTDVIEAVVQSVNLTSEHKKGVKRKNWLLEEQTRKKQKTVPEEEEQ
FT                   ENNKSFIETPVEIPSPLETPAEPSEPENTLQPVLALIPREKKAPRPPKKKYQRAGLYSD
FT                   VYKTIDPKSRLIQLKKEKLEYTPGEHEYGLFPAPIHVDVYVDVKPLSGYEATTCNCKKP
FT                   DDDTRKGCGDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIR
FT                   TKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEAR
FT                   FINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFE
FT                   KCRGIIGGKSQRMNGLPSHKGSQSSSTHRKSARAKEKRKSKHKLKKRKGHPSEEPSENI
FT                   NTPTRLTPQLQMKPMSNRERNFVLKHHVFLVRNWEKIHQKQEEVKHTRDIHSASLYTRW
FT                   NGLCRDDGNIKSDVFMTQFSALQTARSVRTRRLAAAEENLEVARAARLAQIFKEICDGI
FT                   ISYRDSSQQTLAAPLLNLPPKKKNADYYEKISDPLDLSTIEKQILIGYYKTVEAFDADM
FT                   LKVFRNAEKYYGRKSPIGRDVCRLRKAYYSARHEASAQIDEIVGETASEADSSETSVSE
FT                   KESGHEKDDDVIRCICGLYKDEGLMIQCDKCMVWQHCDCMGVNTDVEHYLCEQCDPRPV
FT                   DREVPMIPRPHYAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLS
FT                   HINRDKLDIFRIEKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIP
FT                   LEAVVGTCCVLDLYTYCKGRPKGIKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYA
FT                   FDHFPKKLTPKRDFSPHYVPDNYKRNGGRSSWKSERSKPPLKDLGQEDDALPLIEEVLA
FT                   SQEQAAREVPSPEEPDQERATGDIGDAEKKPEESSQEAQLASTPEERRHSQRERLNQIL
FT                   LNLLEKIPGKNAIDVTYLLEEGSGRKLRRRTLFIPENSFRK"
FT   gene            complement(24438990..24445709)
FT                   /gene="Rusc1"
FT                   /locus_tag="mCG_17549"
FT                   /note="gene_id=mCG17549.2"
FT   mRNA            complement(join(24438990..24439660,24441783..24441905,
FT                   24442885..24443278,24443810..24443856,24444010..24444115,
FT                   24444187..24444361,24444495..24444571,24444679..24444777,
FT                   24445506..24445709))
FT                   /gene="Rusc1"
FT                   /locus_tag="mCG_17549"
FT                   /product="RUN and SH3 domain containing 1"
FT                   /note="gene_id=mCG17549.2 transcript_id=mCT14205.2 created
FT                   on 27-SEP-2002"
FT   CDS             complement(join(24439492..24439660,24441783..24441905,
FT                   24442885..24443278,24443810..24443856,24444010..24444115,
FT                   24444187..24444361,24444495..24444571,24444679..24444727))
FT                   /codon_start=1
FT                   /gene="Rusc1"
FT                   /locus_tag="mCG_17549"
FT                   /product="RUN and SH3 domain containing 1"
FT                   /note="gene_id=mCG17549.2 transcript_id=mCT14205.2
FT                   protein_id=mCP17272.2"
FT                   /protein_id="EDL15240.1"
FT                   /translation="MAEAQSGTGQLQEQKKGLLIAVSASVDKIISHFGAARNLVQKAQL
FT                   GDSRLSPDVGHLVLTTLCPALHALVADGLKPFRKDLITGQRRSSPWSVVEASVKPGSCT
FT                   HSMGSLYSQVSRLAPLSSSRSRFHAFILGLLNTKQLELWFSSLQEDAGLLSLLYLPTGF
FT                   FSLARGSCPSLATELLLLLQPLSVLTFHLDLLFEHHHHLPVGLQQAPAPSCPPPALQQT
FT                   MQAVLHWGERLAQSLRGTSGESTTDSSTPSARPPAGSWWDQLTQASRVYASGGTEGFPL
FT                   LRRPSSWLPPTVSVLALVKRGTPPETPPEALVSSPGSVVQADRAVRALCDHTAAGPDQL
FT                   SFQRGELLRVIATVDEDWLRCGRDGVEGLVPVGYTSLVL"
FT   gene            complement(24448599..24456955)
FT                   /locus_tag="mCG_17543"
FT                   /note="gene_id=mCG17543.2"
FT   mRNA            complement(join(24448599..24448853,24449241..24449375,
FT                   24449462..24449539,24449870..24449942,24450024..24450112,
FT                   24450364..24450486,24450609..24450689,24454310..24454450,
FT                   24455679..24455841,24456872..24456955))
FT                   /locus_tag="mCG_17543"
FT                   /product="mCG17543, transcript variant mCT181512"
FT                   /note="gene_id=mCG17543.2 transcript_id=mCT181512.1 created
FT                   on 13-JUN-2003"
FT   mRNA            complement(join(24448599..24448853,24449241..24449375,
FT                   24449462..24449539,24449870..24449942,24450024..24450112,
FT                   24450364..24450486,24450609..24450689,24454310..24454450,
FT                   24455679..24455841,24455931..24456331))
FT                   /locus_tag="mCG_17543"
FT                   /product="mCG17543, transcript variant mCT14201"
FT                   /note="gene_id=mCG17543.2 transcript_id=mCT14201.2 created
FT                   on 13-JUN-2003"
FT   CDS             complement(join(24448653..24448853,24449241..24449375,
FT                   24449462..24449539,24449870..24449942,24450024..24450112,
FT                   24450364..24450486,24450609..24450689,24454310..24454450,
FT                   24455679..24455841,24455931..24456109))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17543"
FT                   /product="mCG17543, isoform CRA_a"
FT                   /note="gene_id=mCG17543.2 transcript_id=mCT14201.2
FT                   protein_id=mCP17234.2 isoform=CRA_a"
FT                   /protein_id="EDL15238.1"
FT                   /translation="MPLSCWLRSLGVFLLPAPCWAPRERWLGFLQRPSLAYGCPVLGAW
FT                   HSARWWCQVWTEEPRAFSSSVRMNGNQKLDAYNQEKQNFIQHFSQIVKVLTEKELGHPE
FT                   IGDAIARLKEVLEYNALGGKYNRGLTVVQAFQELVEPKKQDAESLQRALTVGWCVELLQ
FT                   AFFLVSDDIMDSSLTRRGQICWYQKPGIGLDAINDALLLEASIYRLLKFYCREQPYYLN
FT                   LLELFLQSSYQTEIGQTLDLMTAPQGHVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAM
FT                   YMAGIDGEKEHANALKILMEMGEFFQVQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQ
FT                   CLLRASPQQRQILEENYGQKDPEKVARVKALYEALDLQSAFFKYEEDSYNRLKSLIEQC
FT                   SAPLPPSIFMELANKIYKRRK"
FT   CDS             complement(join(24448653..24448853,24449241..24449375,
FT                   24449462..24449539,24449870..24449942,24450024..24450112,
FT                   24450364..24450486,24450609..24450689,24454310..24454450,
FT                   24455679..24455819))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17543"
FT                   /product="mCG17543, isoform CRA_b"
FT                   /note="gene_id=mCG17543.2 transcript_id=mCT181512.1
FT                   protein_id=mCP104434.1 isoform=CRA_b"
FT                   /db_xref="GOA:Q4FJN9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="MGI:MGI:104888"
FT                   /db_xref="UniProtKB/TrEMBL:Q4FJN9"
FT                   /protein_id="EDL15239.1"
FT                   /translation="MNGNQKLDAYNQEKQNFIQHFSQIVKVLTEKELGHPEIGDAIARL
FT                   KEVLEYNALGGKYNRGLTVVQAFQELVEPKKQDAESLQRALTVGWCVELLQAFFLVSDD
FT                   IMDSSLTRRGQICWYQKPGIGLDAINDALLLEASIYRLLKFYCREQPYYLNLLELFLQS
FT                   SYQTEIGQTLDLMTAPQGHVDLGRYTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGE
FT                   KEHANALKILMEMGEFFQVQDDYLDLFGDPSVTGKVGTDIQDNKCSWLVVQCLLRASPQ
FT                   QRQILEENYGQKDPEKVARVKALYEALDLQSAFFKYEEDSYNRLKSLIEQCSAPLPPSI
FT                   FMELANKIYKRRK"
FT   gene            24484590..24495991
FT                   /gene="Pklr"
FT                   /locus_tag="mCG_17567"
FT                   /note="gene_id=mCG17567.2"
FT   mRNA            join(24484590..24484730,24485672..24485854,
FT                   24491324..24491415,24491515..24491646,24491772..24491958,
FT                   24492215..24492485,24492601..24492751,24492971..24493123,
FT                   24493219..24493385,24494835..24495016,24495476..24495991)
FT                   /gene="Pklr"
FT                   /locus_tag="mCG_17567"
FT                   /product="pyruvate kinase liver and red blood cell"
FT                   /note="gene_id=mCG17567.2 transcript_id=mCT14224.2 created
FT                   on 05-AUG-2002"
FT   CDS             join(24484631..24484730,24485672..24485854,
FT                   24491324..24491415,24491515..24491646,24491772..24491958,
FT                   24492215..24492485,24492601..24492751,24492971..24493123,
FT                   24493219..24493385,24494835..24495016,24495476..24495582)
FT                   /codon_start=1
FT                   /gene="Pklr"
FT                   /locus_tag="mCG_17567"
FT                   /product="pyruvate kinase liver and red blood cell"
FT                   /note="gene_id=mCG17567.2 transcript_id=mCT14224.2
FT                   protein_id=mCP17239.1"
FT                   /db_xref="GOA:G3X925"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="MGI:MGI:97604"
FT                   /db_xref="UniProtKB/TrEMBL:G3X925"
FT                   /protein_id="EDL15236.1"
FT                   /translation="MSVQENELPQQLWPWIFKSQKDLAKSALSGAPGGPAGYLRRASVA
FT                   QLTQELGTAFFQQQQLPAAMADTFLEHLCLLDIDSEPVAARSTSIIATIGPASRSVDRL
FT                   KEMIKAGMNIARLNFSHGSHEYHAESIANIREAAESFATSPLSYRPVAIALDTKGPEIR
FT                   TGVLQGGPESEVEIVKGSQVLVTVDPKFRTRGDAKTVWVDYHNITQVVAVGGRIYIDDG
FT                   LISLVVRKIGPEGLVTEVEHGGFLGNRKGVNLPNAEVDLPGLSEQDLLDLRFGVEHNVD
FT                   IIFASFVRKASDVVAVRDALGPEGRGIKIISKIENHEGVKKFDEILEVSDGIMVARGDL
FT                   GIEIPAEKVFLAQKMMIGRCNLAGKPVVCATQMLESMITKARPTRAETSDVANAVLDGA
FT                   DCIMLSGETAKGSFPVEAVKMQHAIAREAEAAVYHRQLFEELRRAAPLSRDPTEVTAIG
FT                   AVEASFKCCAAAIIVLTKTGRSAQLLSRYRPRAAVIAVTRSAQAARQVHLSRGVFPLLY
FT                   REPPEAVWADDVDRRVQFGIESGKLRGFLRVGDLVIVVTGWRPGSGYTNIMRVLTIS"
FT   gene            complement(24487586..24488279)
FT                   /locus_tag="mCG_17565"
FT                   /note="gene_id=mCG17565.0"
FT   mRNA            complement(24487586..24488279)
FT                   /locus_tag="mCG_17565"
FT                   /product="mCG17565"
FT                   /note="gene_id=mCG17565.0 transcript_id=mCT14221.1 created
FT                   on 31-OCT-2002"
FT   CDS             complement(24487833..24488075)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17565"
FT                   /product="mCG17565"
FT                   /note="gene_id=mCG17565.0 transcript_id=mCT14221.1
FT                   protein_id=mCP17236.2"
FT                   /protein_id="EDL15237.1"
FT                   /translation="MNFSTLRNIQGLFAPLKLQMEFKAVQQVHRLPFLPSSNLSLDILR
FT                   GNDETIGFEDILNDPSQSELMGEPHVMVEHKLGLL"
FT   gene            complement(24496083..24510182)
FT                   /gene="Hcn3"
FT                   /locus_tag="mCG_17563"
FT                   /note="gene_id=mCG17563.2"
FT   mRNA            complement(join(24496083..24498304,24498716..24498880,
FT                   24499815..24500055,24500354..24500500,24500861..24501079,
FT                   24501424..24501585,24502645..24503074,24509810..24510182))
FT                   /gene="Hcn3"
FT                   /locus_tag="mCG_17563"
FT                   /product="hyperpolarization-activated, cyclic
FT                   nucleotide-gated K+ 3"
FT                   /note="gene_id=mCG17563.2 transcript_id=mCT14219.2 created
FT                   on 05-AUG-2002"
FT   CDS             complement(join(24497604..24498304,24498716..24498880,
FT                   24499815..24500055,24500354..24500500,24500861..24501079,
FT                   24501424..24501585,24502645..24503074,24509810..24510084))
FT                   /codon_start=1
FT                   /gene="Hcn3"
FT                   /locus_tag="mCG_17563"
FT                   /product="hyperpolarization-activated, cyclic
FT                   nucleotide-gated K+ 3"
FT                   /note="gene_id=mCG17563.2 transcript_id=mCT14219.2
FT                   protein_id=mCP17226.2"
FT                   /db_xref="GOA:B2RRB5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR013621"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="MGI:MGI:1298211"
FT                   /db_xref="UniProtKB/TrEMBL:B2RRB5"
FT                   /protein_id="EDL15235.1"
FT                   /translation="MEEEARPAAGAGEAATPARETPPAAPAQARAASGGVPESAPEPKR
FT                   RQLGTLLQPTVNKFSLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMV
FT                   GNLIVLPVGITFFKEENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAI
FT                   RTRYLRTWFLVDLISSIPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLR
FT                   LSRLIRYIHQWEEIFHMTYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPSDC
FT                   WVSMNRMVNHSWGRQYSHALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAM
FT                   FIGHATALIQSLDSSRRQYQEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEE
FT                   SILGELSEPLREEIINFTCRGLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREG
FT                   SVGRKMYFIQHGLLSVLARGARDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLS
FT                   VDHFNAVLEEFPMMRRAFETVAMDRLRRIGKKNSILQRKRSEPSPGSSGGVMEQHLVQH
FT                   DRDMARGVRGLAPGTGARLSGKPVLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPD
FT                   SPATLLARSARRSAGSPASPLVPVRAGPLLARGPWASTSRLPAPPARTLHASLSRTGRS
FT                   QVSLLGPPPGGGARRLGPRGRPLSASQPSLPQRATGDGSPRRKGSGSERLPPSGLLAKP
FT                   PGTVQPPRSSVPEPVTPRGPQISANM"
FT   gene            <24514780..24526916
FT                   /gene="Clk2"
FT                   /locus_tag="mCG_17559"
FT                   /note="gene_id=mCG17559.3"
FT   mRNA            join(<24514780..24515070,24516999..24517168,
FT                   24518654..24518879,24519581..24519665,24520012..24520078,
FT                   24520256..24520372,24523372..24523538,24524192..24524286,
FT                   24524940..24525069,24525153..24525235,24525387..24525466,
FT                   24525640..24525730,24526389..24526915)
FT                   /gene="Clk2"
FT                   /locus_tag="mCG_17559"
FT                   /product="CDC-like kinase 2, transcript variant mCT190934"
FT                   /note="gene_id=mCG17559.3 transcript_id=mCT190934.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<24514780..24515070,24516999..24517168,
FT                   24518654..24518879,24519581..24519665,24520012..24520078,
FT                   24520256..24520372,24523372..24523538,24524192..24524286,
FT                   24524940..24525069,24525153..24525235,24525387..24525466,
FT                   24525640..24525730,24526389..24526574)
FT                   /codon_start=1
FT                   /gene="Clk2"
FT                   /locus_tag="mCG_17559"
FT                   /product="CDC-like kinase 2, isoform CRA_b"
FT                   /note="gene_id=mCG17559.3 transcript_id=mCT190934.0
FT                   protein_id=mCP111891.0 isoform=CRA_b"
FT                   /protein_id="EDL15234.1"
FT                   /translation="LTAAAAAERRGQSRRPSWDRAPGGGGARGAERILGAGTEPGRAGL
FT                   EQSPGTGREVPGPRVGGWNRTSSPRGCRDSGRSAAAITDFLWDKRTGLAARTMPHPRRY
FT                   HSSERGSRGSYHEHYQSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSYDDHSSDRR
FT                   LYDRRYCGSYRRNDYSRDRGEAYYDTDFRQSYEYHRENSSYRSQRSSRRKHRRRRRRSR
FT                   TFSRSSSHSSRRAKSVEDDAEGHLIYHVGDWLQERYEIVSTLGEGTFGRVVQCVDHRRG
FT                   GTRVALKIIKNVEKYKEAARLEINVLEKINEKDPDNKNLCVQMFDWFDYHGHMCISFEL
FT                   LGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLHDNKLTHTDLKPENILFVNSDYE
FT                   LTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTIVSTRHYRAPEVILELGWSQPCD
FT                   VWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPVPSRMIRKTRKQKYFYRGRLDWD
FT                   ENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENMLEYEPAKRLTLGEALQHPFFAC
FT                   LRTEPPNTKLWDSSRDISR"
FT   mRNA            join(24514799..24515070,24516999..24517168,
FT                   24518651..24518879,24519581..24519665,24520012..24520078,
FT                   24520256..24520372,24523372..24523538,24524192..24524286,
FT                   24524940..24525069,24525153..24525235,24525387..24525466,
FT                   24525640..24525730,24526389..24526916)
FT                   /gene="Clk2"
FT                   /locus_tag="mCG_17559"
FT                   /product="CDC-like kinase 2, transcript variant mCT14215"
FT                   /note="gene_id=mCG17559.3 transcript_id=mCT14215.1 created
FT                   on 05-AUG-2002"
FT   CDS             join(24516999..24517168,24518651..24518879,
FT                   24519581..24519665,24520012..24520078,24520256..24520372,
FT                   24523372..24523538,24524192..24524286,24524940..24525069,
FT                   24525153..24525235,24525387..24525466,24525640..24525730,
FT                   24526389..24526574)
FT                   /codon_start=1
FT                   /gene="Clk2"
FT                   /locus_tag="mCG_17559"
FT                   /product="CDC-like kinase 2, isoform CRA_a"
FT                   /note="gene_id=mCG17559.3 transcript_id=mCT14215.1
FT                   protein_id=mCP17281.1 isoform=CRA_a"
FT                   /protein_id="EDL15233.1"
FT                   /translation="MPHPRRYHSSERGSRGSYHEHYQSRKHKRRRSRSWSSSSDRTRRR
FT                   RREDSYHVRSRSSYDDHSSDRRLYDRRYCGSYRRNDYSRDRGEAYYDTDFRQSYEYHRE
FT                   NSSYRSQRSSRRKHRRRRRRSRTFSRSSSHSSRRAKSVEDDAEGHLIYHVGDWLQERYE
FT                   IVSTLGEGTFGRVVQCVDHRRGGTRVALKIIKNVEKYKEAARLEINVLEKINEKDPDNK
FT                   NLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQLCQAVKFLH
FT                   DNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKSTAVRVVDFGSATFDHEHHSTI
FT                   VSTRHYRAPEVILELGWSQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMMERILGPV
FT                   PSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEAEDHHQLFDLIENM
FT                   LEYEPAKRLTLGEALQHPFFACLRTEPPNTKLWDSSRDISR"
FT   gene            24527385..24532760
FT                   /gene="Scamp3"
FT                   /locus_tag="mCG_17556"
FT                   /note="gene_id=mCG17556.1"
FT   mRNA            join(24527385..24527652,24527985..24528062,
FT                   24529090..24529218,24529312..24529432,24530247..24530375,
FT                   24530724..24530883,24531170..24531271,24531921..24532038,
FT                   24532294..24532760)
FT                   /gene="Scamp3"
FT                   /locus_tag="mCG_17556"
FT                   /product="secretory carrier membrane protein 3"
FT                   /note="gene_id=mCG17556.1 transcript_id=mCT14212.2 created
FT                   on 05-AUG-2002"
FT   CDS             join(24527587..24527652,24527985..24528062,
FT                   24529090..24529218,24529312..24529432,24530247..24530375,
FT                   24530724..24530883,24531170..24531271,24531921..24532038,
FT                   24532294..24532440)
FT                   /codon_start=1
FT                   /gene="Scamp3"
FT                   /locus_tag="mCG_17556"
FT                   /product="secretory carrier membrane protein 3"
FT                   /note="gene_id=mCG17556.1 transcript_id=mCT14212.2
FT                   protein_id=mCP17273.2"
FT                   /db_xref="GOA:O35609"
FT                   /db_xref="InterPro:IPR007273"
FT                   /db_xref="MGI:MGI:1346346"
FT                   /db_xref="UniProtKB/Swiss-Prot:O35609"
FT                   /protein_id="EDL15232.1"
FT                   /translation="MAQSRDTGNPFPDSGELDNPFQDPAVIQHRPSQQYATLDVYNPFE
FT                   NREPPPAYEPPAPAPAPLPPPSAPSVQSSRKLSPTEPRNYGSYSTQASAAAATAELLKK
FT                   QEELNRKAEELDRRERELQHVALGGAGTRQNNWPPLPSFCPVKPCFFQDISMEIPQEFQ
FT                   KTVSTMYYLWMCSTLALLLNFFACLARFCVDTGSGSGFGLSMLWLLLFTPCSFVCWYRP
FT                   MYKAFRSDSSFNFFVFFFIFFVQDVFFVLQAIGIPGWGFSGWVTALVVVGSKPAVAVLM
FT                   LLVALLFTGIAVLGIVMLKRIHSLYRQTGASFQKAQQEFAAGVFSNPAVRTAAANAAAG
FT                   AAENAFRAP"
FT   gene            24533234..24539285
FT                   /gene="1110013L07Rik"
FT                   /locus_tag="mCG_17552"
FT                   /note="gene_id=mCG17552.2"
FT   mRNA            join(24533234..24533943,24534147..24534203,
FT                   24534406..24534516,24534623..24534742,24534882..24534989,
FT                   24535430..24535602,24535727..24535826,24536772..24536841,
FT                   24537052..24537597,24538069..24538137,24538216..24538469,
FT                   24538559..24539285)
FT                   /gene="1110013L07Rik"
FT                   /locus_tag="mCG_17552"
FT                   /product="RIKEN cDNA 1110013L07"
FT                   /note="gene_id=mCG17552.2 transcript_id=mCT14209.2 created
FT                   on 27-SEP-2002"
FT   CDS             join(24533719..24533943,24534147..24534203,
FT                   24534406..24534516,24534623..24534742,24534882..24534989,
FT                   24535430..24535602,24535727..24535826,24536772..24536841,
FT                   24537052..24537597,24538069..24538137,24538216..24538469,
FT                   24538559..24538732)
FT                   /codon_start=1
FT                   /gene="1110013L07Rik"
FT                   /locus_tag="mCG_17552"
FT                   /product="RIKEN cDNA 1110013L07"
FT                   /note="gene_id=mCG17552.2 transcript_id=mCT14209.2
FT                   protein_id=mCP17276.1"
FT                   /protein_id="EDL15231.1"
FT                   /translation="MMPSPSDSSRSLTSRPSTRGLTHLRLHRPWLQALLTLGLAQVLLG
FT                   ILVITFSMVASSVTTTESIKRSCPSWAGFSLAFSGLVGIVSWKRPFTLVISFFSLLSVL
FT                   CVMLSMAGSVLSCKNAQLARDFRECSMEGKVCVCCPPIPLHRPCPEWGQELKVALNSTC
FT                   DEARGALKNLLFSVCGLTICAAIICTLSAIVCCVQIFSLDLVHMLAPERSVSGPLGPLA
FT                   CTSSPPAPLLHTMLDLEEFVPPVPPPPYYPPEYTCSSETDAQSITYNGSMDSPVPLYPT
FT                   DCPPSYEAVMGLRRDSQATLFDPQLHDGSCVCERVASIVDVSMDSGSLVLSAIGDLPGG
FT                   SSPSEDSCLLELQGSVRSVDYVLFRSIQRSRAGYCLSLDCGLRGPFEDSPLPRRPPRAA
FT                   RSYSCSAPEAPPPLGAPTAARSCHRLEGWPPWVGPCFPELRRRVPRGGSRSAAPPPARA
FT                   PARRFSDSSGSLTPPGHRPPHRTPPPPLLLPRSHSDPGITTSSDIADFRDLYTKVLEEE
FT                   AASVSSADTGLCSEACLFRLARCPSPKLLRARSAEKRRPVPTFQKVPLPSGPTPAHSLG
FT                   DLKGSWPGRGLVTRFLQLSRRSPDPTGTGAHGYKQVRRSPWGRPGRESLHLRSCGDLSS
FT                   GSSLRRLLSARRLEHGIRPHSLSLNGGSRETGL"
FT   gene            24552925..24558682
FT                   /gene="Gba"
FT                   /locus_tag="mCG_17555"
FT                   /note="gene_id=mCG17555.3"
FT   mRNA            join(24552925..24553086,24553472..24553541,
FT                   24553986..24554177,24554276..24554422,24555448..24555581,
FT                   24555793..24555965,24556135..24556369,24557228..24557452,
FT                   24557825..24557988,24558313..24558429,24558518..24558673)
FT                   /gene="Gba"
FT                   /locus_tag="mCG_17555"
FT                   /product="glucosidase, beta, acid, transcript variant
FT                   mCT14211"
FT                   /note="gene_id=mCG17555.3 transcript_id=mCT14211.1 created
FT                   on 05-AUG-2002"
FT   mRNA            join(<24552940..24553086,24553192..24553360,
FT                   24553472..24553541,24553986..24554177,24554276..24554422,
FT                   24555448..24555581,24555793..24555965,24556135..24556369,
FT                   24557228..24557452,24557825..24557988,24558313..24558429,
FT                   24558518..24558682)
FT                   /gene="Gba"
FT                   /locus_tag="mCG_17555"
FT                   /product="glucosidase, beta, acid, transcript variant
FT                   mCT190927"
FT                   /note="gene_id=mCG17555.3 transcript_id=mCT190927.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<24553349..24553360,24553472..24553541,
FT                   24553986..24554177,24554276..24554422,24555448..24555581,
FT                   24555793..24555965,24556135..24556369,24557228..24557452,
FT                   24557825..24557988,24558313..24558429,24558518..24558623)
FT                   /codon_start=1
FT                   /gene="Gba"
FT                   /locus_tag="mCG_17555"
FT                   /product="glucosidase, beta, acid, isoform CRA_a"
FT                   /note="gene_id=mCG17555.3 transcript_id=mCT190927.0
FT                   protein_id=mCP111889.0 isoform=CRA_a"
FT                   /protein_id="EDL15229.1"
FT                   /translation="SLIKKCAGVMAARLIGFFLFQAVSWAYGAQPCIPKSFGYSSVVCV
FT                   CNASYCDSLDPVTLPALGTFSRYESTRRGRRMELSVGAIQANRTGTGLLLTLQPEKKFQ
FT                   KVKGFGGAMTDATALNILALSPPTQKLLLRSYFSTNGIEYNIIRVPMASCDFSIRVYTY
FT                   ADTPNDFQLSNFSLPEEDTKLKIPLIHQALKMSSRPISLFASPWTSPTWLKTNGRVNGK
FT                   GSLKGQPGDIFHQTWANYFVKFLDAYAKYGLRFWAVTAENEPTAGLFTGYPFQCLGFTP
FT                   EHQRDFISRDLGPALANSSHDVKLLMLDDQRLLLPRWAEVVLSDPEAAKYVHGIAVHWY
FT                   MDFLAPAKATLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLL
FT                   YHVTGWTDWNLALNPEGGPNWVRNFVDSPIIVDIPKDAFYKQPMFYHLGHFSKFIPEGS
FT                   QRVALVASESTDLETVALLRPDGSAVVVVLNRSSEDVPLTISDPDLGFLETVSPGYSIH
FT                   TYLWRRQ"
FT   CDS             join(24553487..24553541,24553986..24554177,
FT                   24554276..24554422,24555448..24555581,24555793..24555965,
FT                   24556135..24556369,24557228..24557452,24557825..24557988,
FT                   24558313..24558429,24558518..24558623)
FT                   /codon_start=1
FT                   /gene="Gba"
FT                   /locus_tag="mCG_17555"
FT                   /product="glucosidase, beta, acid, isoform CRA_b"
FT                   /note="gene_id=mCG17555.3 transcript_id=mCT14211.1
FT                   protein_id=mCP17261.1 isoform=CRA_b"
FT                   /protein_id="EDL15230.1"
FT                   /translation="MAARLIGFFLFQAVSWAYGAQPCIPKSFGYSSVVCVCNASYCDSL
FT                   DPVTLPALGTFSRYESTRRGRRMELSVGAIQANRTGTGLLLTLQPEKKFQKVKGFGGAM
FT                   TDATALNILALSPPTQKLLLRSYFSTNGIEYNIIRVPMASCDFSIRVYTYADTPNDFQL
FT                   SNFSLPEEDTKLKIPLIHQALKMSSRPISLFASPWTSPTWLKTNGRVNGKGSLKGQPGD
FT                   IFHQTWANYFVKFLDAYAKYGLRFWAVTAENEPTAGLFTGYPFQCLGFTPEHQRDFISR
FT                   DLGPALANSSHDVKLLMLDDQRLLLPRWAEVVLSDPEAAKYVHGIAVHWYMDFLAPAKA
FT                   TLGETHRLFPNTMLFASEACVGSKFWEQSVRLGSWDRGMQYSHSIITNLLYHVTGWTDW
FT                   NLALNPEGGPNWVRNFVDSPIIVDIPKDAFYKQPMFYHLGHFSKFIPEGSQRVALVASE
FT                   STDLETVALLRPDGSAVVVVLNRSSEDVPLTISDPDLGFLETVSPGYSIHTYLWRRQ"
FT   gene            complement(24559090..24564289)
FT                   /gene="Mtx1"
FT                   /locus_tag="mCG_17553"
FT                   /note="gene_id=mCG17553.2"
FT   mRNA            complement(join(24559090..24559422,24559506..24559660,
FT                   24560108..24560184,24560267..24560449,24560585..24560677,
FT                   24562684..24562763,24562878..24562947,24563814..24564289))
FT                   /gene="Mtx1"
FT                   /locus_tag="mCG_17553"
FT                   /product="metaxin 1, transcript variant mCT14207"
FT                   /note="gene_id=mCG17553.2 transcript_id=mCT14207.2 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(24559108..24559422,24559506..24559660,
FT                   24560108..24560184,24560267..24560449,24560585..24560674,
FT                   24562684..24562763,24562878..24562947,24563814..24564278))
FT                   /gene="Mtx1"
FT                   /locus_tag="mCG_17553"
FT                   /product="metaxin 1, transcript variant mCT181516"
FT                   /note="gene_id=mCG17553.2 transcript_id=mCT181516.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(24559208..24559422,24559506..24559660,
FT                   24560108..24560184,24560267..24560449,24560585..24560674,
FT                   24562684..24562763,24562878..24562947,24563814..24563894))
FT                   /codon_start=1
FT                   /gene="Mtx1"
FT                   /locus_tag="mCG_17553"
FT                   /product="metaxin 1, isoform CRA_b"
FT                   /note="gene_id=mCG17553.2 transcript_id=mCT181516.0
FT                   protein_id=mCP104438.0 isoform=CRA_b"
FT                   /protein_id="EDL15227.1"
FT                   /translation="MAAPMELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNP
FT                   WQSPSGTLPALRTSDGKVITVPHKIITHLRKEYNADYDLSARQGADTLAFMSLLEEKLL
FT                   PVLIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLLCGEHKSENEE
FT                   ELEKELYQEARECLTLLSQRLGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAH
FT                   LRGLHNLCAYCTHILNLYFPRDGDEVPLPRQTPAAPETEEEPYRRRTQILSVLAGLAAM
FT                   VGYALLSGIVSIQRTSPARAPGTRALGLAEEDEED"
FT   CDS             complement(join(24559208..24559422,24559506..24559660,
FT                   24560108..24560184,24560267..24560449,24560585..24560677,
FT                   24562684..24562763,24562878..24562947,24563814..24563894))
FT                   /codon_start=1
FT                   /gene="Mtx1"
FT                   /locus_tag="mCG_17553"
FT                   /product="metaxin 1, isoform CRA_a"
FT                   /note="gene_id=mCG17553.2 transcript_id=mCT14207.2
FT                   protein_id=mCP17242.2 isoform=CRA_a"
FT                   /db_xref="GOA:Q8R5C0"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR017410"
FT                   /db_xref="InterPro:IPR019564"
FT                   /db_xref="MGI:MGI:103025"
FT                   /db_xref="UniProtKB/TrEMBL:Q8R5C0"
FT                   /protein_id="EDL15226.1"
FT                   /translation="MAAPMELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNP
FT                   WQSPSGTLPALRTSDGKVITVPHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKL
FT                   LPVLIHTFWIDAKNYVEVTRKWYAEAMPFPLNFFLPGRMQRQYMERLQLLCGEHKSENE
FT                   EELEKELYQEARECLTLLSQRLGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQA
FT                   HLRGLHNLCAYCTHILNLYFPRDGDEVPLPRQTPAAPETEEEPYRRRTQILSVLAGLAA
FT                   MVGYALLSGIVSIQRTSPARAPGTRALGLAEEDEED"
FT   mRNA            complement(join(<24559576..24559660,24560108..24560184,
FT                   24560267..24560449,24560585..24560677,24562684..24562947,
FT                   24563814..24564178))
FT                   /gene="Mtx1"
FT                   /locus_tag="mCG_17553"
FT                   /product="metaxin 1, transcript variant mCT181515"
FT                   /note="gene_id=mCG17553.2 transcript_id=mCT181515.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(<24559576..24559660,24560108..24560184,
FT                   24560267..24560449,24560585..24560677,24562684..24562947,
FT                   24563814..24563894))
FT                   /codon_start=1
FT                   /gene="Mtx1"
FT                   /locus_tag="mCG_17553"
FT                   /product="metaxin 1, isoform CRA_c"
FT                   /note="gene_id=mCG17553.2 transcript_id=mCT181515.0
FT                   protein_id=mCP104437.0 isoform=CRA_c"
FT                   /protein_id="EDL15228.1"
FT                   /translation="MAAPMELFCWSGGWGLPSVDLDSLAVLTYTRFTGAPLKIHKTSNP
FT                   WQSPSGIPEGQECARGGAGDRNAMQMSMTRQAGPCEYTSFSISGTLPALRTSDGKVITV
FT                   PHKIITHLRKEKYNADYDLSARQGADTLAFMSLLEEKLLPVLIHTFWIDAKNYVEVTRK
FT                   WYAEAMPFPLNFFLPGRMQRQYMERLQLLCGEHKSENEEELEKELYQEARECLTLLSQR
FT                   LGSQKFFFGDAPASLDAFVFSHLALLLQAKLPSGKLQAH"
FT   gene            24565184..24577046
FT                   /gene="Thbs3"
FT                   /locus_tag="mCG_133395"
FT                   /note="gene_id=mCG133395.1"
FT   mRNA            join(24565184..24565301,24566658..24566864,
FT                   24567662..24567918,24568005..24568107,24568834..24568860,
FT                   24569024..24569106,24569190..24569241,24569366..24569514,
FT                   24569832..24569972,24570129..24570206,24571117..24571269,
FT                   24571493..24571603,24571686..24571793,24573162..24573321,
FT                   24573564..24573682,24573790..24573842,24574119..24574194,
FT                   24574237..24574354,24574487..24574665,24574778..24574826,
FT                   24575011..24575207,24575453..24575625,24576515..24576654,
FT                   24576737..24577046)
FT                   /gene="Thbs3"
FT                   /locus_tag="mCG_133395"
FT                   /product="thrombospondin 3"
FT                   /note="gene_id=mCG133395.1 transcript_id=mCT134763.1
FT                   created on 20-FEB-2003"
FT   CDS             join(24565223..24565301,24566658..24566864,
FT                   24567662..24567918,24568005..24568107,24568834..24568860,
FT                   24569024..24569106,24569190..24569241,24569366..24569514,
FT                   24569832..24569972,24570129..24570206,24571117..24571269,
FT                   24571493..24571603,24571686..24571793,24573162..24573321,
FT                   24573564..24573682,24573790..24573842,24574119..24574194,
FT                   24574237..24574354,24574487..24574665,24574778..24574826,
FT                   24575011..24575207,24575453..24575625,24576515..24576654,
FT                   24576737..24576795)
FT                   /codon_start=1
FT                   /gene="Thbs3"
FT                   /locus_tag="mCG_133395"
FT                   /product="thrombospondin 3"
FT                   /note="gene_id=mCG133395.1 transcript_id=mCT134763.1
FT                   protein_id=mCP65701.1"
FT                   /db_xref="GOA:Q05895"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR001791"
FT                   /db_xref="InterPro:IPR001881"
FT                   /db_xref="InterPro:IPR003367"
FT                   /db_xref="InterPro:IPR008859"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR017897"
FT                   /db_xref="InterPro:IPR018097"
FT                   /db_xref="InterPro:IPR024665"
FT                   /db_xref="InterPro:IPR028507"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="MGI:MGI:98739"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q05895"
FT                   /protein_id="EDL15225.1"
FT                   /translation="MEKPELWGVLALLLLCSYTCGSQDLQVIDLLTVGESRQMVAVAEK
FT                   IRTALLTAGDIYLLSTFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQRED
FT                   GKVHAVNLQQAGLADGRTHTALLRLRGPSRPSPGLQLYVDCKLGDQHAGLPALAPIPPA
FT                   EVSGLEIRTGQKAYLRMQGFVESMKIILGGSMARVGALSECPFQGDDSIHNAVTSALQS
FT                   ILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPS
FT                   PCFRGVDCMEVYEYPGYRCGPCPPGLQGNGTHCDDINECAHADPCFPGSSCINTMPGFH
FT                   CEACPPGYKGTRVSGVGIDYARASKQVCNDIDECNDGNNGGCDPNSICTNTVGSFKCGP
FT                   CRLGFLGNQSQGCVPARTCHSPAHSPCHIHAHCLFERNGAVSCQCNVGWAGNGNVCGPD
FT                   TDIDGYPDQALPCMDNNKHCKQDNCLLTPNSGQEDADNDGVGDQCDDDADGDGIKNVED
FT                   NCRLFPNKDQQNSDTDSFGDACDNCPNVPNNDQKDTDGNGEGDACDNDVDGDGIPNGLD
FT                   NCPKVPNPLQTDRDEDGVGDACDSCPEMSNPTQTDADSDLVGDVCDTNEDSDGDGHQDT
FT                   KDNCPQLPNSSQLDSDNDGLGDECDGDDDNDGVPDYIPPGPDNCRLVPNPNQKDSDGNG
FT                   VGDVCEDDFDNDAVVDPLDVCPESAEVTLTDFRAYQTVILDPEGDAQIDPNWVVLNQGM
FT                   EIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFLFSYQDSGRFYVVMWKQT
FT                   EQTYWQATPFRAVAQPGLQLKAVTSISGPGEHLRNALWHTGHTPDQVRLLWTDPRNVGW
FT                   RDKTSYRWRLLHRPQVGYIRVKLYEGPQLVADSGVIIDTSMRGGRLGVFCFSQENIIWS
FT                   NLQYRCNDTVPEDFEPFRRQLLQGRV"
FT   gene            24579262..24583561
FT                   /gene="Muc1"
FT                   /locus_tag="mCG_17542"
FT                   /note="gene_id=mCG17542.0"
FT   mRNA            join(24579262..24579387,24580121..24581424,
FT                   24581523..24581575,24581711..24581844,24581973..24582094,
FT                   24582176..24582325,24583216..24583561)
FT                   /gene="Muc1"
FT                   /locus_tag="mCG_17542"
FT                   /product="mucin 1, transmembrane"
FT                   /note="gene_id=mCG17542.0 transcript_id=mCT14200.1 created
FT                   on 06-AUG-2002"
FT   CDS             join(24579330..24579387,24580121..24581424,
FT                   24581523..24581575,24581711..24581844,24581973..24582094,
FT                   24582176..24582325,24583216..24583290)
FT                   /codon_start=1
FT                   /gene="Muc1"
FT                   /locus_tag="mCG_17542"
FT                   /product="mucin 1, transmembrane"
FT                   /note="gene_id=mCG17542.0 transcript_id=mCT14200.1
FT                   protein_id=mCP17262.1"
FT                   /protein_id="EDL15224.1"
FT                   /translation="MTPGIRAPFFLLLLLASLKGFLALPSEENSVTSSQDTSSSLASTT
FT                   TPVHSSNSDPATRPPGDSTSSPVQSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVNSA
FT                   SSPVAHGDTSSPATSLSKDSNSSPVVHSGTSSAPATTAPVDSTSSPVVHGGTSSPATSP
FT                   PGDSTSSPDHSSTSSPATRAPEDSTSTAVLSGTSSPATTAPVDSTSSPVAHDDTSSPAT
FT                   SLSEDSASSPVAHGGTSSPATSPLRDSTSSPVHSSASIQNIKTTSDLASTPDHNGTSVT
FT                   TTSSALGSATSPDHSGTSTTTNSSESVLATTPVYSSMPFSTTKVTSGSAIIPDHNGSSV
FT                   LPTSSVLGSATSLVYNTSAIATTPVSNGTQPSVPSQYPVSPTMATTSSHSTIASSSYYS
FT                   TVPFSTFSSNSSPQLSVGVSFFFLSFYIQNHPFNSSLEDPSSNYYQELKRNISGLFLQI
FT                   FNGDFLGISSIKFRSGSVVVESTVVFREGTFSASDVKSQLIQHKKEADDYNLTISEVKV
FT                   NEMQFPPSAQSRPGVPGWGIALLVLVCILVALAIVYFLALAVCQCRRKSYGQLDIFPTQ
FT                   DTYHPMSEYPTYHTHGRYVPPGSTKRSPYEEVSAGNGSSSLSYTNPAVVTTSANL"
FT   gene            complement(24584372..>24596043)
FT                   /locus_tag="mCG_17547"
FT                   /note="gene_id=mCG17547.2"
FT   mRNA            complement(join(24584372..24585484,24586495..24586792,
FT                   24587809..24588111,24588858..24588895,24589090..24589211,
FT                   24589463..24589716,24592358..24592453,24592566..24592709,
FT                   24593775..24594118,24594337..24594598,24594888..>24595113))
FT                   /locus_tag="mCG_17547"
FT                   /product="mCG17547, transcript variant mCT190968"
FT                   /note="gene_id=mCG17547.2 transcript_id=mCT190968.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(24584377..24585514,24587755..24588111,
FT                   24589090..24589211,24589463..24589716,24592358..24592453,
FT                   24592566..24592709,24593775..24594118,24594337..24594598,
FT                   24595981..>24596043))
FT                   /locus_tag="mCG_17547"
FT                   /product="mCG17547, transcript variant mCT14204"
FT                   /note="gene_id=mCG17547.2 transcript_id=mCT14204.2 created
FT                   on 25-OCT-2002"
FT   mRNA            complement(join(<24585091..24585484,24586495..24586792,
FT                   24587809..24588111,24589090..24589211,24589463..24589716,
FT                   24592358..24592453,24592566..24592709,24593775..24594118,
FT                   24594337..24594598,24595981..>24596043))
FT                   /locus_tag="mCG_17547"
FT                   /product="mCG17547, transcript variant mCT190969"
FT                   /note="gene_id=mCG17547.2 transcript_id=mCT190969.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(24585091..24585484,24586495..24586792,
FT                   24587809..24588111,24589090..24589211,24589463..24589716,
FT                   24592358..24592453,24592566..24592709,24593775..24594118,
FT                   24594337..24594598,24595981..24596043))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17547"
FT                   /product="mCG17547, isoform CRA_c"
FT                   /note="gene_id=mCG17547.2 transcript_id=mCT190969.0
FT                   protein_id=mCP111888.0 isoform=CRA_c"
FT                   /protein_id="EDL15223.1"
FT                   /translation="MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLV
FT                   LPCTHNVCQACAREVLGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDR
FT                   LLKSGFGTYPGRKRGALHPQTILFPCPACQGDVELGERGLSGLFRNLTLERVVERYRQS
FT                   VSVGGAILCQLCKPPPLEATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRP
FT                   KGLMCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLAYI
FT                   LGNQDTVQTQICELEETIRHTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQ
FT                   ERLSRLSAQIHEHQSLLDGSGLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTF
FT                   RPAASSSFRHCQLDVGREMKLLTELSFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPP
FT                   AWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEY
FT                   SEDVHLHTPPAPVLHFFLDGRWGASRERLAISKDQRAVRSIPGLPLLLAAERLLTGCHL
FT                   SVDVVLGDVAVTQGRSYWACAVDPASYLVKVGVGLESKLQESFQGAPDVISPRYDPDSG
FT                   HDSGAEDAAVEALPPFAFLTIGMGKILLGSGASSNAGLTGRDGPTASCTVPLPPRLGIC
FT                   LDYERGRVSFLDAVSFRGLLECPLDCSGPVCPAFCFIGGGAVQLQEPVGTKPERKVTIG
FT                   GFAKLD"
FT   CDS             complement(join(24585408..24585514,24587755..24588111,
FT                   24589090..24589211,24589463..24589716,24592358..24592453,
FT                   24592566..24592709,24593775..24594118,24594337..24594598,
FT                   24595981..24596043))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17547"
FT                   /product="mCG17547, isoform CRA_a"
FT                   /note="gene_id=mCG17547.2 transcript_id=mCT14204.2
FT                   protein_id=mCP17265.2 isoform=CRA_a"
FT                   /protein_id="EDL15221.1"
FT                   /translation="MAEGEDMQTFTSIMDALVRISTSMKNMEKELLCPVCQEMYKQPLV
FT                   LPCTHNVCQACAREVLGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRTLPKPDRLDR
FT                   LLKSGFGTYPGRKRGALHPQTILFPCPACQGDVELGERGLSGLFRNLTLERVVERYRQS
FT                   VSVGGAILCQLCKPPPLEATKGCTECRATFCNECFKLFHPWGTQKAQHEPTLPTLSFRP
FT                   KGLMCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKDKLTKSLAYI
FT                   LGNQDTVQTQICELEETIRHTEVSGQQAKEEVSQLVRGLGAVLEEKRASLLQAIEECQQ
FT                   ERLSRLSAQIHEHQSLLDGSGLVGYAQEVLKETDQPCFVQAAKQLHNRIARATEALQTF
FT                   RPAASSSFRHCQLDVGREMKLLTELSFLRVPEAPVIDTQRTFAYDQIFLCWRLPPHSPP
FT                   AWHYTVEFRRTDVPAQPGPTRWQRREEVRGTSALLENPDTGSVYVLRVRGCNKAGYGEY
FT                   SEDVHLHTPPAPGEYTDKRLHVVDRDVHAEASFFWIPPPTDTTRTVGTTAVPRTLPWRR
FT                   YHPLLS"
FT   CDS             complement(join(24588091..24588111,24588858..24588895,
FT                   24589090..24589211,24589463..24589716,24592358..24592453,
FT                   24592566..24592709,24593775..24594118,24594337..24594598,
FT                   24594888..>24594977))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17547"
FT                   /product="mCG17547, isoform CRA_b"
FT                   /note="gene_id=mCG17547.2 transcript_id=mCT190968.0
FT                   protein_id=mCP111887.0 isoform=CRA_b"
FT                   /protein_id="EDL15222.1"
FT                   /translation="RKGRGTTPSCRMGGALEINAINPEMEGWRQTSMKNMEKELLCPVC
FT                   QEMYKQPLVLPCTHNVCQACAREVLGQQGYIGHGGDPSSEPTSPASTPSTRSPRLSRRT
FT                   LPKPDRLDRLLKSGFGTYPGRKRGALHPQTILFPCPACQGDVELGERGLSGLFRNLTLE
FT                   RVVERYRQSVSVGGAILCQLCKPPPLEATKGCTECRATFCNECFKLFHPWGTQKAQHEP
FT                   TLPTLSFRPKGLMCPDHKEEVTHYCKTCQRLVCQLCRVRRTHSGHKITPVLSAYQALKD
FT                   KLTKSLAYILGNQDTVQTQICELEETIRHTEVSGQQAKEEVSQLVRGLGAVLEEKRASL
FT                   LQAIEECQQERLSRLSAQIHEHQSLLDGSGLVGYAQEVLKETDQPCFVQAAKQLHNRIA
FT                   RATEALQTFRPAASSSFRHCQLDVGREMKLLTELSFLRGCGHRGLCSGAPQCPRRPS"
FT   gene            24596350..24599994
FT                   /gene="Krtcap2"
FT                   /locus_tag="mCG_17561"
FT                   /note="gene_id=mCG17561.3"
FT   mRNA            join(24596350..24596781,24597044..24597198,
FT                   24597331..24597394,24599344..24599410,24599841..24599992)
FT                   /gene="Krtcap2"
FT                   /locus_tag="mCG_17561"
FT                   /product="keratinocyte associated protein 2, transcript
FT                   variant mCT14217"
FT                   /note="gene_id=mCG17561.3 transcript_id=mCT14217.1 created
FT                   on 25-MAR-2003"
FT   mRNA            join(24596356..24596859,24597044..24597198,
FT                   24597331..24597394,24599344..24599410,24599841..24599992)
FT                   /gene="Krtcap2"
FT                   /locus_tag="mCG_17561"
FT                   /product="keratinocyte associated protein 2, transcript
FT                   variant mCT181520"
FT                   /note="gene_id=mCG17561.3 transcript_id=mCT181520.0 created
FT                   on 25-MAR-2003"
FT   mRNA            join(24596357..24596781,24597047..24597198,
FT                   24597331..24597394,24599344..24599410,24599841..24599994)
FT                   /gene="Krtcap2"
FT                   /locus_tag="mCG_17561"
FT                   /product="keratinocyte associated protein 2, transcript
FT                   variant mCT181521"
FT                   /note="gene_id=mCG17561.3 transcript_id=mCT181521.0 created
FT                   on 25-MAR-2003"
FT   CDS             join(24596526..24596781,24597044..24597198,
FT                   24597331..24597394,24599344..24599410,24599841..24599961)
FT                   /codon_start=1
FT                   /gene="Krtcap2"
FT                   /locus_tag="mCG_17561"
FT                   /product="keratinocyte associated protein 2, isoform CRA_a"
FT                   /note="gene_id=mCG17561.3 transcript_id=mCT14217.1
FT                   protein_id=mCP17223.1 isoform=CRA_a"
FT                   /protein_id="EDL15218.1"
FT                   /translation="MSAACPERQQMPWLQKAGDQAGRWPRMLLEALFPPCHKRALHPRR
FT                   VEEEVKQVHVGPDACVQTTAPALAPLFLQGHGLDHGRGVMVVGTGTSLALSSLLSLLLF
FT                   AGMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCL
FT                   LLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPAKITGKGKKRN"
FT   CDS             join(24596526..24596781,24597047..24597198,
FT                   24597331..24597394,24599344..24599410,24599841..24599961)
FT                   /codon_start=1
FT                   /gene="Krtcap2"
FT                   /locus_tag="mCG_17561"
FT                   /product="keratinocyte associated protein 2, isoform CRA_b"
FT                   /note="gene_id=mCG17561.3 transcript_id=mCT181521.0
FT                   protein_id=mCP104443.0 isoform=CRA_b"
FT                   /protein_id="EDL15219.1"
FT                   /translation="MSAACPERQQMPWLQKAGDQAGRWPRMLLEALFPPCHKRALHPRR
FT                   VEEEVKQVHVGPDACVQTTAPALAPLFLQGHGLDHGRGVMVGTGTSLALSSLLSLLLFA
FT                   GMQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGFQAKIFPEILLCLL
FT                   LALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPAKITGKGKKRN"
FT   CDS             join(24597106..24597198,24597331..24597394,
FT                   24599344..24599410,24599841..24599961)
FT                   /codon_start=1
FT                   /gene="Krtcap2"
FT                   /locus_tag="mCG_17561"
FT                   /product="keratinocyte associated protein 2, isoform CRA_c"
FT                   /note="gene_id=mCG17561.3 transcript_id=mCT181520.0
FT                   protein_id=mCP104442.0 isoform=CRA_c"
FT                   /protein_id="EDL15220.1"
FT                   /translation="MQIYSRQLASTEWLTIQGGLLGSGLFVFSLTAFNNLENLVFGKGF
FT                   QAKIFPEILLCLLLALFASGLIHRVCVTTCFIFSMVGLYYINKISSTLYQATAPVLTPA
FT                   KITGKGKKRN"
FT   gene            24609402..24618232
FT                   /locus_tag="mCG_17569"
FT                   /note="gene_id=mCG17569.1"
FT   mRNA            join(24609402..24609635,24617515..24617758,
FT                   24617881..24618232)
FT                   /locus_tag="mCG_17569"
FT                   /product="mCG17569"
FT                   /note="gene_id=mCG17569.1 transcript_id=mCT14225.1 created
FT                   on 27-SEP-2002"
FT   CDS             24617886..24618164
FT                   /codon_start=1
FT                   /locus_tag="mCG_17569"
FT                   /product="mCG17569"
FT                   /note="gene_id=mCG17569.1 transcript_id=mCT14225.1
FT                   protein_id=mCP17238.1"
FT                   /protein_id="EDL15217.1"
FT                   /translation="MTKLTQWLWGLALLGSAWAALTMGALGLELPFPCREVLWPLPAYL
FT                   LVSAGCYALGTVGYRVATFHDCEDAARELQSQIVEARADLARRGLRF"
FT   gene            complement(24619398..24621710)
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /note="gene_id=mCG17557.1"
FT   mRNA            complement(join(24619398..24619750,24619825..24619944,
FT                   24620202..24620363,24620979..24621102,24621214..24621291,
FT                   24621538..24621710))
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /product="recombination activating gene 1 activating
FT                   protein 1, transcript variant mCT14213"
FT                   /note="gene_id=mCG17557.1 transcript_id=mCT14213.1 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(24619400..24619750,24619825..24619944,
FT                   24620202..24620363,24620979..>24621678))
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /product="recombination activating gene 1 activating
FT                   protein 1, transcript variant mCT190929"
FT                   /note="gene_id=mCG17557.1 transcript_id=mCT190929.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(24619649..24619750,24619825..24619944,
FT                   24620202..24620363,24620979..24621102,24621214..24621291,
FT                   24621538..24621617))
FT                   /codon_start=1
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /product="recombination activating gene 1 activating
FT                   protein 1, isoform CRA_c"
FT                   /note="gene_id=mCG17557.1 transcript_id=mCT14213.1
FT                   protein_id=mCP17279.1 isoform=CRA_c"
FT                   /protein_id="EDL15215.1"
FT                   /translation="MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFL
FT                   PFLTTDVNNLSWLSYGVLKGDGTLIIVNSVGAVLQTLYILAYLHYSPQKHGVLLQTATL
FT                   LAVLLLGYGYFWLLVPDLEARLQQLGLFCSVFTISMYLSPLADLAKIVQTKSTQRLSFS
FT                   LTIATLFCSASWSIYGFRLRDPYITVPNLPGILTSLIRLGLFCKYPPEQDRKYRLLQT"
FT   CDS             complement(join(24619649..24619750,24619825..24619944,
FT                   24620202..24620363,24620979..>24621119))
FT                   /codon_start=1
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /product="recombination activating gene 1 activating
FT                   protein 1, isoform CRA_b"
FT                   /note="gene_id=mCG17557.1 transcript_id=mCT190929.0
FT                   protein_id=mCP111890.0 isoform=CRA_b"
FT                   /protein_id="EDL15214.1"
FT                   /translation="SSFPHSNLSWLSYGVLKGDGTLIIVNSVGAVLQTLYILAYLHYSP
FT                   QKHGVLLQTATLLAVLLLGYGYFWLLVPDLEARLQQLGLFCSVFTISMYLSPLADLAKI
FT                   VQTKSTQRLSFSLTIATLFCSASWSIYGFRLRDPYITVPNLPGILTSLIRLGLFCKYPP
FT                   EQDRKYRLLQT"
FT   mRNA            complement(join(24619677..24619750,24619825..24619944,
FT                   24620202..24620450,24620979..24621291,24621538..24621678))
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /product="recombination activating gene 1 activating
FT                   protein 1, transcript variant mCT181518"
FT                   /note="gene_id=mCG17557.1 transcript_id=mCT181518.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(24619708..24619750,24619825..24619944,
FT                   24620202..24620363,24620979..24621291,24621538..24621666))
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /product="recombination activating gene 1 activating
FT                   protein 1, transcript variant mCT181519"
FT                   /note="gene_id=mCG17557.1 transcript_id=mCT181519.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(24621210..24621291,24621538..24621617))
FT                   /codon_start=1
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /product="recombination activating gene 1 activating
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG17557.1 transcript_id=mCT181519.0
FT                   protein_id=mCP104441.0 isoform=CRA_a"
FT                   /protein_id="EDL15213.1"
FT                   /translation="MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFL
FT                   PFLTTDVK"
FT   CDS             complement(join(24621210..24621291,24621538..24621617))
FT                   /codon_start=1
FT                   /gene="Rag1ap1"
FT                   /locus_tag="mCG_17557"
FT                   /product="recombination activating gene 1 activating
FT                   protein 1, isoform CRA_a"
FT                   /note="gene_id=mCG17557.1 transcript_id=mCT181518.0
FT                   protein_id=mCP104440.0 isoform=CRA_a"
FT                   /protein_id="EDL15216.1"
FT                   /translation="MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFL
FT                   PFLTTDVK"
FT   gene            complement(24622925..24630822)
FT                   /gene="Efna1"
FT                   /locus_tag="mCG_17554"
FT                   /note="gene_id=mCG17554.1"
FT   mRNA            complement(join(24622925..24623793,24623961..24624011,
FT                   24624146..24624211,24627311..24627606,24630632..24630822))
FT                   /gene="Efna1"
FT                   /locus_tag="mCG_17554"
FT                   /product="ephrin A1"
FT                   /note="gene_id=mCG17554.1 transcript_id=mCT14210.1 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(24623681..24623793,24623961..24624011,
FT                   24624146..24624211,24627311..24627606,24630632..24630723))
FT                   /codon_start=1
FT                   /gene="Efna1"
FT                   /locus_tag="mCG_17554"
FT                   /product="ephrin A1"
FT                   /note="gene_id=mCG17554.1 transcript_id=mCT14210.1
FT                   protein_id=mCP17253.1"
FT                   /protein_id="EDL15212.1"
FT                   /translation="MEFLWAPLLGLCCSLAAADRHIVFWNSSNPKFREEDYTVHVQLND
FT                   YLDIICPHYEDDSVADAAMERYTLYMVEHQEYVACQPQSKDQVRWNCNRPSAKHGPEKL
FT                   SEKFQRFTPFILGKEFKEGHSYYYISKPIYHQESQCLKLKVTVNGKITHNPQAHVNPQE
FT                   KRLQADDPEVQVLHSIGYSAAPRLFPLVWAVLLLPLLLLQSQ"
FT   gene            complement(24665283..>24668118)
FT                   /locus_tag="mCG_17541"
FT                   /note="gene_id=mCG17541.2"
FT   mRNA            complement(join(24665283..24666137,24667056..24667133,
FT                   24667318..24667383,24667711..>24668118))
FT                   /locus_tag="mCG_17541"
FT                   /product="mCG17541"
FT                   /note="gene_id=mCG17541.2 transcript_id=mCT14199.2 created
FT                   on 24-SEP-2002"
FT   CDS             complement(join(24666067..24666137,24667056..24667133,
FT                   24667318..24667383,24667711..>24668020))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17541"
FT                   /product="mCG17541"
FT                   /note="gene_id=mCG17541.2 transcript_id=mCT14199.2
FT                   protein_id=mCP17213.2"
FT                   /protein_id="EDL15211.1"
FT                   /translation="PTSFVHSLRREGYTVQVNVNDYLDIYCPHYNSSGPGGGAEQYVLY
FT                   MVNLSGYRTCNASQGSKRWECNRQHASHSPIKFSEKFQRYSAFSLGYEFHAGQEYYYIS
FT                   TPTHNLHWKCLRMKVFVCCASTSHSGEKPVPTLPQFTMGPNVKINVLDSDPFPYQVRPP
FT                   LGPPWPLFCLL"
FT   gene            complement(24685371..24689372)
FT                   /gene="Efna4"
FT                   /locus_tag="mCG_17548"
FT                   /note="gene_id=mCG17548.2"
FT   mRNA            complement(join(24685371..24685790,24686140..24686208,
FT                   24686535..24686830,24689199..24689372))
FT                   /gene="Efna4"
FT                   /locus_tag="mCG_17548"
FT                   /product="ephrin A4"
FT                   /note="gene_id=mCG17548.2 transcript_id=mCT14196.1 created
FT                   on 06-AUG-2002"
FT   CDS             complement(join(24685648..24685790,24686140..24686208,
FT                   24686535..24686830,24689199..24689311))
FT                   /codon_start=1
FT                   /gene="Efna4"
FT                   /locus_tag="mCG_17548"
FT                   /product="ephrin A4"
FT                   /note="gene_id=mCG17548.2 transcript_id=mCT14196.1
FT                   protein_id=mCP17232.1"
FT                   /db_xref="GOA:Q3UQB5"
FT                   /db_xref="InterPro:IPR001799"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR019765"
FT                   /db_xref="MGI:MGI:106643"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UQB5"
FT                   /protein_id="EDL15210.1"
FT                   /translation="MRLLPLLRTVLWAALLGSRLPGCSSLRHPIYWNSSNPRLLRGDAV
FT                   VELGFNDYLDIFCPHYESPGPPEGPETFALYMVDWSGYEACTAEGANAFQRWNCSMPFA
FT                   PFSPVRFSEKIQRYTPFPLGFEFLPGETYYYISVPTPESPGRCLRLQVSVCCKESGSSH
FT                   ESAHPVGSPGESGTSGWRGGHAPSPLCLLLLLLLPILRLLRVL"
FT   gene            complement(24690864..>24701360)
FT                   /gene="Adam15"
FT                   /locus_tag="mCG_17546"
FT                   /note="gene_id=mCG17546.3"
FT   mRNA            complement(join(24690864..24691315,24691417..24691541,
FT                   24692870..24692939,24693299..24693437,24693651..24693723,
FT                   24694475..24694552,24694750..24694945,24695035..24695339,
FT                   24695480..24695572,24695787..24695961,24696068..24696216,
FT                   24696641..24696725,24696855..24697024,24697131..24697199,
FT                   24697305..24697370,24698239..24698428,24698514..24698590,
FT                   24698769..24698847,24699231..24699307,24699880..24699989,
FT                   24701171..24701333))
FT                   /gene="Adam15"
FT                   /locus_tag="mCG_17546"
FT                   /product="a disintegrin and metallopeptidase domain 15
FT                   (metargidin), transcript variant mCT14203"
FT                   /note="gene_id=mCG17546.3 transcript_id=mCT14203.2 created
FT                   on 06-AUG-2002"
FT   mRNA            complement(join(24691002..24691315,24691417..24691541,
FT                   24691763..24691834,24692225..24692299,24692870..24692939,
FT                   24693299..24693437,24693651..24693723,24694475..24694552,
FT                   24694750..24694945,24695035..24695339,24695480..24695572,
FT                   24695787..24695961,24696068..24696216,24696641..24696725,
FT                   24696855..24697024,24697131..24697199,24697305..24697370,
FT                   24698239..24698428,24698514..24698590,24698769..24698847,
FT                   24699231..24699307,24699880..24699989,24701171..>24701360))
FT                   /gene="Adam15"
FT                   /locus_tag="mCG_17546"
FT                   /product="a disintegrin and metallopeptidase domain 15
FT                   (metargidin), transcript variant mCT190961"
FT                   /note="gene_id=mCG17546.3 transcript_id=mCT190961.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(24691008..24691315,24691417..24691478,
FT                   24695872..24695961,24696068..24696216,24696641..24696725,
FT                   24696855..24697024,24697131..24697199,24697305..24697370,
FT                   24698239..24698428,24698514..24698590,24698769..24698847,
FT                   24699231..24699307,24699880..24699989,24701171..>24701321))
FT                   /gene="Adam15"
FT                   /locus_tag="mCG_17546"
FT                   /product="a disintegrin and metallopeptidase domain 15
FT                   (metargidin), transcript variant mCT190962"
FT                   /note="gene_id=mCG17546.3 transcript_id=mCT190962.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(24691236..24691315,24691417..24691478,
FT                   24695872..24695961,24696068..24696216,24696641..24696725,
FT                   24696855..24697024,24697131..24697199,24697305..24697370,
FT                   24698239..24698428,24698514..24698590,24698769..24698847,
FT                   24699231..24699307,24699880..24699989,24701171..>24701291))
FT                   /codon_start=1
FT                   /gene="Adam15"
FT                   /locus_tag="mCG_17546"
FT                   /product="a disintegrin and metallopeptidase domain 15
FT                   (metargidin), isoform CRA_b"
FT                   /note="gene_id=mCG17546.3 transcript_id=mCT190962.0
FT                   protein_id=mCP111886.0 isoform=CRA_b"
FT                   /protein_id="EDL15208.1"
FT                   /translation="PRTCCPSPARSSAAMRLALLWALGLLGAGSPRPSPPLPNIGGTEE
FT                   EQQASPERTLSGSMESRVVQDSPPMSLADVLQTGLPEALRISLELDSESHVLELLQNRD
FT                   LIPGRPTLVWYQPDGTRMVSEGYSLENCCYRGRVQGHPSSWVSLCACSGIRGLIVLSPE
FT                   RGYTLELGPGDLQRPVISRIQDHLLLGHTCAPSWHASVPTRAGPDLLLEQHHAHRLKRD
FT                   VVTETKIVELVIVADNSEVRKYPDFQQLLNRTLEAALLLDTFFQPLNVRVALVGLEAWT
FT                   QHNLIEMSSNPAVLLDNFLRWRRTDLLPRLPHDSAQLVTVTSFSGPMVGMAIQNSICSP
FT                   DFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDSPGHSCPCPGPAPAKSCIMEASTDF
FT                   LPGLNFSNCSRQALEKALLEGMGSCLFERTHQVTCLAQEMEACRWWCPPGQLHHPLQHL
FT                   RSTSDLWRFGCLLLKL"
FT   CDS             complement(join(24691273..24691315,24691417..24691541,
FT                   24691763..24691834,24692225..24692299,24692870..24692939,
FT                   24693299..24693437,24693651..24693723,24694475..24694552,
FT                   24694750..24694945,24695035..24695339,24695480..24695572,
FT                   24695787..24695961,24696068..24696216,24696641..24696725,
FT                   24696855..24697024,24697131..24697199,24697305..24697370,
FT                   24698239..24698428,24698514..24698590,24698769..24698847,
FT                   24699231..24699307,24699880..24699989,24701171..>24701291))
FT                   /codon_start=1
FT                   /gene="Adam15"
FT                   /locus_tag="mCG_17546"
FT                   /product="a disintegrin and metallopeptidase domain 15
FT                   (metargidin), isoform CRA_a"
FT                   /note="gene_id=mCG17546.3 transcript_id=mCT190961.0
FT                   protein_id=mCP111885.0 isoform=CRA_a"
FT                   /protein_id="EDL15207.1"
FT                   /translation="PRTCCPSPARSSAAMRLALLWALGLLGAGSPRPSPPLPNIGGTEE
FT                   EQQASPERTLSGSMESRVVQDSPPMSLADVLQTGLPEALRISLELDSESHVLELLQNRD
FT                   LIPGRPTLVWYQPDGTRMVSEGYSLENCCYRGRVQGHPSSWVSLCACSGIRGLIVLSPE
FT                   RGYTLELGPGDLQRPVISRIQDHLLLGHTCAPSWHASVPTRAGPDLLLEQHHAHRLKRD
FT                   VVTETKIVELVIVADNSEVRKYPDFQQLLNRTLEAALLLDTFFQPLNVRVALVGLEAWT
FT                   QHNLIEMSSNPAVLLDNFLRWRRTDLLPRLPHDSAQLVTVTSFSGPMVGMAIQNSICSP
FT                   DFSGGVNMDHSTSILGVASSIAHELGHSLGLDHDSPGHSCPCPGPAPAKSCIMEASTDF
FT                   LPGLNFSNCSRQALEKALLEGMGSCLFERQPSLAPMSSLCGNMFVDPGEQCDCGFPDEC
FT                   TDPCCDHFTCQLRPGAQCASDGPCCQNCKLHPAGWLCRPPTDDCDLPEFCPGDSSQCPS
FT                   DIRLGDGEPCASGEAVCMHGRCASYARQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCG
FT                   RSPGGSYMPCAPRDVMCGQLQCQWGRSQPLLGSVQDRLSEVLEANGTQLNCSWVDLDLG
FT                   NDVAQPLLALPGTACGPGLVCIGHRCQPVDLLGAQECRRKCHGHGVCDSSGHCRCEEGW
FT                   APPDCMTQLKATSSLTTGLLLSLLLLLVLVLLGASYWHRARLHQRLCQLKGSSCQYRAP
FT                   QSCPPERPGPPQRAQQMTGTKQASVVSFPVPPSRPLPPNPVPKKLQAALADRSNPPTRP
FT                   LPADPVVRRPKSQGPTKPPPPRKPLPANPQGQHPPGDLPGPGDGSLPLVVPSRPAPPPP
FT                   AASSLYL"
FT   CDS             complement(join(24691273..24691315,24691417..24691541,
FT                   24692870..24692939,24693299..24693437,24693651..24693723,
FT                   24694475..24694552,24694750..24694945,24695035..24695339,
FT                   24695480..24695572,24695787..24695961,24696068..24696216,
FT                   24696641..24696725,24696855..24697024,24697131..24697199,
FT                   24697305..24697370,24698239..24698428,24698514..24698590,
FT                   24698769..24698847,24699231..24699307,24699880..24699989,
FT                   24701171..24701249))
FT                   /codon_start=1
FT                   /gene="Adam15"
FT                   /locus_tag="mCG_17546"
FT                   /product="a disintegrin and metallopeptidase domain 15
FT                   (metargidin), isoform CRA_c"
FT                   /note="gene_id=mCG17546.3 transcript_id=mCT14203.2
FT                   protein_id=mCP17283.2 isoform=CRA_c"
FT                   /protein_id="EDL15209.1"
FT                   /translation="MRLALLWALGLLGAGSPRPSPPLPNIGGTEEEQQASPERTLSGSM
FT                   ESRVVQDSPPMSLADVLQTGLPEALRISLELDSESHVLELLQNRDLIPGRPTLVWYQPD
FT                   GTRMVSEGYSLENCCYRGRVQGHPSSWVSLCACSGIRGLIVLSPERGYTLELGPGDLQR
FT                   PVISRIQDHLLLGHTCAPSWHASVPTRAGPDLLLEQHHAHRLKRDVVTETKIVELVIVA
FT                   DNSEVRKYPDFQQLLNRTLEAALLLDTFFQPLNVRVALVGLEAWTQHNLIEMSSNPAVL
FT                   LDNFLRWRRTDLLPRLPHDSAQLVTVTSFSGPMVGMAIQNSICSPDFSGGVNMDHSTSI
FT                   LGVASSIAHELGHSLGLDHDSPGHSCPCPGPAPAKSCIMEASTDFLPGLNFSNCSRQAL
FT                   EKALLEGMGSCLFERQPSLAPMSSLCGNMFVDPGEQCDCGFPDECTDPCCDHFTCQLRP
FT                   GAQCASDGPCCQNCKLHPAGWLCRPPTDDCDLPEFCPGDSSQCPSDIRLGDGEPCASGE
FT                   AVCMHGRCASYARQCQSLWGPGAQPAAPLCLQTANTRGNAFGSCGRSPGGSYMPCAPRD
FT                   VMCGQLQCQWGRSQPLLGSVQDRLSEVLEANGTQLNCSWVDLDLGNDVAQPLLALPGTA
FT                   CGPGLVCIGHRCQPVDLLGAQECRRKCHGHGVCDSSGHCRCEEGWAPPDCMTQLKATSS
FT                   LTTGLLLSLLLLLVLVLLGASYWHRARLHQRLCQLKGSSCQYRAPQSCPPERPGPPQRA
FT                   QQMTGTKSQGPTKPPPPRKPLPANPQGQHPPGDLPGPGDGSLPLVVPSRPAPPPPAASS
FT                   LYL"
FT   gene            complement(24701581..24716617)
FT                   /locus_tag="mCG_145738"
FT                   /note="gene_id=mCG145738.0"
FT   mRNA            complement(join(24701581..24701876,24703829..24703942,
FT                   24704065..24704207,24704628..24704744,24704877..24705003,
FT                   24705160..24705255,24705453..24705552,24707599..24707759,
FT                   24708180..24708301,24708835..24708978,24709081..24709288,
FT                   24709924..24710063,24710437..24710565,24715411..24715485,
FT                   24715566..24715691,24716372..24716616))
FT                   /locus_tag="mCG_145738"
FT                   /product="mCG145738, transcript variant mCT185590"
FT                   /note="gene_id=mCG145738.0 transcript_id=mCT185590.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(join(24701625..24701876,24703829..24703942,
FT                   24704065..24704207,24704628..24704744,24704877..24705003,
FT                   24705160..24705255,24705453..24705552,24707599..24707759,
FT                   24708180..24708301,24708835..24708978,24709081..24709288,
FT                   24709924..24710063,24710437..24710565,24715411..24715485,
FT                   24715566..24715691,24716372..24716516))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145738"
FT                   /product="mCG145738, isoform CRA_a"
FT                   /note="gene_id=mCG145738.0 transcript_id=mCT185590.0
FT                   protein_id=mCP106849.0 isoform=CRA_a"
FT                   /protein_id="EDL15204.1"
FT                   /translation="MAFLSSTLHSLGIFEKISRIKEVLKNRLLDLTKRRDQAREQQRKR
FT                   PHTIIQGLLLWSLPVSWIRFLWRQPGEFPVTAFLLGAGTGGLLAIGLFQLLVNPMNIYE
FT                   EQKVVALYCLASLGAIGWGTSPHIRCASLLLVPKMLGKEGRLFVMGYALAAIYSGPAAN
FT                   LRSNINEVIASLGCTVELQINNTRSAWRVSTAPLRAVFKGMVGSKDSLNKEIQNVSTSF
FT                   EEMDEQVKSDAGYSSEDWDKNRESTEMFGTSRVRPYLSTQMVYELRTRLRCIHVVNKAI
FT                   LSCYRWFDKKHKNCMRRIHLPLFNNMICVPMKFKFLCNIAKVIEIWCYKRIPVEGNFGQ
FT                   TYDSVNQSIHGLSGEFSANINLKEEKQSSMVGLNTTNWEHMGTEVRDYVRQQETYLQWA
FT                   MGLLHVLLSCTFLLVFHSAFSYMDHYNWDIRFDNIYISTYFCQIDARRKKLGKQSLLPL
FT                   RKAERKTVIFPFKATIQAWEMRYVIRELLETLPIVLLLLVLCAIDWALYSVFDTIRQHS
FT                   FVQYSFRSSHKLEIKVEGDSILAKLLRKTIGALNTSSSTDVETNNMPCLPQPISLNARD
FT                   YFKASLPTLLLVCLCLAQAFGYRLRRVIAAFYFPKREKKRALFFYNEFLKKRSAFTKLR
FT                   RAAIVRRANQQKAPPHYLVEALYRRCPLLHRFMRQRCVVCQAMETPDSYVCPTPDCKAL
FT                   YCRSCWDDMQRLCPVCTPREELSSSAHSDSNDDAVYGD"
FT   mRNA            complement(join(24702385..24704207,24704584..24704744,
FT                   24705160..24705255,24705453..24705552,24706783..24706908))
FT                   /locus_tag="mCG_145738"
FT                   /product="mCG145738, transcript variant mCT185592"
FT                   /note="gene_id=mCG145738.0 transcript_id=mCT185592.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(24703032..24703520)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145738"
FT                   /product="mCG145738, isoform CRA_b"
FT                   /note="gene_id=mCG145738.0 transcript_id=mCT185592.0
FT                   protein_id=mCP106850.0 isoform=CRA_b"
FT                   /protein_id="EDL15205.1"
FT                   /translation="MERRQVARGQWDFRREHAVFGRHRTGTAVESTHPEAEGARGPHCI
FT                   FFPLGRTECRQVCEAILQSWKSGMVVGCQRRLGLSPASSLPWYGSCVTLLNCQVLLSLL
FT                   CKMVLTNSFVQLLQCLGFTSLMLVHTQTHTHTHTHTTKPDDPSSILLVEGEDSPQAVP"
FT   mRNA            complement(join(24708870..24709288,24710437..24710565,
FT                   24715411..24715485,24715562..24715691,24716372..24716617))
FT                   /locus_tag="mCG_145738"
FT                   /product="mCG145738, transcript variant mCT185591"
FT                   /note="gene_id=mCG145738.0 transcript_id=mCT185591.0
FT                   created on 13-JUN-2003"
FT   CDS             complement(join(24709064..24709288,24710437..24710565,
FT                   24715411..24715449))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145738"
FT                   /product="mCG145738, isoform CRA_c"
FT                   /note="gene_id=mCG145738.0 transcript_id=mCT185591.0
FT                   protein_id=mCP106848.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9D215"
FT                   /db_xref="MGI:MGI:1925022"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D215"
FT                   /protein_id="EDL15206.1"
FT                   /translation="MRSRRWWRYTAWQAWGPSAGAPPLTSAVPVSCWYPRCWAKKADSL
FT                   SWDMLWLLSTVGSKDSLNKEIQNVSTSFEEMDEQVKSDAGYSSEDWDKNRESTEMFGTS
FT                   RVRPYLSTQMVYELRTRLRCIREEYS"
FT   gene            24718951..>24719610
FT                   /locus_tag="mCG_17570"
FT                   /note="gene_id=mCG17570.1"
FT   mRNA            join(24718951..24719296,24719453..>24719610)
FT                   /locus_tag="mCG_17570"
FT                   /product="mCG17570"
FT                   /note="gene_id=mCG17570.1 transcript_id=mCT14226.1 created
FT                   on 25-OCT-2002"
FT   CDS             join(24719088..24719296,24719453..>24719610)
FT                   /codon_start=1
FT                   /locus_tag="mCG_17570"
FT                   /product="mCG17570"
FT                   /note="gene_id=mCG17570.1 transcript_id=mCT14226.1
FT                   protein_id=mCP17240.1"
FT                   /protein_id="EDL15203.1"
FT                   /translation="MKLLGKLRREFEFNMTATHYFSVDLNSSRSLSQVALDLQEAVSMK
FT                   LYTAREALSLMGYTMPLLIGFLYIQALCYRYYYLNSDKFDNVYITRRFLDMEAVRSLAG
FT                   MPTVLPLSSHEAKHYIQP"
FT   gene            complement(24730634..24732602)
FT                   /gene="Zbtb7b"
FT                   /locus_tag="mCG_17540"
FT                   /note="gene_id=mCG17540.0"
FT   mRNA            complement(join(24730634..24731339,24731689..24732602))
FT                   /gene="Zbtb7b"
FT                   /locus_tag="mCG_17540"
FT                   /product="Vzinc finger and BTB domain containing 7B"
FT                   /note="gene_id=mCG17540.0 transcript_id=mCT14198.0 created
FT                   on 25-OCT-2002"
FT   CDS             complement(join(24730871..24731339,24731689..24732503))
FT                   /codon_start=1
FT                   /gene="Zbtb7b"
FT                   /locus_tag="mCG_17540"
FT                   /product="Vzinc finger and BTB domain containing 7B"
FT                   /note="gene_id=mCG17540.0 transcript_id=mCT14198.0
FT                   protein_id=mCP17257.1"
FT                   /protein_id="EDL15202.1"
FT                   /translation="MPAVLQAARLLEIPCVIAACMEILQGSGLEAPSPDEDDCERARQY
FT                   LEAFATATTTASTSGMPNGEDSPPQVPLLPPPPPPPRPVARRSRKPRKAFLQTKGARAN
FT                   HLVPEAPTVLTHPLTYEEEEMVGRLGNSGGSGLGDSYSPPTGAASPAEGPLNYEVFEGE
FT                   EEEEEMAYPPGYGLAQSNEPSLSPEELGSDEDPIDPDLMAYLSSLHQDALTPGLDGQDK
FT                   LVRKRRSQMPQECPVCHKIIHGAGKLPRHMRTHTGEKPFACEVCGVRFTRNDKLKIHMR
FT                   KHTGERPYSCPHCPARFLHSYDLKNHMHLHTGDRPYECHLCHKAFAKEDHLQRHLKGQN
FT                   CLEVRTRRRRKDDVAAPHYPPPSTTTSSPAGLDLSNGHLDTFHLSLARFWEQSATTGPP
FT                   VTTQGPPEEEEEEGTPTTPQAEGAMESS"
FT   gene            24743194..24749604
FT                   /locus_tag="mCG_124558"
FT                   /note="gene_id=mCG124558.1"
FT   mRNA            join(24743194..24743851,24749338..24749604)
FT                   /locus_tag="mCG_124558"
FT                   /product="mCG124558"
FT                   /note="gene_id=mCG124558.1 transcript_id=mCT125804.1
FT                   created on 25-OCT-2002"
FT   CDS             24743549..24743788
FT                   /codon_start=1
FT                   /locus_tag="mCG_124558"
FT                   /product="mCG124558"
FT                   /note="gene_id=mCG124558.1 transcript_id=mCT125804.1
FT                   protein_id=mCP65945.1"
FT                   /protein_id="EDL15201.1"
FT                   /translation="MANLGQRCALGFYHTATPTLLRAGAPAPAARPLVGRVLITHPRTG
FT                   VVRAKADFEKVAVGLRLERPECDCGAGGAEGSSC"
FT   gene            complement(24752383..24763252)
FT                   /gene="Flad1"
FT                   /locus_tag="mCG_142689"
FT                   /note="gene_id=mCG142689.0"
FT   mRNA            complement(join(24752383..24753691,24754549..24754680,
FT                   24754775..24754848,24756960..24757149,24757235..24757333,
FT                   24758789..24758936,24759802..24760546,24762538..24762760,
FT                   24763164..24763252))
FT                   /gene="Flad1"
FT                   /locus_tag="mCG_142689"
FT                   /product="RFad1, flavin adenine dinucleotide synthetase,
FT                   homolog (yeast), transcript variant mCT181634"
FT                   /note="gene_id=mCG142689.0 transcript_id=mCT181634.0
FT                   created on 01-APR-2003"
FT   mRNA            complement(join(24753249..24754680,24754773..24754848,
FT                   24756960..24757136,24757150..24757333,24758789..24758936,
FT                   24759802..24760546,24762538..24762760,24762941..24763033))
FT                   /gene="Flad1"
FT                   /locus_tag="mCG_142689"
FT                   /product="RFad1, flavin adenine dinucleotide synthetase,
FT                   homolog (yeast), transcript variant mCT181633"
FT                   /note="gene_id=mCG142689.0 transcript_id=mCT181633.0
FT                   created on 01-APR-2003"
FT   CDS             complement(join(24753610..24753691,24754549..24754680,
FT                   24754775..24754848,24756960..24757149,24757235..24757333,
FT                   24758789..24758936,24759802..24760546,24762538..24762624))
FT                   /codon_start=1
FT                   /gene="Flad1"
FT                   /locus_tag="mCG_142689"
FT                   /product="RFad1, flavin adenine dinucleotide synthetase,
FT                   homolog (yeast), isoform CRA_c"
FT                   /note="gene_id=mCG142689.0 transcript_id=mCT181634.0
FT                   protein_id=mCP104556.0 isoform=CRA_c"
FT                   /protein_id="EDL15200.1"
FT                   /translation="MASRASELPPGSGRSVTAGIIIVGDEILKGHTQDTNTYFLCRTLR
FT                   SLGVQVCRVSVVPDEVATIASEVNSFSRRFTHVLTAGGIGPTHDDVTFEAVAQAFGEEL
FT                   KPHPELQAAIKTLGGEGWEKLSMVPSSARLHYGTDPRTGHPFRFPLVSVRNVYLFPGIP
FT                   ELLRRVLEGLKGLFQNTAVQFHLKELYVAASEGSIAPILSEAQAHFGRRLSLGSYPDWS
FT                   SNYFQVKLILDSEEKEPLEECLAYLTARLPQGSLVPYQPDAVEKAGEAVYKLAESGSCL
FT                   GKKVAGALQTIETALAQYHLSQLCVGFNGGKDCTALLHLFHAAVQRKFPDVPKPLQILY
FT                   IRSISPFPELEQFLQDTIKRYNLQVLEAEGNMKQALGELQEKHPQLEAVLMGTRRTDPY
FT                   SCSLSHFSPTDPGWPSFMRINPLLDWTYRNIWEFLRQLFVPYCILYDRGYTSLGSRENT
FT                   TQNPALKCLSPGGHPVYRPAYLLENEDEERNSRIPKTPGASWPSPRMGHKELKKEPRTL
FT                   L"
FT   mRNA            complement(join(24754462..24754680,24754775..24754848,
FT                   24756960..24757149,24757235..24757333,24758789..24758936,
FT                   24759802..24760546,24762538..24762760,24763164..>24763196))
FT                   /gene="Flad1"
FT                   /locus_tag="mCG_142689"
FT                   /product="RFad1, flavin adenine dinucleotide synthetase,
FT                   homolog (yeast), transcript variant mCT190978"
FT                   /note="gene_id=mCG142689.0 transcript_id=mCT190978.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(24754545..24754680,24754775..24754848,
FT                   24756960..24757149,24757235..24757333,24758789..24758936,
FT                   24759802..24760546,24762538..24762760,24763164..>24763174))
FT                   /codon_start=1
FT                   /gene="Flad1"
FT                   /locus_tag="mCG_142689"
FT                   /product="RFad1, flavin adenine dinucleotide synthetase,
FT                   homolog (yeast), isoform CRA_b"
FT                   /note="gene_id=mCG142689.0 transcript_id=mCT190978.0
FT                   protein_id=mCP111942.0 isoform=CRA_b"
FT                   /protein_id="EDL15199.1"
FT                   /translation="SEAWFPQPRNSGYGLLHPVDLAASQYIRPQFGVLSGYWKALQKST
FT                   EGRTMASRASELPPGSGRSVTAGIIIVGDEILKGHTQDTNTYFLCRTLRSLGVQVCRVS
FT                   VVPDEVATIASEVNSFSRRFTHVLTAGGIGPTHDDVTFEAVAQAFGEELKPHPELQAAI
FT                   KTLGGEGWEKLSMVPSSARLHYGTDPRTGHPFRFPLVSVRNVYLFPGIPELLRRVLEGL
FT                   KGLFQNTAVQFHLKELYVAASEGSIAPILSEAQAHFGRRLSLGSYPDWSSNYFQVKLIL
FT                   DSEEKEPLEECLAYLTARLPQGSLVPYQPDAVEKAGEAVYKLAESGSCLGKKVAGALQT
FT                   IETALAQYHLSQLCVGFNGGKDCTALLHLFHAAVQRKFPDVPKPLQILYIRSISPFPEL
FT                   EQFLQDTIKRYNLQVLEAEGNMKQALGELQEKHPQLEAVLMGTRRTDPYSCSLSHFSPT
FT                   DPGWPSFMRINPLLDWTYRNIWEFLRQLFVPYCILYDRGYTSLGSRENTTQNPALKCLS
FT                   PGGHPVYRPAYLLENEDEERNSRM"
FT   CDS             complement(join(24754631..24754680,24754773..24754848,
FT                   24756960..24757136,24757150..24757333,24758789..24758936,
FT                   24759802..24760546,24762538..24762624))
FT                   /codon_start=1
FT                   /gene="Flad1"
FT                   /locus_tag="mCG_142689"
FT                   /product="RFad1, flavin adenine dinucleotide synthetase,
FT                   homolog (yeast), isoform CRA_a"
FT                   /note="gene_id=mCG142689.0 transcript_id=mCT181633.0
FT                   protein_id=mCP104555.0 isoform=CRA_a"
FT                   /protein_id="EDL15198.1"
FT                   /translation="MASRASELPPGSGRSVTAGIIIVGDEILKGHTQDTNTYFLCRTLR
FT                   SLGVQVCRVSVVPDEVATIASEVNSFSRRFTHVLTAGGIGPTHDDVTFEAVAQAFGEEL
FT                   KPHPELQAAIKTLGGEGWEKLSMVPSSARLHYGTDPRTGHPFRFPLVSVRNVYLFPGIP
FT                   ELLRRVLEGLKGLFQNTAVQFHLKELYVAASEGSIAPILSEAQAHFGRRLSLGSYPDWS
FT                   SNYFQVKLILDSEEKEPLEECLAYLTARLPQGSLVPYQPDAVEKAGEAVYKLAESGSCL
FT                   GKKVAGALQTIETALAQYHLSQLCVGFNGGKDCTALLHLFHAAVQRKFPDVPKPLQILY
FT                   IRSISPFPELEQFLQDTIKRYWDLEDRAPRRTLVESTLVLISVLFLPKVLEAEGNMKQA
FT                   LGELQEKHPQLEAVLMGTRRTDPYSCSLSHFSPTDPGWPSFMRINPLLDWTYRNIWEFL
FT                   RQLFVPYCILYDRGCTHPWGVGKTQRRIRP"
FT   gene            complement(24766852..24769763)
FT                   /locus_tag="mCG_17538"
FT                   /note="gene_id=mCG17538.1"
FT   mRNA            complement(join(24766852..24767343,24767654..24767781,
FT                   24769535..24769763))
FT                   /locus_tag="mCG_17538"
FT                   /product="mCG17538"
FT                   /note="gene_id=mCG17538.1 transcript_id=mCT14194.1 created
FT                   on 01-APR-2003"
FT   CDS             complement(join(24767291..24767343,24767654..24767781,
FT                   24769535..24769593))
FT                   /codon_start=1
FT                   /locus_tag="mCG_17538"
FT                   /product="mCG17538"
FT                   /note="gene_id=mCG17538.1 transcript_id=mCT14194.1
FT                   protein_id=mCP17245.1"
FT                   /protein_id="EDL15197.1"
FT                   /translation="MSHKQIYYSDKYDDEEFEYRHVMLPKDIAKLVPKTHLMSESEWRN
FT                   LGVQQSQGWVHYMIHEPEPHILLFRRPLPKKPKK"
FT   gene            24769868..24781394
FT                   /gene="Shc1"
FT                   /locus_tag="mCG_17536"
FT                   /note="gene_id=mCG17536.2"
FT   mRNA            join(24769868..24770089,24773229..24773725,
FT                   24774306..24774376,24774888..24774951,24775077..24775196,
FT                   24775570..24775623,24775935..24775986,24776146..24776272,
FT                   24777895..24778081,24778168..24778237,24778319..24778450,
FT                   24778588..24778826,24779697..24781394)
FT                   /gene="Shc1"
FT                   /locus_tag="mCG_17536"
FT                   /product="src homology 2 domain-containing transforming
FT                   protein C1, transcript variant mCT14191"
FT                   /note="gene_id=mCG17536.2 transcript_id=mCT14191.2 created
FT                   on 01-APR-2003"
FT   mRNA            join(<24769992..24770089,24773558..24773725,
FT                   24774306..24774376,24774888..24774951,24775077..24775196,
FT                   24775570..24775623,24775935..24775986,24776146..24776272,
FT                   24777895..24778081,24778168..24778237,24778319..24778450,
FT                   24778588..24778826,24779697..24781394)
FT                   /gene="Shc1"
FT                   /locus_tag="mCG_17536"
FT                   /product="src homology 2 domain-containing transforming
FT                   protein C1, transcript variant mCT190921"
FT                   /note="gene_id=mCG17536.2 transcript_id=mCT190921.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<24770039..24770089,24773558..24773725,
FT                   24774306..24774376,24774888..24774951,24775077..24775196,
FT                   24775570..24775623,24775935..24775986,24776146..24776272,
FT                   24777895..24778081,24778168..24778237,24778319..24778450,
FT                   24778588..24778826,24779697..24779825)
FT                   /codon_start=1
FT                   /gene="Shc1"
FT                   /locus_tag="mCG_17536"
FT                   /product="src homology 2 domain-containing transforming
FT                   protein C1, isoform CRA_b"
FT                   /note="gene_id=mCG17536.2 transcript_id=mCT190921.0
FT                   protein_id=mCP111883.0 isoform=CRA_b"
FT                   /protein_id="EDL15196.1"
FT                   /translation="SGTRSARGAVRRLHETLDMNKLSGGGGRRTRVEGGQLGGEEWTRH
FT                   GSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALDFNTRTQVTREAISLVC
FT                   EAVPGAKGATRRRKPCSRPLSSILGRSNLKFAGMPITLTVSTSSLNLMAADCKQIIANH
FT                   HMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDVISTIGQAFELRFKQ
FT                   YLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAA
FT                   RPTLPSAQMSSHLGATLPIGQHAAGDHEVRKQMLPPPPCPGRELFDDPSYVNIQNLDKA
FT                   RQAGGGAGPPNPSLNGSAPRDLFDMKPFEDALRVPPPPQSMSMAEQLQGEPWFHGKLSR
FT                   REAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSH
FT                   LISYHMDNHLPIISAGSELCLQQPVDRKV"
FT   CDS             join(24773231..24773725,24774306..24774376,
FT                   24774888..24774951,24775077..24775196,24775570..24775623,
FT                   24775935..24775986,24776146..24776272,24777895..24778081,
FT                   24778168..24778237,24778319..24778450,24778588..24778826,
FT                   24779697..24779825)
FT                   /codon_start=1
FT                   /gene="Shc1"
FT                   /locus_tag="mCG_17536"
FT                   /product="src homology 2 domain-containing transforming
FT                   protein C1, isoform CRA_a"
FT                   /note="gene_id=mCG17536.2 transcript_id=mCT14191.2
FT                   protein_id=mCP17230.2 isoform=CRA_a"
FT                   /protein_id="EDL15195.1"
FT                   /translation="MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEELPSPSASSLGPI
FT                   LPPLPGDDSPTTLCSFFPRMSNLKLANPAGGRLGPKGEPGKAAEDGEGSAGAALRDSGL
FT                   LPLLQDMNKLSGGGGRRTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYL
FT                   VRYMGCVEVLQSMRALDFNTRTQVTREAISLVCEAVPGAKGATRRRKPCSRPLSSILGR
FT                   SNLKFAGMPITLTVSTSSLNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDP
FT                   VNQRACHILECPEGLAQDVISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEE
FT                   EEEPPDHQYYNDFPGKEPPLGGVVDMRLREGAARPTLPSAQMSSHLGATLPIGQHAAGD
FT                   HEVRKQMLPPPPCPGRELFDDPSYVNIQNLDKARQAGGGAGPPNPSLNGSAPRDLFDMK
FT                   PFEDALRVPPPPQSMSMAEQLQGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYV
FT                   LTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGSELCLQQPVD
FT                   RKV"
FT   gene            <24782026..24786580
FT                   /locus_tag="mCG_145235"
FT                   /note="gene_id=mCG145235.0"
FT   mRNA            join(<24782026..24782181,24782579..24782628,
FT                   24783902..24786580)
FT                   /locus_tag="mCG_145235"
FT                   /product="mCG145235"
FT                   /note="gene_id=mCG145235.0 transcript_id=mCT184659.0
FT                   created on 05-JUN-2003"
FT   CDS             join(<24782028..24782181,24782579..24782628,
FT                   24783902..24784966)
FT                   /codon_start=1
FT                   /locus_tag="mCG_145235"
FT                   /product="mCG145235"
FT                   /note="gene_id=mCG145235.0 transcript_id=mCT184659.0
FT                   protein_id=mCP105802.0"
FT                   /protein_id="EDL15194.1"
FT                   /translation="GPRTPPSPADADSGPQSMAASAPPPPDKLEGGSGPAPPPAPPSTG
FT                   RKQGKAGLQMKSPEKKRRKSNTQGPAYSHLTEFAPPPTPMVDHLVASNPFEDDFGAPKV
FT                   GGAGPPFLGSPVPFGGFRVQGGMAGQVPPGYGTGGGGGPQPLRRQPPPFPPNPMGPAFN
FT                   MPPQGPGYPPPGNMNFPSQPFNQSLGQNFSPPGGQVMPGPVGGFGPMISPTMGQPPRGE
FT                   LGPPPLPQRFTQPGAPFGPSLQRPGQGLPSLPPNTSPFPGPDPGFPGPGGEDGGKPLNP
FT                   PAPTAFPQEPHSGSPAAAVNGNQPSFPPSSSGRGGGTPDANSLAPPGKAGGGSGPQPPP
FT                   GLVYPCGACRSEVNDDQDAILCEASCQKWFHRECTGMTESAYGLLTTEASAVWACDLCL
FT                   KTKEIQSVYIREGMGQLVAANDG"
FT   gene            <24788184..24802594
FT                   /gene="Pbxip1"
FT                   /locus_tag="mCG_17562"
FT                   /note="gene_id=mCG17562.1"
FT   mRNA            join(<24788184..24788410,24790969..24791153,
FT                   24794574..24794686,24795295..24795405,24797102..24797329,
FT                   24797442..24797465,24797741..24797823,24797930..24798061,
FT                   24798696..24799915,24800323..24802594)
FT                   /gene="Pbxip1"
FT                   /locus_tag="mCG_17562"
FT                   /product="pre-B-cell leukemia transcription factor
FT                   interacting protein 1"
FT                   /note="gene_id=mCG17562.1 transcript_id=mCT14218.2 created
FT                   on 24-SEP-2002"
FT   CDS             join(<24794680..24794686,24795295..24795405,
FT                   24797102..24797329,24797442..24797465,24797741..24797823,
FT                   24797930..24798061,24798696..24799915,24800323..24800416)
FT                   /codon_start=1
FT                   /gene="Pbxip1"
FT                   /locus_tag="mCG_17562"
FT                   /product="pre-B-cell leukemia transcription factor
FT                   interacting protein 1"
FT                   /note="gene_id=mCG17562.1 transcript_id=mCT14218.2
FT                   protein_id=mCP17217.2"
FT                   /protein_id="EDL15193.1"
FT                   /translation="LGLVQEDSQETPVATSLGPDTQDLESEIHPQNLPSSPRAVWKEHR
FT                   CSSSDDDTDVDVEGLRRRRGREPSSSQPVVPVDVEDQAKGEGIGGELGISLNMCFLGAL
FT                   VLLGLGILLFSGTLLEPETGPMEEAELQVFPETGPETELVETLGNRQDEIEHLQASSVP
FT                   PDSVPSLQSMGFLLDKLAKENQDIRLLQAQLQAQKEELQSLLHQPKGLEEENARLREAL
FT                   QQGKTSHQALESELQQLRARLQGLEANCVRGVDGVCLNWGGDPQDGKATKEQGHKGQEP
FT                   DPSLLEQHKQLEAEAKALRQELQRQWQLLGSVHWDLQRGLRDAGRGAPAHPGLAELGHM
FT                   LAQTLQDLENQGINTGRSPNDSEAWHQKKPHTQSPREWGGKEKWRGGQRDQKAEHWKPR
FT                   KEESGQERQRSWRDEGREHTGRWREDRLRADESGSRKDSKRQDPKVHPRKDGNSHSVER
FT                   QKHSWGKDNSPDALSSWEELLRRKYRPPQGCSGVADCARQEGLALFGVELAPVRQQELA
FT                   SVLREYLSRLPWAGQLTKQLPLSPAYFGEDGIFRHDRLRFRDFVDALEDSLEEVALKQT
FT                   GDDDEVDDFEDFVFGHFFGDKALKKRSRKKEKHSWNPRVVGPREEHSRHPHHYHQG"
FT   gene            24810793..24820457
FT                   /gene="Pmvk"
FT                   /locus_tag="mCG_17550"
FT                   /note="gene_id=mCG17550.1"
FT   mRNA            join(24810793..24811114,24813532..24813595,
FT                   24815905..24816099,24818995..24819124,24819962..24820457)
FT                   /gene="Pmvk"
FT                   /locus_tag="mCG_17550"
FT                   /product="phosphomevalonate kinase, transcript variant
FT                   mCT14206"
FT                   /note="gene_id=mCG17550.1 transcript_id=mCT14206.1 created
FT                   on 25-MAR-2003"
FT   mRNA            join(24810965..24811114,24813532..24813595,
FT                   24815947..24816099,24818995..24819124,24819962..24820454)
FT                   /gene="Pmvk"
FT                   /locus_tag="mCG_17550"
FT                   /product="phosphomevalonate kinase, transcript variant
FT                   mCT181514"
FT                   /note="gene_id=mCG17550.1 transcript_id=mCT181514.0 created
FT                   on 25-MAR-2003"
FT   CDS             join(24811020..24811114,24813532..24813595,
FT                   24815905..24816099,24818995..24819124,24819962..24820098)
FT                   /codon_start=1
FT                   /gene="Pmvk"
FT                   /locus_tag="mCG_17550"
FT                   /product="phosphomevalonate kinase, isoform CRA_a"
FT                   /note="gene_id=mCG17550.1 transcript_id=mCT14206.1
FT                   protein_id=mCP17218.1 isoform=CRA_a"
FT                   /protein_id="EDL15190.1"
FT                   /translation="MAPLGASPRLVLLFSGKRKSGKDFVTERLKSRLGGNICALLRLSG
FT                   PLKEEYAREGWWDCVIDGLALQEHGLDFQRLLDASTYKETYRRDMICWGEQKRQADPGF
FT                   FCRKIVEGVSQPIWLVSDTRRTSDIQWFQEAYGAVIQTVRVVASEQSRQQRGWVFTPGV
FT                   DDAESECGLDNFGNFDWVIENHGDEQCLEDQLEHLLGFIQAKL"
FT   CDS             join(24811020..24811114,24813532..24813595,
FT                   24815947..24816099,24818995..24819124,24819962..24820098)
FT                   /codon_start=1
FT                   /gene="Pmvk"
FT                   /locus_tag="mCG_17550"
FT                   /product="phosphomevalonate kinase, isoform CRA_c"
FT                   /note="gene_id=mCG17550.1 transcript_id=mCT181514.0
FT                   protein_id=mCP104436.0 isoform=CRA_c"
FT                   /protein_id="EDL15192.1"
FT                   /translation="MAPLGASPRLVLLFSGKRKSGKDFVTERLKSRLGGNICALLRLSG
FT                   PLKEEYAREHGLDFQRLLDASTYKETYRRDMICWGEQKRQADPGFFCRKIVEGVSQPIW
FT                   LVSDTRRTSDIQWFQEAYGAVIQTVRVVASEQSRQQRGWVFTPGVDDAESECGLDNFGN
FT                   FDWVIENHGDEQCLEDQLEHLLGFIQAKL"
FT   mRNA            join(24811221..24811536,24813532..24813595,
FT                   24815947..24816099,24818995..24819124,24819962..24820456)
FT                   /gene="Pmvk"
FT                   /locus_tag="mCG_17550"
FT                   /product="phosphomevalonate kinase, transcript variant
FT                   mCT181513"
FT                   /note="gene_id=mCG17550.1 transcript_id=mCT181513.0 created
FT                   on 25-MAR-2003"
FT   CDS             join(24811505..24811536,24813532..24813595,
FT                   24815947..24816099,24818995..24819124,24819962..24820098)
FT                   /codon_start=1
FT                   /gene="Pmvk"
FT                   /locus_tag="mCG_17550"
FT                   /product="phosphomevalonate kinase, isoform CRA_b"
FT                   /note="gene_id=mCG17550.1 transcript_id=mCT181513.0
FT                   protein_id=mCP104435.0 isoform=CRA_b"
FT                   /protein_id="EDL15191.1"
FT                   /translation="MAGIYGIFYARLGGNICALLRLSGPLKEEYAREHGLDFQRLLDAS
FT                   TYKETYRRDMICWGEQKRQADPGFFCRKIVEGVSQPIWLVSDTRRTSDIQWFQEAYGAV
FT                   IQTVRVVASEQSRQQRGWVFTPGVDDAESECGLDNFGNFDWVIENHGDEQCLEDQLEHL
FT                   LGFIQAKL"
FT   gene            24871646..25019176
FT                   /gene="Kcnn3"
FT                   /locus_tag="mCG_17564"
FT                   /note="gene_id=mCG17564.2"
FT   mRNA            join(24871646..24872629,24916138..24916233,
FT                   24960561..24960979,24996881..24997022,25003457..25003567,
FT                   25012563..25012649,25018766..25019176)
FT                   /gene="Kcnn3"
FT                   /locus_tag="mCG_17564"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 3"
FT                   /note="gene_id=mCG17564.2 transcript_id=mCT14220.2 created
FT                   on 06-AUG-2002"
FT   CDS             join(24871694..24872629,24916138..24916233,
FT                   24960561..24960979,24996881..24997022,25003457..25003567,
FT                   25012563..25012649,25018766..25019062)
FT                   /codon_start=1
FT                   /gene="Kcnn3"
FT                   /locus_tag="mCG_17564"
FT                   /product="potassium intermediate/small conductance
FT                   calcium-activated channel, subfamily N, member 3"
FT                   /note="gene_id=mCG17564.2 transcript_id=mCT14220.2
FT                   protein_id=mCP17227.2"
FT                   /protein_id="EDL15189.1"
FT                   /translation="MDTSGHFHDSGVGDLDEDPKCPCPSSGDEQQQQQQPPPPPAPPAV
FT                   PQQPPGPLLQPQPPQPQQQQSQQQQQQQSQQQQQQAPLHPLPQLAQLQSQLVHPGLLHS
FT                   SPTAFRAPTSANSTAILHPSSRQGSQLNLNDHLLGHSPSSTATSGPGGGSRHRQASPLV
FT                   HRRDSNPFTEIAMSSCKYSGGVMKPLSRLSASRRNLIEAEPEGQPLQLFSPSNPPEIII
FT                   SSREDNHAHQTLLHHPNATHNHQHAGTTAGSTTFPKANKRKNQNIGYKLGHRRALFEKR
FT                   KRLSDYALIFGMFGIVVMVIETELSWGLYSKDSMFSLALKCLISLSTVILLGLIIAYHT
FT                   REVQLFVIDNGADDWRIAMTYERILYISLEMLVCAIHPIPGEYKFFWTARLAFSYTPSR
FT                   AEADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFVMKTLMTI
FT                   CPGTVLLVFSISLWIIAAWTVRVCERYHDQQDVTSNFLGAMWLISITFLSIGYGDMVPH
FT                   TYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRIKNAAANV
FT                   LRETWLIYKHTKLLKKIDHAKMQNVMYDLITELNDRSEDLEKQIGSLESKLEHLTASFN
FT                   SLPLLIADTLRQQQQQLLTAFVEARGISVAVGTSHAPPSDSPIGISSTSFPTPYTSSSS
FT                   C"
FT   gene            25084166..25106805
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /note="gene_id=mCG17535.1"
FT   mRNA            join(25084166..25084199,25088203..25089634,
FT                   25091351..25091534,25092531..25092679,25093194..25093332,
FT                   25093455..25093639,25098737..25098884,25099181..25099352,
FT                   25099926..25100019,25100533..25100655,25100899..25101032,
FT                   25102998..25103180,25103597..25103709,25103989..25104116,
FT                   25104290..25106805)
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /product="adenosine deaminase, RNA-specific, transcript
FT                   variant mCT14192"
FT                   /note="gene_id=mCG17535.1 transcript_id=mCT14192.1 created
FT                   on 01-APR-2003"
FT   mRNA            join(<25084172..25084199,25088203..25089634,
FT                   25091351..25091534,25092531..25092679,25093194..25093332,
FT                   25093455..25093639,25098737..25098962,25099181..25099352,
FT                   25099926..25100019,25100533..25100655,25100899..25101032,
FT                   25102998..25103180,25103597..25103709,25103989..25104116,
FT                   25104290..>25104536)
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /product="adenosine deaminase, RNA-specific, transcript
FT                   variant mCT190914"
FT                   /note="gene_id=mCG17535.1 transcript_id=mCT190914.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<25084172..25084199,25091351..25091534,
FT                   25092531..25092679,25093194..25093332,25093455..25093639,
FT                   25098737..25098962,25099181..25099352,25099926..25100019,
FT                   25100533..25100655,25100899..25101032,25102998..25103180,
FT                   25103597..25103709,25103989..25104116,25104290..>25104536)
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /product="adenosine deaminase, RNA-specific, transcript
FT                   variant mCT190915"
FT                   /note="gene_id=mCG17535.1 transcript_id=mCT190915.0 created
FT                   on 08-MAR-2004"
FT   mRNA            join(<25084172..25084199,25091351..25091534,
FT                   25092531..25092679,25093194..25093332,25093455..25093639,
FT                   25098737..25098884,25099181..25099352,25099926..25100019,
FT                   25100533..25100655,25100899..25101032,25102998..25103180,
FT                   25103597..25103709,25103989..25104116,25104290..>25104536)
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /product="adenosine deaminase, RNA-specific, transcript
FT                   variant mCT190916"
FT                   /note="gene_id=mCG17535.1 transcript_id=mCT190916.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(25084172..25084199,25088203..25089634,
FT                   25091351..25091534,25092531..25092679,25093194..25093332,
FT                   25093455..25093639,25098737..25098962,25099181..25099352,
FT                   25099926..25100019,25100533..25100655,25100899..25101032,
FT                   25102998..25103180,25103597..25103709,25103989..25104116,
FT                   25104290..25104536)
FT                   /codon_start=1
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /product="adenosine deaminase, RNA-specific, isoform CRA_b"
FT                   /note="gene_id=mCG17535.1 transcript_id=mCT190914.0
FT                   protein_id=mCP111880.0 isoform=CRA_b"
FT                   /protein_id="EDL15186.1"
FT                   /translation="MSQGFRGPTGVFPHQTQSYLDPSHEHSKWRYPQPQGPESYPRSFQ
FT                   LQQIEFLKGRLPEAPLIGIQTQSLPPFLPGHWPRFPGPPAQDRQLEIWEFPRSVTLRNQ
FT                   GFHIGPPLPPPHSRGTPWRGADGLCSHFRELSISQSPEQKVLNRLEELGEGKATTAHVL
FT                   ARELRIPKRDINRILYSLEKKGKLHRGRGKPPLWSLVPLSQAWTQPPGVVNPDSCIQEF
FT                   PRGEPGLDSEDGDPASDLEGPSEPLDMAEIKEKICDYLFNVSNSSALNLAKNIGLTKAR
FT                   DVTSVLIDLERQGDVYRQGATPPIWYLTDKKRERLQMKRSTHSAPAPTPTAVPEATRSP
FT                   SFPACHPPPAGASSSVAASKRVENGQEPAIKHESRHEARPGPMRLRPHAYHNGPSRAGY
FT                   VASENGQWATDDIPDNLNSIHTAPGEFRAIMEMPSFYSPTLPRCSPYKKLTECQLKNPV
FT                   SGLLEYAQFTSQTCDFNLIEQSGPSHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAVK
FT                   AMAILLREAKAKDSGQPEDLSHCPMEEDSEKPAEAQAPSSSATSLFSGKSPVTTLLECM
FT                   HKLGNSCEFRLLSKEGPAHDPKFQYCVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQE
FT                   EAASSADDQSGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFK
FT                   LIDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGF
FT                   AEVTPVTGASLRRTMLLLSRSPDAHPKTLPLSGSTFHDQIAMLSHRCFNALTNSFQPSL
FT                   LGRKILAAIIMKRDPEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRF
FT                   LYSELMKYNHHTAKNSIFELARGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAV
FT                   ESTESRHYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKI
FT                   LRWNVLGLQGALLTHFLQPVYLKSVTLGYLFSQGHLTRAICCRVTRDGKAFEDGLRYPF
FT                   IVNHPKVGRVSVYDSKRQSGKTKETSVNWCMADGYDLEILDGTRGTVDGPGKELSRVSK
FT                   KNIFLQFKKLCSFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQE
FT                   EKNFYLCPVPND"
FT   CDS             join(25084172..25084199,25088203..25089634,
FT                   25091351..25091534,25092531..25092679,25093194..25093332,
FT                   25093455..25093639,25098737..25098884,25099181..25099352,
FT                   25099926..25100019,25100533..25100655,25100899..25101032,
FT                   25102998..25103180,25103597..25103709,25103989..25104116,
FT                   25104290..25104536)
FT                   /codon_start=1
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /product="adenosine deaminase, RNA-specific, isoform CRA_a"
FT                   /note="gene_id=mCG17535.1 transcript_id=mCT14192.1
FT                   protein_id=mCP17210.1 isoform=CRA_a"
FT                   /protein_id="EDL15185.1"
FT                   /translation="MSQGFRGPTGVFPHQTQSYLDPSHEHSKWRYPQPQGPESYPRSFQ
FT                   LQQIEFLKGRLPEAPLIGIQTQSLPPFLPGHWPRFPGPPAQDRQLEIWEFPRSVTLRNQ
FT                   GFHIGPPLPPPHSRGTPWRGADGLCSHFRELSISQSPEQKVLNRLEELGEGKATTAHVL
FT                   ARELRIPKRDINRILYSLEKKGKLHRGRGKPPLWSLVPLSQAWTQPPGVVNPDSCIQEF
FT                   PRGEPGLDSEDGDPASDLEGPSEPLDMAEIKEKICDYLFNVSNSSALNLAKNIGLTKAR
FT                   DVTSVLIDLERQGDVYRQGATPPIWYLTDKKRERLQMKRSTHSAPAPTPTAVPEATRSP
FT                   SFPACHPPPAGASSSVAASKRVENGQEPAIKHESRHEARPGPMRLRPHAYHNGPSRAGY
FT                   VASENGQWATDDIPDNLNSIHTAPGEFRAIMEMPSFYSPTLPRCSPYKKLTECQLKNPV
FT                   SGLLEYAQFTSQTCDFNLIEQSGPSHEPRFKFQVVINGREFPPAEAGSKKVAKQDAAVK
FT                   AMAILLREAKAKDSGQPEDLSHCPMEEDSEKPAEAQAPSSSATSLFSGKSPVTTLLECM
FT                   HKLGNSCEFRLLSKEGPAHDPKFQYCVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQE
FT                   EAASSADDQSGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFK
FT                   LIDQSGPPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGF
FT                   AELPLSGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKRDPEDMGVVVSLGT
FT                   GNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNHHTAKNSIFELARGGEK
FT                   LQIKKTVSFHLYISTAPCGDGALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENG
FT                   EGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVT
FT                   LGYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPKVGRVSVYDSKRQSGKTKETS
FT                   VNWCMADGYDLEILDGTRGTVDGPGKELSRVSKKNIFLQFKKLCSFRARRDLLQLSYGE
FT                   AKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND"
FT   CDS             join(<25084174..25084199,25091351..25091534,
FT                   25092531..25092679,25093194..25093332,25093455..25093639,
FT                   25098737..25098962,25099181..25099352,25099926..25100019,
FT                   25100533..25100655,25100899..25101032,25102998..25103180,
FT                   25103597..25103709,25103989..25104116,25104290..25104536)
FT                   /codon_start=1
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /product="adenosine deaminase, RNA-specific, isoform CRA_c"
FT                   /note="gene_id=mCG17535.1 transcript_id=mCT190915.0
FT                   protein_id=mCP111881.0 isoform=CRA_c"
FT                   /protein_id="EDL15187.1"
FT                   /translation="VSRVQGTHRFKFQVVINGREFPPAEAGSKKVAKQDAAVKAMAILL
FT                   REAKAKDSGQPEDLSHCPMEEDSEKPAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNS
FT                   CEFRLLSKEGPAHDPKFQYCVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQEEAASSA
FT                   DDQSGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSG
FT                   PPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAEVTPV
FT                   TGASLRRTMLLLSRSPDAHPKTLPLSGSTFHDQIAMLSHRCFNALTNSFQPSLLGRKIL
FT                   AAIIMKRDPEDMGVVVSLGTGNRCVKGDSLSLKGETVNDCHAEIISRRGFIRFLYSELM
FT                   KYNHHTAKNSIFELARGGEKLQIKKTVSFHLYISTAPCGDGALFDKSCSDRAVESTESR
FT                   HYPVFENPKQGKLRTKVENGEGTIPVESSDIVPTWDGIRLGERLRTMSCSDKILRWNVL
FT                   GLQGALLTHFLQPVYLKSVTLGYLFSQGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPK
FT                   VGRVSVYDSKRQSGKTKETSVNWCMADGYDLEILDGTRGTVDGPGKELSRVSKKNIFLQ
FT                   FKKLCSFRARRDLLQLSYGEAKKAARDYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYL
FT                   CPVPND"
FT   CDS             join(<25084174..25084199,25091351..25091534,
FT                   25092531..25092679,25093194..25093332,25093455..25093639,
FT                   25098737..25098884,25099181..25099352,25099926..25100019,
FT                   25100533..25100655,25100899..25101032,25102998..25103180,
FT                   25103597..25103709,25103989..25104116,25104290..25104536)
FT                   /codon_start=1
FT                   /gene="Adar"
FT                   /locus_tag="mCG_17535"
FT                   /product="adenosine deaminase, RNA-specific, isoform CRA_d"
FT                   /note="gene_id=mCG17535.1 transcript_id=mCT190916.0
FT                   protein_id=mCP111882.0 isoform=CRA_d"
FT                   /protein_id="EDL15188.1"
FT                   /translation="VSRVQGTHRFKFQVVINGREFPPAEAGSKKVAKQDAAVKAMAILL
FT                   REAKAKDSGQPEDLSHCPMEEDSEKPAEAQAPSSSATSLFSGKSPVTTLLECMHKLGNS
FT                   CEFRLLSKEGPAHDPKFQYCVAVGAQTFPPVSAPSKKVAKQMAAEEAMKALQEEAASSA
FT                   DDQSGGANTDSLDESMAPNKIRRIGELVRYLNTNPVGGLLEYARSHGFAAEFKLIDQSG
FT                   PPHEPKFVYQAKVGGRWFPAVCAHSKKQGKQDAADAALRVLIGESEKAEQLGFAELPLS
FT                   GSTFHDQIAMLSHRCFNALTNSFQPSLLGRKILAAIIMKRDPEDMGVVVSLGTGNRCVK
FT                   GDSLSLKGETVNDCHAEIISRRGFIRFLYSELMKYNHHTAKNSIFELARGGEKLQIKKT
FT                   VSFHLYISTAPCGDGALFDKSCSDRAVESTESRHYPVFENPKQGKLRTKVENGEGTIPV
FT                   ESSDIVPTWDGIRLGERLRTMSCSDKILRWNVLGLQGALLTHFLQPVYLKSVTLGYLFS
FT                   QGHLTRAICCRVTRDGKAFEDGLRYPFIVNHPKVGRVSVYDSKRQSGKTKETSVNWCMA
FT                   DGYDLEILDGTRGTVDGPGKELSRVSKKNIFLQFKKLCSFRARRDLLQLSYGEAKKAAR
FT                   DYDLAKNYFKKSLRDMGYGNWISKPQEEKNFYLCPVPND"
FT   gene            complement(25110431..25117933)
FT                   /gene="Chrnb2"
FT                   /locus_tag="mCG_22243"
FT                   /note="gene_id=mCG22243.1"
FT   mRNA            complement(join(25110431..25110631,25114033..25115002,
FT                   25115760..25115869,25116371..25116415,25116581..25116726,
FT                   25117704..25117933))
FT                   /gene="Chrnb2"
FT                   /locus_tag="mCG_22243"
FT                   /product="cholinergic receptor, nicotinic, beta polypeptide
FT                   2 (neuronal)"
FT                   /note="gene_id=mCG22243.1 transcript_id=mCT21199.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(25110461..25110631,25114033..25115002,
FT                   25115760..25115869,25116371..25116415,25116581..25116726,
FT                   25117704..25117767))
FT                   /codon_start=1
FT                   /gene="Chrnb2"
FT                   /locus_tag="mCG_22243"
FT                   /product="cholinergic receptor, nicotinic, beta polypeptide
FT                   2 (neuronal)"
FT                   /note="gene_id=mCG22243.1 transcript_id=mCT21199.1
FT                   protein_id=mCP17254.2"
FT                   /db_xref="GOA:Q9ERK7"
FT                   /db_xref="InterPro:IPR002394"
FT                   /db_xref="InterPro:IPR006029"
FT                   /db_xref="InterPro:IPR006201"
FT                   /db_xref="InterPro:IPR006202"
FT                   /db_xref="InterPro:IPR018000"
FT                   /db_xref="InterPro:IPR027361"
FT                   /db_xref="MGI:MGI:87891"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9ERK7"
FT                   /protein_id="EDL15184.1"
FT                   /translation="MARCSNSMALLFSFGLLWLCSGVLGTDTEERLVEHLLDPSRYNKL
FT                   IRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKK
FT                   VRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFP
FT                   FDQQNCTMKFRSWTYDRTEIDLVLKSDVASLDDFTPSGEWDIIALPGRRNENPDDSTYV
FT                   DITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLL
FT                   LISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFL
FT                   EKLPTLLFLQQPRHRCARQRLRLRRRQREREGAGTLFFREGPAADPCTCFVNPASMQGL
FT                   AGAFQAEPAAAGLGRSMGPCSCGLREAVDGVRFIADHMRSEDDDQSVREDWKYVAMVID
FT                   RLFLWIFVFVCVFGTIGMFLQPLFQNYTATTFLHSDHSAPSSK"
FT   gene            complement(25120872..25126451)
FT                   /gene="4632404H12Rik"
FT                   /locus_tag="mCG_1032259"
FT                   /note="gene_id=mCG1032259.0"
FT   mRNA            complement(join(25120872..25121523,25121544..25122772,
FT                   25125712..25126451))
FT                   /gene="4632404H12Rik"
FT                   /locus_tag="mCG_1032259"
FT                   /product="RIKEN cDNA 4632404H12"
FT                   /note="gene_id=mCG1032259.0 transcript_id=mCT149963.1
FT                   created on 25-OCT-2002"
FT   CDS             complement(join(25122424..25122772,25125712..25125749))
FT                   /codon_start=1
FT                   /gene="4632404H12Rik"
FT                   /locus_tag="mCG_1032259"
FT                   /product="RIKEN cDNA 4632404H12"
FT                   /note="gene_id=mCG1032259.0 transcript_id=mCT149963.1
FT                   protein_id=mCP65569.1"
FT                   /db_xref="GOA:Q9D683"
FT                   /db_xref="MGI:MGI:1921284"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D683"
FT                   /protein_id="EDL15183.1"
FT                   /translation="MLAESFTRPSLTPSHPWICPSFSWIHLSNPFMRFAAWCDSYKPRS
FT                   DEEKGRIKAGEGAQLPDLFSSAGIPSPGSCSVSAEKASGISELCGSWTPMSRDALPLRH
FT                   CPTSAVQFLGFRAPVDTLPLSRNL"
FT   gene            25126904..25137225
FT                   /gene="Ube2q"
FT                   /locus_tag="mCG_22232"
FT                   /note="gene_id=mCG22232.1"
FT   mRNA            join(25126904..25127250,25129289..25129393,
FT                   25129724..25129829,25130444..25130494,25132642..25132782,
FT                   25132968..25133052,25133668..25133728,25133918..25134008,
FT                   25134120..25134178,25134278..25134326,25134599..25134694,
FT                   25135002..25135068,25135488..25137225)
FT                   /gene="Ube2q"
FT                   /locus_tag="mCG_22232"
FT                   /product="ubiquitin-conjugating enzyme E2Q (putative)"
FT                   /note="gene_id=mCG22232.1 transcript_id=mCT21188.2 created
FT                   on 24-SEP-2002"
FT   CDS             join(25129800..25129829,25130444..25130494,
FT                   25132642..25132782,25132968..25133052,25133668..25133728,
FT                   25133918..25134008,25134120..25134178,25134278..25134326,
FT                   25134599..25134694,25135002..25135068,25135488..25135519)
FT                   /codon_start=1
FT                   /gene="Ube2q"
FT                   /locus_tag="mCG_22232"
FT                   /product="ubiquitin-conjugating enzyme E2Q (putative)"
FT                   /note="gene_id=mCG22232.1 transcript_id=mCT21188.2
FT                   protein_id=mCP17252.2"
FT                   /protein_id="EDL15182.1"
FT                   /translation="MLDQPLPAEQCTQEEVSSEDEDEEMPEDTEDLDHYEMKEEEPAEG
FT                   KKSEDDGIGKENLAILEKIKKNQRQDYLNGAVSGSVQATDRLMKELRDIYRSQSFKGGN
FT                   YAVELVNDSLYDWNVKLLKVDQDSALHNDLQILKEKEGADFILLNFSFKDNFPFDPPFV
FT                   RVVSPVLSGGYVLGGGAICMELLTKQGWSSAYSIESVIMQISATLVKGKARVQFGANKS
FT                   QYSLTRAQQSYKSLVQIHEKNGWYTPPKEDG"
FT   gene            25187327..>25207899
FT                   /gene="She"
FT                   /locus_tag="mCG_124554"
FT                   /note="gene_id=mCG124554.1"
FT   mRNA            join(25187327..25187456,25202553..25202858,
FT                   25204895..25204935,25205552..25205671,25207716..>25207899)
FT                   /gene="She"
FT                   /locus_tag="mCG_124554"
FT                   /product="src homology 2 domain-containing transforming
FT                   protein E"
FT                   /note="gene_id=mCG124554.1 transcript_id=mCT125800.1
FT                   created on 25-OCT-2002"
FT   CDS             join(25202787..25202858,25204895..25204935,
FT                   25205552..25205671,25207716..25207899)
FT                   /codon_start=1
FT                   /gene="She"
FT                   /locus_tag="mCG_124554"
FT                   /product="src homology 2 domain-containing transforming
FT                   protein E"
FT                   /note="gene_id=mCG124554.1 transcript_id=mCT125800.1
FT                   protein_id=mCP65894.1"
FT                   /protein_id="EDL15181.1"
FT                   /translation="MIGPLLSMNSPGSGRGSRSREPCQGEKVDPGLALEKQPWYHGSIS
FT                   RAEAESRLQPCKEAAYLVRNSESGNSKYSIALKTSQGCVHIIVAQTKDNKYTLNQTSAV
FT                   FDSIPEVVHYYSNAKLPFKGAEHMTLLHPVHKLH"
FT   gene            complement(25223227..25265939)
FT                   /gene="Il6ra"
FT                   /locus_tag="mCG_124537"
FT                   /note="gene_id=mCG124537.1"
FT   mRNA            complement(join(25223227..25224542,25229951..25230050,
FT                   25230986..25231055,25231991..25232037,25238837..25238978,
FT                   25239477..25239643,25239957..25240141,25242122..25242245,
FT                   25243172..25243408,25265732..25265939))
FT                   /gene="Il6ra"
FT                   /locus_tag="mCG_124537"
FT                   /product="interleukin 6 receptor, alpha"
FT                   /note="gene_id=mCG124537.1 transcript_id=mCT125781.1
FT                   created on 01-AUG-2002"
FT   CDS             complement(join(25224317..25224542,25229951..25230050,
FT                   25230986..25231055,25231991..25232037,25238837..25238978,
FT                   25239477..25239643,25239957..25240141,25242122..25242245,
FT                   25243172..25243408,25265732..25265816))
FT                   /codon_start=1
FT                   /gene="Il6ra"
FT                   /locus_tag="mCG_124537"
FT                   /product="interleukin 6 receptor, alpha"
FT                   /note="gene_id=mCG124537.1 transcript_id=mCT125781.1
FT                   protein_id=mCP65629.1"
FT                   /protein_id="EDL15180.1"
FT                   /translation="MLTVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTL
FT                   ICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPL
FT                   LVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQ
FT                   YSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVS
FT                   AIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALR
FT                   GVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHED
FT                   QYESSTEATSVLAPVQESSSMSLPTFLVAGGSLAFGLLLCVFIILRLKQKWKSEAEKES
FT                   KTTSPPPPPYSLGPLKPTFLLVPLLTPHSSGSDNTVNHSCLGVRDAQSPYDNSNRDYLF
FT                   PR"
FT   gene            complement(25292255..>25313969)
FT                   /locus_tag="mCG_22242"
FT                   /note="gene_id=mCG22242.1"
FT   mRNA            complement(join(25292255..25294202,25294446..25294576,
FT                   25296109..25296247,25296393..25296638,25296888..25296971,
FT                   25297776..25297999,25298261..25298444,25298700..25298844,
FT                   25298958..25299063,25299207..25299318,25299404..25299558,
FT                   25300579..25300698,25300826..25301014,25301166..25301331,
FT                   25301748..25301791,25302588..25302796,25305457..25305653,
FT                   25306984..25307072,25307222..25307380,25309837..25309916,
FT                   25310124..25310194,25310637..25310709,25310806..25310867,
FT                   25311117..25311215,25311337..25311450,25311819..25311877,
FT                   25313903..>25313969))
FT                   /locus_tag="mCG_22242"
FT                   /product="mCG22242"
FT                   /note="gene_id=mCG22242.1 transcript_id=mCT21198.2 created
FT                   on 31-OCT-2002"
FT   CDS             complement(join(25293924..25294202,25294446..25294576,
FT                   25296109..25296247,25296393..25296638,25296888..25296971,
FT                   25297776..25297999,25298261..25298444,25298700..25298844,
FT                   25298958..25299063,25299207..25299318,25299404..25299558,
FT                   25300579..25300698,25300826..25301014,25301166..25301331,
FT                   25301748..25301791,25302588..25302796,25305457..25305653,
FT                   25306984..25307072,25307222..25307380,25309837..25309916,
FT                   25310124..25310194,25310637..25310709,25310806..25310867,
FT                   25311117..25311215,25311337..25311450,25311819..25311877,
FT                   25313903..>25313969))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22242"
FT                   /product="mCG22242"
FT                   /note="gene_id=mCG22242.1 transcript_id=mCT21198.2
FT                   protein_id=mCP17250.1"
FT                   /protein_id="EDL15179.1"
FT                   /translation="GLPWIAGTLLGEMALCAKKRPPEEERRARANDREYNEKFQYASNC
FT                   IKTSKYNIVTFLPVNLFEQFQEVANTYFLFLLILQLIPQISSLSWFTTIVPLVLVLTIT
FT                   AVKDATDDYFRHKSDNQVNNRHSQVLINGVLQQEQWMNVCVGDIIKLENNQFVAADLLL
FT                   LSSSEPHGLCYIETAELDGETNMKVRQAIPVTSELGDVSQLARFDGEVICEPPNNKLDK
FT                   FSGTLYWKENKFPLSNQNMLLRGCVLRNTEWCFGLVIFAGPDTKLMQNSGRTKFKRTSI
FT                   DRLMNTLVLWIFGFLVCMGVILAIGNAIWEHEVGTRFQVYLPWDEAVDSAFFSGFLSFW
FT                   SYIIILNTVVPISLYVSVEVIRLGHSYFINWDKKMFCMKKRTPAEARTTTLNEELGQVE
FT                   YIFSDKTGTLTQNIMVFNKCSINGHSYGDVFDVLGHKAELGERPEPVDFSFNPLADKKF
FT                   LFWDSSLLEAVKMGDPHTHEFFRLLSLCHTVMSEEKNEGELYYKAQSPDEGALVTAARN
FT                   FGFVFRSRTPKTITVHELGTAITYQLLAILDFNNIRKRMSVIVRNPEGKIRLYCKGADT
FT                   ILLDRLHPPTQELLSSTTDHLNVGDGLRTLVLAYKDLDEEYYEEWARRRLQASLAQDSR
FT                   EDRLASIYEEVESDMMLLGATAIEDKLQQGVPETIALLTLANIKIWVLTGDKQETAVNI
FT                   GYSCKMLTDDMTEVFVVTGHTVLEVREELRKARKKMVDSSHAVGNGFTYQGNLSSSKLT
FT                   SVLEAVAGEYALVINGHSLAHALEADMELEFLETACACKAVICCRVTPLQKAQVVELVK
FT                   KYKKAVTLAIGDGANDVSMIKTAHIGVGISGQEGIQAVLASDYSFSQFKFLQRLLLVHG
FT                   RWSYLRMCKFLCYFFYKNFAFTMVHFWFGFFCGFSAQTVYDQYFITLYNIVYTSLPVLA
FT                   MGVFDQDVPEQRSMEYPKLYEPGQLNLLFNKREFFICIAQGIYTSVLMFFIPYGVFAEA
FT                   TRDDGTQLADYQSFAVTVATSLVIVVSVQIGLDTGYWTAINHFFIWGSLAVYFAILFAM
FT                   HSNGLFDMFPNQFRFVGNAQNTLAQPTVWLTIALTTAVCIMPVVAFRFLRLSLKPDLSD
FT                   TVRYTQLVRKKQKAQHRCMRRVGRTGSRRSGYAFSHQEGFGELIMSGKNMRLSSLALSS
FT                   FSTRSSSSWIESLRRKKSDSANSPSGGAEKPLKG"
FT   gene            complement(25317624..25319092)
FT                   /pseudo
FT                   /locus_tag="mCG_22225"
FT                   /note="gene_id=mCG22225.1"
FT   mRNA            complement(join(25317624..25317726,25318332..25318524,
FT                   25318754..25318890,25318954..25319092))
FT                   /pseudo
FT                   /locus_tag="mCG_22225"
FT                   /note="gene_id=mCG22225.1 transcript_id=mCT21181.2 created
FT                   on 27-MAR-2003"
FT   gene            complement(25348316..>25351549)
FT                   /locus_tag="mCG_124547"
FT                   /note="gene_id=mCG124547.0"
FT   mRNA            complement(join(25348316..25348569,25348673..25348763,
FT                   25348870..25348976,25349106..25349157,25350246..25350433,
FT                   25350597..25350862,25351387..25351549))
FT                   /locus_tag="mCG_124547"
FT                   /product="mCG124547, transcript variant mCT125792"
FT                   /note="gene_id=mCG124547.0 transcript_id=mCT125792.0
FT                   created on 01-AUG-2002"
FT   mRNA            complement(join(25348316..25348569,25348673..25348763,
FT                   25348870..25348976,25349106..25349157,25350246..25350862,
FT                   25351387..>25351549))
FT                   /locus_tag="mCG_124547"
FT                   /product="mCG124547, transcript variant mCT190994"
FT                   /note="gene_id=mCG124547.0 transcript_id=mCT190994.0
FT                   created on 08-MAR-2004"
FT   mRNA            complement(join(<25348484..25348569,25348673..25348763,
FT                   25348870..25348976,25349106..25349157,25350661..25350862,
FT                   25351387..>25351439))
FT                   /locus_tag="mCG_124547"
FT                   /product="mCG124547, transcript variant mCT190995"
FT                   /note="gene_id=mCG124547.0 transcript_id=mCT190995.0
FT                   created on 08-MAR-2004"
FT   CDS             complement(join(25348484..25348569,25348673..25348763,
FT                   25348870..25348976,25349106..25349157,25350661..25350862,
FT                   25351387..25351439))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124547"
FT                   /product="mCG124547, isoform CRA_c"
FT                   /note="gene_id=mCG124547.0 transcript_id=mCT190995.0
FT                   protein_id=mCP111937.0 isoform=CRA_c"
FT                   /protein_id="EDL15178.1"
FT                   /translation="MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDR
FT                   GAWGRESYAFDGSQPPEEFGFSFSPRGGMRFHGNFGFDDLLDDTWPVSPHSRAKEDKDL
FT                   DSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETTVTHQEAH
FT                   DSSRSDPDSQRSSALDDPFSILDLLLGRWFRSR"
FT   CDS             complement(join(25348484..25348569,25348673..25348763,
FT                   25348870..25348976,25349106..25349157,25350246..25350433,
FT                   25350597..25350862,25351387..25351439))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124547"
FT                   /product="mCG124547, isoform CRA_a"
FT                   /note="gene_id=mCG124547.0 transcript_id=mCT125792.0
FT                   protein_id=mCP65920.1 isoform=CRA_a"
FT                   /db_xref="GOA:B9EJR4"
FT                   /db_xref="InterPro:IPR017248"
FT                   /db_xref="MGI:MGI:1346319"
FT                   /db_xref="UniProtKB/TrEMBL:B9EJR4"
FT                   /protein_id="EDL15176.1"
FT                   /translation="MSVFDLFRGFFGFPGPRSHRDPFFGGMTRDDDDDDDDDDEAEEDR
FT                   GAWGRESYAFDGSQPPEEFGFSFSPRGGMRFHGNFGFDDLVRDFNSIFSEMGAWTLPSH
FT                   SPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFEGVLESHAKPESPKPAPDWGS
FT                   QGPFHRLDDTWPVSPHSRAKEDKDLDSQVSQEGLGPLLQPQPKSYFKSISVTKITKPDG
FT                   TVEERRTVVDSEGRRETTVTHQEAHDSSRSDPDSQRSSALDDPFSILDLLLGRWFRSR"
FT   CDS             complement(join(25348484..25348569,25348673..25348763,
FT                   25348870..25348976,25349106..25349157,25350246..>25350473))
FT                   /codon_start=1
FT                   /locus_tag="mCG_124547"
FT                   /product="mCG124547, isoform CRA_b"
FT                   /note="gene_id=mCG124547.0 transcript_id=mCT190994.0
FT                   protein_id=mCP111936.0 isoform=CRA_b"
FT                   /protein_id="EDL15177.1"
FT                   /translation="GLSYPRITYQLSTELPGPESETPGERLREGQTLRDSMLKYPDSHQ
FT                   PRIFEGVLESHAKPESPKPAPDWGSQGPFHRLDDTWPVSPHSRAKEDKDLDSQVSQEGL
FT                   GPLLQPQPKSYFKSISVTKITKPDGTVEERRTVVDSEGRRETTVTHQEAHDSSRSDPDS
FT                   QRSSALDDPFSILDLLLGRWFRSR"
FT   gene            complement(25352443..25405332)
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /note="gene_id=mCG22226.1"
FT   mRNA            complement(join(25352443..25353850,25354677..25354787,
FT                   25355138..25355335,25356104..25356171,25361115..25361220,
FT                   25361969..25362186,25363292..25363373,25365545..25365598,
FT                   25367989..25368077,25368161..25368356,25369558..25369630,
FT                   25369974..25370148,25371273..25371327,25372011..25372200,
FT                   25373756..25373928,25374098..25374375,25376290..25376488,
FT                   25379448..25379537,25381184..25381236,25384170..25384229,
FT                   25386924..25387022,25387514..25387559,25391229..25391324,
FT                   25391678..25391875,25396559..25396669,25397713..25397790,
FT                   25400621..25400750,25405241..25405332))
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, transcript
FT                   variant mCT21182"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT21182.2 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25353001..25353112,25354677..25354727,
FT                   25355138..25355335,25356104..25356171,25361115..25361220,
FT                   25361969..25362186,25363292..25363373,25365545..25365598,
FT                   25367989..25368077,25368161..25368356,25369558..25369630,
FT                   25369974..25370148,25371273..25371327,25372011..25372200,
FT                   25373756..25373928,25374098..25374375,25376290..25376488,
FT                   25377922..25378093,25379452..25379537,25381184..25381236,
FT                   25384170..25384229,25386924..25387036,25387514..25387559,
FT                   25391229..25391324,25391707..25391875,25396559..25396669,
FT                   25397713..25397790,25400621..25400750,25405241..25405316))
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, transcript
FT                   variant mCT181536"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT181536.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25353001..25353112,25355138..25355332,
FT                   25356104..25356171,25361115..25361220,25361969..25362186,
FT                   25363292..25363373,25365545..25365598,25367989..25368077,
FT                   25368161..25368356,25369558..25369630,25369974..25370148,
FT                   25371273..25371327,25372011..25372200,25373756..25373928,
FT                   25374098..25374375,25376290..25376488,25377922..25378093,
FT                   25379452..25379537,25381184..25381236,25386924..25387036,
FT                   25387514..25387559,25391229..25391324,25391707..25391875,
FT                   25396559..25396669,25397713..25397790,25400621..25400750,
FT                   25405241..25405306))
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, transcript
FT                   variant mCT181537"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT181537.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(25353074..25353112,25355138..25355332,
FT                   25356104..25356171,25361115..25361220,25361969..25362186,
FT                   25363292..25363373,25365545..25365598,25367989..25368077,
FT                   25368161..25368356,25369558..25369630,25369974..25370148,
FT                   25371273..25371327,25372011..25372200,25373756..25373928,
FT                   25374098..25374375,25376290..25376488,25377922..25378093,
FT                   25379452..25379537,25381184..25381236,25386924..25387036,
FT                   25387514..25387559,25391229..25391324,25391707..25391875,
FT                   25396559..25396669,25397713..25397790,25400621..25400710))
FT                   /codon_start=1
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, isoform
FT                   CRA_g"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT181537.0
FT                   protein_id=mCP104458.0 isoform=CRA_g"
FT                   /protein_id="EDL15175.1"
FT                   /translation="MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDH
FT                   NDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKG
FT                   VSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSG
FT                   GPSGRGTDRGRRGRGRGRGSSGRRGGRFSAQGMGTFNPADYAEPANTDDNYGNSSGNTW
FT                   NNTGHFEPDDGTSAWRTATEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQR
FT                   IDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSKQNAISQPASGSTFSHHSMVS
FT                   MLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSP
FT                   SLVQYDLKSANDSTVHSPFTKRQAFTPSSTMMEVFLQEKPPAVATSTAAPPPPSSPLPS
FT                   KSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSKIPALAVEMPGSADISGLNLQ
FT                   FGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTASESSSTVSSNQSQESGYQSGPI
FT                   QSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAKNGFSSVQATQLQTTQSV
FT                   EGATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSSSLSGLSHTEEIPNTTTTQHS
FT                   SALSTQQNTLSSSTSSGRTSTSTLLHTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVS
FT                   SSLNSGSSLGLSLGSNSTVTASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHA
FT                   YPPQVYGYDDLQMLQTRFPLDYYSIPFPTPTTPLTGRDGSLASNPYSGDLTKFGRGDAS
FT                   SPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAV
FT                   FPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGVSVTSSNTGVPDISGSVYSKT
FT                   QSFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYPPAPFMHILTPHQQPHSQILHH
FT                   HLQQDGQDILTLVDDQLGE"
FT   CDS             complement(join(25353074..25353112,25354677..25354727,
FT                   25355138..25355335,25356104..25356171,25361115..25361220,
FT                   25361969..25362186,25363292..25363373,25365545..25365598,
FT                   25367989..25368077,25368161..25368356,25369558..25369630,
FT                   25369974..25370148,25371273..25371327,25372011..25372200,
FT                   25373756..25373928,25374098..25374375,25376290..25376488,
FT                   25377922..25378093,25379452..25379537,25381184..25381236,
FT                   25384170..25384229,25386924..25387036,25387514..25387559,
FT                   25391229..25391324,25391707..25391875,25396559..25396669,
FT                   25397713..25397790,25400621..25400710))
FT                   /codon_start=1
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, isoform
FT                   CRA_a"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT181536.0
FT                   protein_id=mCP104459.0 isoform=CRA_a"
FT                   /protein_id="EDL15169.1"
FT                   /translation="MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDH
FT                   NDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKG
FT                   VSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSG
FT                   GPSGRGTDRGRRGRGRGRGSSGRRGGRFSAQGMGTFNPADYAEPANTDDNYGNSSGNTW
FT                   NNTGHFEPDDGTRLDFIGVEGSNYPRKFETAPGAWRTATEEWGTEDWNEDLSETKIFTA
FT                   SNVSSVPLPAENVTITAGQRIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSK
FT                   QNAISQPASGSTFSHHSMVSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQH
FT                   SQSGSTTTSSWDMGSTTQSPSLVQYDLKSANDSTVHSPFTKRQAFTPSSTMMEVFLQEK
FT                   PPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSK
FT                   IPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTASE
FT                   SSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLT
FT                   QAKNGFSSVQATQLQTTQSVEGATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSS
FT                   SLSGLSHTEEIPNTTTTQHSSALSTQQNTLSSSTSSGRTSTSTLLHTSVESEANLHSSS
FT                   STFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTSGKAPPNLP
FT                   PGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFPTPTTPLTGRDG
FT                   SLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTS
FT                   LPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGV
FT                   SVTSSNTGVPDISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYP
FT                   PAPFMHILTPHQQPHSQILHHHLQQDGQLPYLQMILCCQRQQEEQDILTLVDDQLGE"
FT   mRNA            complement(join(25353147..25353850,25355138..25355335,
FT                   25356104..25356171,25361115..25361220,25361969..25362186,
FT                   25363292..25363373,25365545..25365598,25367989..25368077,
FT                   25368161..25368356,25369558..25369630,25369974..25370148,
FT                   25371273..25371327,25372011..25372200,25373756..25373928,
FT                   25374098..25374375,25376290..25376488,25377922..25378093,
FT                   25379452..25379537,25381184..25381236,25384155..25384229,
FT                   25386924..25387036,25387514..25387559,25391229..25391324,
FT                   25391707..25391875,25396559..25396669,25397713..25397790,
FT                   25400621..25400750,25405241..25405328))
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, transcript
FT                   variant mCT190974"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT190974.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25353177..25353850,25355138..25355335,
FT                   25356104..25356171,25361115..25361220,25361969..25362186,
FT                   25363292..25363373,25365545..25365598,25367989..25368077,
FT                   25368161..25368356,25369558..25369630,25369974..25370148,
FT                   25371273..25371327,25372011..25372200,25373756..25373928,
FT                   25374098..25374375,25376290..25376488,25377922..25378093,
FT                   25379452..25379537,25381184..25381236,25384170..25384229,
FT                   25386924..25387036,25387514..25387559,25391229..25391324,
FT                   25391707..25391875,25396559..25396669,25397713..25397790,
FT                   25400621..25400752))
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, transcript
FT                   variant mCT190972"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT190972.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(25353755..25353850,25355138..25355335,
FT                   25356104..25356171,25361115..25361220,25361969..25362186,
FT                   25363292..25363373,25365545..25365598,25367989..25368077,
FT                   25368161..25368356,25369558..25369630,25369974..25370148,
FT                   25371273..25371327,25372011..25372200,25373756..25373928,
FT                   25374098..25374375,25376290..25376488,25377922..25378093,
FT                   25379452..25379537,25381184..25381236,25384170..25384229,
FT                   25386924..25387036,25387514..25387559,25391229..25391324,
FT                   25391707..25391875,25396559..25396669,25397713..25397790,
FT                   25400621..25400710))
FT                   /codon_start=1
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, isoform
FT                   CRA_c"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT190972.0
FT                   protein_id=mCP111907.0 isoform=CRA_c"
FT                   /protein_id="EDL15171.1"
FT                   /translation="MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDH
FT                   NDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKG
FT                   VSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSG
FT                   GPSGRGTDRGRRGRGRGRGSSGRRGGRFSAQGMGTFNPADYAEPANTDDNYGNSSGNTW
FT                   NNTGHFEPDDGTRLDFIGVEGSNYPRKFETAPGAWRTATEEWGTEDWNEDLSETKIFTA
FT                   SNVSSVPLPAENVTITAGQRIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSK
FT                   QNAISQPASGSTFSHHSMVSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQH
FT                   SQSGSTTTSSWDMGSTTQSPSLVQYDLKSANDSTVHSPFTKRQAFTPSSTMMEVFLQEK
FT                   PPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSK
FT                   IPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTASE
FT                   SSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLT
FT                   QAKNGFSSVQATQLQTTQSVEGATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSS
FT                   SLSGLSHTEEIPNTTTTQHSSALSTQQNTLSSSTSSGRTSTSTLLHTSVESEANLHSSS
FT                   STFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTSGKAPPNLP
FT                   PGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFPTPTTPLTGRDG
FT                   SLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTS
FT                   LPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGV
FT                   SVTSSNTGVPDISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPINPATAAAYP
FT                   PAPFMHILTPHQQPHSQILHHHLQQDGQTGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN
FT                   "
FT   CDS             complement(join(25353755..25353850,25355138..25355335,
FT                   25356104..25356171,25361115..25361220,25361969..25362186,
FT                   25363292..25363373,25365545..25365598,25367989..25368077,
FT                   25368161..25368356,25369558..25369630,25369974..25370148,
FT                   25371273..25371327,25372011..25372200,25373756..25373928,
FT                   25374098..25374375,25376290..25376488,25377922..25378093,
FT                   25379452..25379537,25381184..25381236,25384155..25384229,
FT                   25386924..25387036,25387514..25387559,25391229..25391324,
FT                   25391707..25391875,25396559..25396669,25397713..25397790,
FT                   25400621..25400710))
FT                   /codon_start=1
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, isoform
FT                   CRA_e"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT190974.0
FT                   protein_id=mCP111909.0 isoform=CRA_e"
FT                   /protein_id="EDL15173.1"
FT                   /translation="MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDH
FT                   NDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKG
FT                   VSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSG
FT                   GPSGRGTDRGRRGRGRGRGSSGRRGGRFSAQGMGTFNPADYAEPANTDDNYGNSSGNTW
FT                   NNTGHFEPDDGTRLDFIGVEGSNYPRKFETAPGMIHPGAWRTATEEWGTEDWNEDLSET
FT                   KIFTASNVSSVPLPAENVTITAGQRIDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLV
FT                   FSNSKQNAISQPASGSTFSHHSMVSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQ
FT                   LAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKSANDSTVHSPFTKRQAFTPSSTMMEV
FT                   FLQEKPPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKT
FT                   SLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSSLYT
FT                   STASESSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSP
FT                   QKDLTQAKNGFSSVQATQLQTTQSVEGATGSAVKSESPSTSSIPSLNETVPAASLLTTA
FT                   NQHSSSLSGLSHTEEIPNTTTTQHSSALSTQQNTLSSSTSSGRTSTSTLLHTSVESEAN
FT                   LHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTSGKA
FT                   PPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFPTPTTPL
FT                   TGRDGSLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPG
FT                   YSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHG
FT                   YNTGVSVTSSNTGVPDISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPINPAT
FT                   AAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQTGSGQRSQTSSIPQKPQTNKSAYNSY
FT                   SWGAN"
FT   CDS             complement(join(25353755..25353850,25354677..25354787,
FT                   25355138..25355335,25356104..25356171,25361115..25361220,
FT                   25361969..25362186,25363292..25363373,25365545..25365598,
FT                   25367989..25368077,25368161..25368356,25369558..25369630,
FT                   25369974..25370148,25371273..25371327,25372011..25372200,
FT                   25373756..25373928,25374098..25374375,25376290..25376488,
FT                   25379448..25379537,25381184..25381236,25384170..25384229,
FT                   25386924..25387022,25387514..25387559,25391229..25391324,
FT                   25391678..25391875,25396559..25396669,25397713..25397790,
FT                   25400621..25400710))
FT                   /codon_start=1
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, isoform
FT                   CRA_f"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT21182.2
FT                   protein_id=mCP17259.2 isoform=CRA_f"
FT                   /protein_id="EDL15174.1"
FT                   /translation="MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDH
FT                   NDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKG
FT                   VSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGRECMHGALSKPAFGAR
FT                   KMDWMAPRVEGLLEEAQTEAEEAVAVAEVVLVGEEEGFLLKEWADYAEPANTDDNYGNS
FT                   SGNTWNNTGHFEPDDGTRLDFIGVEGSNYPRKFETAPGAWRTATEEWGTEDWNEDLSET
FT                   KIFTASNVSSVPLPAENVTITAGQRQVSMLGKGFGDVGEAKGGSTTGSQFLEQFKTAQA
FT                   LAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKSANDSTVHSPFTKRQAFTPSSTM
FT                   MEVFLQEKPPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLKQQK
FT                   KKTSLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQAPSS
FT                   LYTSTASESSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPSSIS
FT                   SSPQKDLTQAKNGFSSVQATQLQTTQSVEGATGSAVKSESPSTSSIPSLNETVPAASLL
FT                   TTANQHSSSLSGLSHTEEIPNTTTTQHSSALSTQQNTLSSSTSSGRTSTSTLLHTSVES
FT                   EANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVATTS
FT                   GKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFPTPT
FT                   TPLTGRDGSLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLNPAL
FT                   PPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPSGYG
FT                   SHGYNTGVSVTSSNTGVPDISGSVYSKTQQSFEKQGFHSGTPAASFNLPSALGSGGPIN
FT                   PATAAAYPPAPFMHILTPHQQPHSQILHHHLQQDGQWSSIVKSLSLYFPYILVLPQLPY
FT                   LQMILCCQRQQEEQTGSGQRSQTSSIPQKPQTNKSAYNSYSWGAN"
FT   mRNA            complement(join(25358853..25359476,25361115..25361220,
FT                   25361969..25362186,25363292..25363373,25365545..25365598,
FT                   25367989..25368077,25368161..25368356,25369558..25369630,
FT                   25369974..25370148,25371273..25371327,25372011..25372200,
FT                   25373756..25373928,25374098..25374375,25376290..25376488,
FT                   25377922..25378093,25379452..25379537,25381184..25381236,
FT                   25386924..25387036,25387514..25387559,25391229..25391324,
FT                   25391707..25391875,25396559..25396669,25397713..25397790,
FT                   25400621..25400750,25405241..25405306))
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, transcript
FT                   variant mCT190971"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT190971.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25359079..25359476,25361115..25361220,
FT                   25361969..25362186,25363292..25363373,25365545..25365598,
FT                   25367989..25368077,25368161..25368356,25369558..25369630,
FT                   25369974..25370148,25371273..25371327,25372011..25372200,
FT                   25373756..25373928,25374098..25374375,25376290..25376488,
FT                   25377922..25378093,25379452..25379537,25381184..25381236,
FT                   25384170..25384229,25386924..25387036,25387514..25387559,
FT                   25391229..25391324,25391674..25391875,25396559..25396669,
FT                   25397713..25397790,25400621..25400750,25405241..25405324))
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, transcript
FT                   variant mCT190973"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT190973.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(25359427..25359476,25361115..25361220,
FT                   25361969..25362186,25363292..25363373,25365545..25365598,
FT                   25367989..25368077,25368161..25368356,25369558..25369630,
FT                   25369974..25370148,25371273..25371327,25372011..25372200,
FT                   25373756..25373928,25374098..25374375,25376290..25376488,
FT                   25377922..25378093,25379452..25379537,25381184..25381236,
FT                   25386924..25387036,25387514..25387559,25391229..25391324,
FT                   25391707..25391875,25396559..25396669,25397713..25397790,
FT                   25400621..25400710))
FT                   /codon_start=1
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, isoform
FT                   CRA_b"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT190971.0
FT                   protein_id=mCP111906.0 isoform=CRA_b"
FT                   /protein_id="EDL15170.1"
FT                   /translation="MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDH
FT                   NDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKG
FT                   VSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGREFRGQENGLDGTKSG
FT                   GPSGRGTDRGRRGRGRGRGSSGRRGGRFSAQGMGTFNPADYAEPANTDDNYGNSSGNTW
FT                   NNTGHFEPDDGTSAWRTATEEWGTEDWNEDLSETKIFTASNVSSVPLPAENVTITAGQR
FT                   IDLAVLLGKTPSSMENDSSNLDPSQAPSLAQPLVFSNSKQNAISQPASGSTFSHHSMVS
FT                   MLGKGFGDVGEAKGGSTTGSQFLEQFKTAQALAQLAAQHSQSGSTTTSSWDMGSTTQSP
FT                   SLVQYDLKSANDSTVHSPFTKRQAFTPSSTMMEVFLQEKPPAVATSTAAPPPPSSPLPS
FT                   KSTSAPQMSPGSSDNQSSSPQPAQQKLKQQKKKTSLTSKIPALAVEMPGSADISGLNLQ
FT                   FGALQFGSEPVLSDYESTPTTSASSSQAPSSLYTSTASESSSTVSSNQSQESGYQSGPI
FT                   QSTTYTSQNNAQGPLYEQRSTQTRRYPSSISSSPQKDLTQAKNGFSSVQATQLQTTQSV
FT                   EGATGSAVKSESPSTSSIPSLNETVPAASLLTTANQHSSSLSGLSHTEEIPNTTTTQHS
FT                   SALSTQQNTLSSSTSSGRTSTSTLLHTSVESEANLHSSSSTFSTTSSTVSAPPPVVSVS
FT                   SSLNSGSSLGLSLGSNSTVTASTRSSVATTSGKAPPNLPPGVPPLLPNPYIMAPGLLHA
FT                   YPPQVYGYDDLQMLQTRFPLDYYSIPFPTPTTPLTGRDGSLASNPYSGDLTKFGRGDAS
FT                   SPAPATTLAQPQQNQTQTHHTTQQTFLNPALPPGYSYTSLPYYTGVPGLPSTFQYGPAV
FT                   FPVAPTSSKQHGVNVSVNASATPFQQPSGYGSHGYNTGRKYPPPYKHFWTAES"
FT   CDS             complement(join(25359427..25359476,25361115..25361220,
FT                   25361969..25362186,25363292..25363373,25365545..25365598,
FT                   25367989..25368077,25368161..25368356,25369558..25369630,
FT                   25369974..25370148,25371273..25371327,25372011..25372200,
FT                   25373756..25373928,25374098..25374375,25376290..25376488,
FT                   25377922..25378093,25379452..25379537,25381184..25381236,
FT                   25384170..25384229,25386924..25387036,25387514..25387559,
FT                   25391229..25391324,25391674..25391875,25396559..25396669,
FT                   25397713..25397790,25400621..25400710))
FT                   /codon_start=1
FT                   /gene="Ubap2l"
FT                   /locus_tag="mCG_22226"
FT                   /product="ubiquitin associated protein 2-like, isoform
FT                   CRA_d"
FT                   /note="gene_id=mCG22226.1 transcript_id=mCT190973.0
FT                   protein_id=mCP111908.0 isoform=CRA_d"
FT                   /protein_id="EDL15172.1"
FT                   /translation="MMTSVGTNRARGNWEQPQNQNQTQHKQRPQATAEQIRLAQMISDH
FT                   NDADFEEKVKQLIDITGKNQDECVIALHDCNGDVNRAINVLLEGNPDTHSWEMVGKKKG
FT                   VSGQKDGGQTESNEEGKENRDRDRDYSRRRGGPPRRGRGASRGRECMHGALSKPAVVRG
FT                   QENGLDGTKSGGPSGRGTDRGRRGRGRGRGSSGRRGGRFSAQGMGTFNPADYAEPANTD
FT                   DNYGNSSGNTWNNTGHFEPDDGTRLDFIGVEGSNYPRKFETAPGAWRTATEEWGTEDWN
FT                   EDLSETKIFTASNVSSVPLPAENVTITAGQRIDLAVLLGKTPSSMENDSSNLDPSQAPS
FT                   LAQPLVFSNSKQNAISQPASGSTFSHHSMVSMLGKGFGDVGEAKGGSTTGSQFLEQFKT
FT                   AQALAQLAAQHSQSGSTTTSSWDMGSTTQSPSLVQYDLKSANDSTVHSPFTKRQAFTPS
FT                   STMMEVFLQEKPPAVATSTAAPPPPSSPLPSKSTSAPQMSPGSSDNQSSSPQPAQQKLK
FT                   QQKKKTSLTSKIPALAVEMPGSADISGLNLQFGALQFGSEPVLSDYESTPTTSASSSQA
FT                   PSSLYTSTASESSSTVSSNQSQESGYQSGPIQSTTYTSQNNAQGPLYEQRSTQTRRYPS
FT                   SISSSPQKDLTQAKNGFSSVQATQLQTTQSVEGATGSAVKSESPSTSSIPSLNETVPAA
FT                   SLLTTANQHSSSLSGLSHTEEIPNTTTTQHSSALSTQQNTLSSSTSSGRTSTSTLLHTS
FT                   VESEANLHSSSSTFSTTSSTVSAPPPVVSVSSSLNSGSSLGLSLGSNSTVTASTRSSVA
FT                   TTSGKAPPNLPPGVPPLLPNPYIMAPGLLHAYPPQVYGYDDLQMLQTRFPLDYYSIPFP
FT                   TPTTPLTGRDGSLASNPYSGDLTKFGRGDASSPAPATTLAQPQQNQTQTHHTTQQTFLN
FT                   PALPPGYSYTSLPYYTGVPGLPSTFQYGPAVFPVAPTSSKQHGVNVSVNASATPFQQPS
FT                   GYGSHGYNTGRKYPPPYKHFWTAES"
FT   gene            25404486..25415290
FT                   /locus_tag="mCG_124557"
FT                   /note="gene_id=mCG124557.2"
FT   mRNA            join(25404486..25404544,25405452..25405636,
FT                   25405751..25405970,25406359..25406460,25409060..25409177,
FT                   25409382..25409435,25411337..25411503,25411594..25411652,
FT                   25414490..25415148)
FT                   /locus_tag="mCG_124557"
FT                   /product="mCG124557, transcript variant mCT125803"
FT                   /note="gene_id=mCG124557.2 transcript_id=mCT125803.1
FT                   created on 24-SEP-2002"
FT   mRNA            join(<25405722..25405970,25406359..25406460,
FT                   25411337..25411503,25411594..25411652,25414490..25415290)
FT                   /locus_tag="mCG_124557"
FT                   /product="mCG124557, transcript variant mCT190952"
FT                   /note="gene_id=mCG124557.2 transcript_id=mCT190952.0
FT                   created on 08-MAR-2004"
FT   CDS             join(25405905..25405970,25406359..25406460,
FT                   25409060..25409177,25409382..25409435,25411337..25411503,
FT                   25411594..25411652,25414490..25414685)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124557"
FT                   /product="mCG124557, isoform CRA_a"
FT                   /note="gene_id=mCG124557.2 transcript_id=mCT125803.1
FT                   protein_id=mCP65938.1 isoform=CRA_a"
FT                   /protein_id="EDL15167.1"
FT                   /translation="MASSSNWLSGVNVVLVMAYGSLVFVLLFIFVKRQIMRFAMKSRRG
FT                   PHVPVGHNAPKDLKEEIDIRLSRVQDIKYEPQLLADDDTRLLQLETQGNQSCYNYLYRM
FT                   KALDAIRASEIPFHAEGRHPCSLMGKNFRSYLLDLRNTSTPFKGVGKALIDTLLDGYET
FT                   ARYGTGVFGQSEYLRYQEALSELATVVKARIGSSQRQHQSAAKDLTQSPEMSPTTIQVT
FT                   YLPSSQKSKRPKHFLELKSFKDNYNTLESTL"
FT   CDS             join(<25406421..25406460,25411337..25411503,
FT                   25411594..25411652,25414490..25414685)
FT                   /codon_start=1
FT                   /locus_tag="mCG_124557"
FT                   /product="mCG124557, isoform CRA_b"
FT                   /note="gene_id=mCG124557.2 transcript_id=mCT190952.0
FT                   protein_id=mCP111876.0 isoform=CRA_b"
FT                   /protein_id="EDL15168.1"
FT                   /translation="KGTSCSCRTQCPQEIPFHAEGRHPCSLMGKNFRSYLLDLRNTSTP
FT                   FKGVGKALIDTLLDGYETARYGTGVFGQSEYLRYQEALSELATVVKARIGSSQRQHQSA
FT                   AKDLTQSPEMSPTTIQVTYLPSSQKSKRPKHFLELKSFKDNYNTLESTL"
FT   gene            <25415647..25418727
FT                   /locus_tag="mCG_146184"
FT                   /note="gene_id=mCG146184.0"
FT   mRNA            join(<25415647..25415735,25416061..25416101,
FT                   25417277..25417406,25418362..25418727)
FT                   /locus_tag="mCG_146184"
FT                   /product="mCG146184"
FT                   /note="gene_id=mCG146184.0 transcript_id=mCT186287.0
FT                   created on 14-JUL-2003"
FT   CDS             join(<25415649..25415735,25416061..25416101,
FT                   25417277..25417406,25418362..25418463)
FT                   /codon_start=1
FT                   /locus_tag="mCG_146184"
FT                   /product="mCG146184"
FT                   /note="gene_id=mCG146184.0 transcript_id=mCT186287.0
FT                   protein_id=mCP107588.0"
FT                   /protein_id="EDL15166.1"
FT                   /translation="ERRAFPVSPNLASMSVVDMSAEKMTKLEENLQRAVALKKTVDRWR
FT                   NFHIHCMWQTTLDQRRNLFAALRMKDTKEQELALSNKQLLVVRQAALHELFEKEYQQYQ
FT                   QELNQMGKAFYEERL"
FT   gene            25425547..25444991
FT                   /locus_tag="mCG_22236"
FT                   /note="gene_id=mCG22236.2"
FT   mRNA            join(25425547..25425702,25426572..25426697,
FT                   25439304..25439437,25440313..25440430,25440532..25440602,
FT                   25441907..25441982,25442657..25442719,25442870..25442939,
FT                   25443873..25443951,25444792..25444991)
FT                   /locus_tag="mCG_22236"
FT                   /product="mCG22236"
FT                   /note="gene_id=mCG22236.2 transcript_id=mCT125793.1 created
FT                   on 19-JUN-2003"
FT   CDS             join(25425586..25425702,25426572..25426697,
FT                   25439304..25439437,25440313..25440430,25440532..25440602,
FT                   25441907..25441982,25442657..25442719,25442870..25442939,
FT                   25443873..25443951,25444792..25444795)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22236"
FT                   /product="mCG22236"
FT                   /note="gene_id=mCG22236.2 transcript_id=mCT125793.1
FT                   protein_id=mCP65931.1"
FT                   /protein_id="EDL15165.1"
FT                   /translation="MMEAIKKKMQMLKLDKENVLDRAEQAEAEQKQAEERSKQLEDELA
FT                   TMQKKLKGTEDELDKYSEALKDAQEKLELAEKKAADAEAEVASLNRRIQLVEEELDRAQ
FT                   ERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAEEADRKY
FT                   EEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQKEDKY
FT                   EEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDELYAQKLKYKAISDELDHALND
FT                   MTSI"
FT   gene            25457578..25563692
FT                   /locus_tag="mCG_22220"
FT                   /note="gene_id=mCG22220.1"
FT   mRNA            join(25457578..25457802,25460348..25460484,
FT                   25468266..25468397,25471804..25471897,25473141..25473291,
FT                   25475775..25475907,25477295..25477453,25482204..25482272,
FT                   25485475..25485581,25487718..25487858,25489204..25489341,
FT                   25490001..25490090,25497328..25497402,25507665..25507886,
FT                   25513020..25513193,25520920..25521072,25523176..25523280,
FT                   25525236..25525364,25527541..25527668,25529049..25529181,
FT                   25533356..25533418,25534577..25534756,25535089..25535169,
FT                   25538686..25538844,25539293..25539384,25546014..25546231,
FT                   25551110..25551246,25552858..25552981,25554976..25555125,
FT                   25556767..25557018,25560517..25560718,25563588..25563692)
FT                   /locus_tag="mCG_22220"
FT                   /product="mCG22220"
FT                   /note="gene_id=mCG22220.1 transcript_id=mCT21176.2 created
FT                   on 23-SEP-2002"
FT   CDS             join(25457612..25457802,25460348..25460484,
FT                   25468266..25468397,25471804..25471897,25473141..25473291,
FT                   25475775..25475907,25477295..25477453,25482204..25482272,
FT                   25485475..25485581,25487718..25487858,25489204..25489341,
FT                   25490001..25490090,25497328..25497402,25507665..25507886,
FT                   25513020..25513193,25520920..25521072,25523176..25523280,
FT                   25525236..25525364,25527541..25527668,25529049..25529181,
FT                   25533356..25533418,25534577..25534756,25535089..25535169,
FT                   25538686..25538844,25539293..25539384,25546014..25546231,
FT                   25551110..25551246,25552858..25552981,25554976..25555125,
FT                   25556767..25557018,25560517..25560557)
FT                   /codon_start=1
FT                   /locus_tag="mCG_22220"
FT                   /product="mCG22220"
FT                   /note="gene_id=mCG22220.1 transcript_id=mCT21176.2
FT                   protein_id=mCP17235.2"
FT                   /protein_id="EDL15164.1"
FT                   /translation="MIAFGAPRRRSFGLLFSLAPHLFFLFLIGTLANKLNVPQVLLPFS
FT                   REPGRVPFLLEAQRGCYIWHSTHHDAVTIQPLYENGTSCSQRAVLVAESTQPIRLSSII
FT                   LAREVVTDHELRCDVKVDVIDNIEIVSRTRELYVDDAPLELMVRALDSKGNTFSTLAGM
FT                   VFEWSIAQDNESSREELSSKIRILKYSEAEYSPPDYIIEMEKQERQGDVILVSGMRTGA
FT                   AVVKVRIYEPFYKKVAAALIRLLVLENIFLIPSHDTYLLVGAYIKYRVAKMVQGRMTEV
FT                   NFPLEHYTLELQDHRLTNGGLPSKSVALLDEKTAMVTAVQLGQTNLVFVHKNVHMRSVS
FT                   GLPNSTIYVVEPGFLGFSIHPGGRWSLEVGQVYVITVEVFDKSSTRVYISDNLKITFQF
FT                   SKEYFEEQLSTSNGSYHVVKALKDGVVVINATLTSSLQERNSSQPKTYQISHQQEVKIY
FT                   FPIQLKPSFLAFPHHPLGISNRFTVQVEGGSGNFTWSSSNETVAMVTTKGVVTAGQVYV
FT                   MKLNKMELLPFQADVEIGQIIEALNPVDVALVTWQSVKEMVFEGGPHPWILEPSRFFLE
FT                   LSMEKAEAIRVAEVRLPAKRKQNQYVYRVLCLELGEQVLTFRIGNHPGVLNPSPSVEKV
FT                   QVRFICAHPASMLVTPMYKAPSGTQPCPLPQYNKQLIPVSSLRDSVLELAVFDQHGRKF
FT                   DNFSSLMLEWKSSNETLAHFEDSKSVEMGISNSPRSAGVELILVEDVTVQPENATIYNH
FT                   PDVKLVPAHPGFLTLEVYDLCLAYLGPAVAQIRVSDIQELELDLIDKVEIGKTVLVVVR
FT                   VLGSSKHPFRNKYFRNMEVRLQLASAIVTLRLMEDQDEYSENYMLRAVTVGQTTLVAIA
FT                   TDRMGKKFTSAPRHIEVFPPFRLIPEKMTLIATNMMQIMSEGGPQPQSIIHFSISNQTV
FT                   AVVNRRGQVTGKSVGTAVLHGTIQTVNEDTGKVIVFSQDEVQIEVVQLQAVRILAAATR
FT                   LVTATEVFLQLPAENNFAMVVHTKAAGRTTIKVTVRSENSSSGQLEGNLLELSDEIQIL
FT                   VFEKLQLFYANCQPEQILMPMNSQLKLHTNRDDLLLIGPGNRNYTYMAQAVNKGVTVVG
FT                   LWDQRHPGMADYIPVAVEHAIEPDTKLIFVGDVICFSTQLVNQHGEPGVWMISTNNIVQ
FT                   TDTATGVGVARNPGTATIFHNIPGVVKTFREVVVNASSRLTLSYDLKTYLTNTPNATAF
FT                   KLFISTGRNVNLKGSCTPSQALAIEKVLLPETLMLCHVQFSNTLLDIPASKVFHIHSEF
FT                   SVEKGVYVCLIKVRQESKELRQVLSVADTSVYGWATLVSERGKNGMQRILIPFIPGFYM
FT                   NQSEFVLGHKDTGELRILGVERVLESLEVSLPQLPLSSSVWL"
FT   gene            complement(25565903..25572713)
FT                   /locus_tag="mCG_22228"
FT                   /note="gene_id=mCG22228.3"
FT   mRNA            complement(join(25565903..25565989,25566170..25566280,
FT                   25566429..25566537,25566846..25566886,25572697..25572713))
FT                   /locus_tag="mCG_22228"
FT                   /product="mCG22228, transcript variant mCT21184"
FT                   /note="gene_id=mCG22228.3 transcript_id=mCT21184.3 created
FT                   on 26-MAR-2003"
FT   mRNA            complement(join(25565907..25565989,25566170..25566280,
FT                   25566429..25566561,25566617..25566776))
FT                   /locus_tag="mCG_22228"
FT                   /product="mCG22228, transcript variant mCT181539"
FT                   /note="gene_id=mCG22228.3 transcript_id=mCT181539.0 created
FT                   on 26-MAR-2003"
FT   mRNA            complement(join(25565909..25565989,25566170..25566280,
FT                   25566429..25566537,25566617..25566830))
FT                   /locus_tag="mCG_22228"
FT                   /product="mCG22228, transcript variant mCT181538"
FT                   /note="gene_id=mCG22228.3 transcript_id=mCT181538.0 created
FT                   on 26-MAR-2003"
FT   mRNA            complement(join(25565916..25565989,25566170..25566280,
FT                   25566429..25566537,25566846..25566892,25572697..25572713))
FT                   /locus_tag="mCG_22228"
FT                   /product="mCG22228, transcript variant mCT181540"
FT                   /note="gene_id=mCG22228.3 transcript_id=mCT181540.0 created
FT                   on 26-MAR-2003"
FT   CDS             complement(join(25565961..25565989,25566170..25566280,
FT                   25566429..25566537,25566846..25566851))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22228"
FT                   /product="mCG22228, isoform CRA_b"
FT                   /note="gene_id=mCG22228.3 transcript_id=mCT181540.0
FT                   protein_id=mCP104461.0 isoform=CRA_b"
FT                   /protein_id="EDL15162.1"
FT                   /translation="MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITT
FT                   VFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH"
FT   CDS             complement(join(25565961..25565989,25566170..25566280,
FT                   25566429..25566537,25566846..25566851))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22228"
FT                   /product="mCG22228, isoform CRA_b"
FT                   /note="gene_id=mCG22228.3 transcript_id=mCT21184.3
FT                   protein_id=mCP17286.2 isoform=CRA_b"
FT                   /protein_id="EDL15163.1"
FT                   /translation="MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITT
FT                   VFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH"
FT   CDS             complement(join(25565961..25565989,25566170..25566280,
FT                   25566429..25566447))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22228"
FT                   /product="mCG22228, isoform CRA_a"
FT                   /note="gene_id=mCG22228.3 transcript_id=mCT181538.0
FT                   protein_id=mCP104462.0 isoform=CRA_a"
FT                   /protein_id="EDL15160.1"
FT                   /translation="MDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGC
FT                   SFRRKQH"
FT   CDS             complement(join(25565961..25565989,25566170..25566280,
FT                   25566429..25566447))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22228"
FT                   /product="mCG22228, isoform CRA_a"
FT                   /note="gene_id=mCG22228.3 transcript_id=mCT181539.0
FT                   protein_id=mCP104460.0 isoform=CRA_a"
FT                   /protein_id="EDL15161.1"
FT                   /translation="MDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGC
FT                   SFRRKQH"
FT   gene            25574072..25579797
FT                   /gene="Rab13"
FT                   /locus_tag="mCG_22248"
FT                   /note="gene_id=mCG22248.2"
FT   mRNA            join(25574072..25574279,25575649..25575709,
FT                   25576938..25576998,25577201..25577278,25577905..25577994,
FT                   25578113..25578178,25578259..25578312,25578920..25579797)
FT                   /gene="Rab13"
FT                   /locus_tag="mCG_22248"
FT                   /product="RAB13, member RAS oncogene family"
FT                   /note="gene_id=mCG22248.2 transcript_id=mCT21204.2 created
FT                   on 23-SEP-2002"
FT   CDS             join(25574156..25574279,25575649..25575709,
FT                   25576938..25576998,25577201..25577278,25577905..25577994,
FT                   25578113..25578178,25578259..25578312,25578920..25578994)
FT                   /codon_start=1
FT                   /gene="Rab13"
FT                   /locus_tag="mCG_22248"
FT                   /product="RAB13, member RAS oncogene family"
FT                   /note="gene_id=mCG22248.2 transcript_id=mCT21204.2
FT                   protein_id=mCP17288.2"
FT                   /protein_id="EDL15159.1"
FT                   /translation="MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDF
FT                   KIRTVDIEGKRIKLQVWDTAGQERFKTITTAYYRGAMGIILVYDITDEKSFENIQNWMK
FT                   SIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLAREHRIRFFETSAKSSVNVDEAFS
FT                   SLARDILLKTGGRRSGTNSKPSSTGLKTSDKKKNKCLLG"
FT   gene            25585075..25589355
FT                   /gene="Jtb"
FT                   /locus_tag="mCG_22219"
FT                   /note="gene_id=mCG22219.1"
FT   mRNA            join(25585075..25585502,25585657..25585694,
FT                   25585893..25585975,25587429..25587508,25588889..25589355)
FT                   /gene="Jtb"
FT                   /locus_tag="mCG_22219"
FT                   /product="jumping translocation breakpoint, transcript
FT                   variant mCT21175"
FT                   /note="gene_id=mCG22219.1 transcript_id=mCT21175.1 created
FT                   on 26-MAR-2003"
FT   mRNA            join(25585170..25585502,25585657..25585975,
FT                   25587429..25587508,25588889..25588925)
FT                   /gene="Jtb"
FT                   /locus_tag="mCG_22219"
FT                   /product="jumping translocation breakpoint, transcript
FT                   variant mCT181534"
FT                   /note="gene_id=mCG22219.1 transcript_id=mCT181534.0 created
FT                   on 26-MAR-2003"
FT   CDS             join(25585420..25585502,25585657..25585694,
FT                   25585893..25585975,25587429..25587508,25588889..25589045)
FT                   /codon_start=1
FT                   /gene="Jtb"
FT                   /locus_tag="mCG_22219"
FT                   /product="jumping translocation breakpoint, isoform CRA_a"
FT                   /note="gene_id=mCG22219.1 transcript_id=mCT21175.1
FT                   protein_id=mCP17251.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q542D4"
FT                   /db_xref="InterPro:IPR008657"
FT                   /db_xref="MGI:MGI:1346082"
FT                   /db_xref="UniProtKB/TrEMBL:Q542D4"
FT                   /protein_id="EDL15157.1"
FT                   /translation="MLAGAGRRGLPRAGHLCWLLCAFTLKLCEAEAPVREEKLSVSTST
FT                   SPCWLAEEFVVTEECTPCSNFQIKTTPECGSTGYVEKITCSSSKRNEFKSCRSALLEQH
FT                   LFWKFEGVVVAVALVFACLVIVRQRQLDRKALEKVRKQIESI"
FT   CDS             join(25585420..25585502,25585657..25585702)
FT                   /codon_start=1
FT                   /gene="Jtb"
FT                   /locus_tag="mCG_22219"
FT                   /product="jumping translocation breakpoint, isoform CRA_b"
FT                   /note="gene_id=mCG22219.1 transcript_id=mCT181534.0
FT                   protein_id=mCP104456.0 isoform=CRA_b"
FT                   /protein_id="EDL15158.1"
FT                   /translation="MLAGAGRRGLPRAGHLCWLLCAFTLKLCEAEAPVREEKLSGG"
FT   gene            complement(25591005..25597021)
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /note="gene_id=mCG22223.1"
FT   mRNA            complement(join(25591005..25591427,25591556..25591652,
FT                   25591818..25591902,25591989..25592057,25592151..25592257,
FT                   25592390..25592485,25595438..25595559,25595717..25595951,
FT                   25596228..25596342,25596524..25596556,25596814..25597021))
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /product="cAMP responsive element binding protein 3-like 4,
FT                   transcript variant mCT21180"
FT                   /note="gene_id=mCG22223.1 transcript_id=mCT21180.1 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25591006..25591427,25591556..25591652,
FT                   25591818..25591902,25591989..25592057,25592151..25592257,
FT                   25592390..25592485,25595438..25595559,25595717..25595951,
FT                   25596228..25596342,25596814..25597020))
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /product="cAMP responsive element binding protein 3-like 4,
FT                   transcript variant mCT181535"
FT                   /note="gene_id=mCG22223.1 transcript_id=mCT181535.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25591076..25591427,25591556..25591652,
FT                   25591818..25591902,25591989..25592057,25592151..25592257,
FT                   25592390..25592485,25595438..25595559,25595717..>25596054))
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /product="cAMP responsive element binding protein 3-like 4,
FT                   transcript variant mCT190967"
FT                   /note="gene_id=mCG22223.1 transcript_id=mCT190967.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25591077..25591427,25591556..25591652,
FT                   25591818..25591902,25591989..25592057,25592151..25592257,
FT                   25592390..25592485,25595438..25595559,25595717..25595951,
FT                   25596228..25596342,25596524..>25596629))
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /product="cAMP responsive element binding protein 3-like 4,
FT                   transcript variant mCT190966"
FT                   /note="gene_id=mCG22223.1 transcript_id=mCT190966.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(25591237..25591427,25591556..25591652,
FT                   25591818..25591902,25591989..25592057,25592151..25592257,
FT                   25592390..25592485,25595438..25595559,25595717..25595951,
FT                   25596228..25596342,25596524..>25596528))
FT                   /codon_start=1
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /product="cAMP responsive element binding protein 3-like 4,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22223.1 transcript_id=mCT190966.0
FT                   protein_id=mCP111904.0 isoform=CRA_b"
FT                   /protein_id="EDL15154.1"
FT                   /translation="NRNMELGCPELLEPPEDIFSTGSFLELGFNGPASKVPVTRGLQKS
FT                   EPDDFLNLFIDPNMIHCSETSPGRDSGVSEDPGSPAQQASSSPALYEVVYDSGTLQGTQ
FT                   REAGPTFGLISIQIDQWTPALMVPDACTVSGLPSDSHRHILPRVSTRAPAPPAAMPSCQ
FT                   HHLFLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYLD
FT                   GLESRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKLTAQTSSRAAQTSTCVLILL
FT                   FSLALIILPSFSPFQGQSEARPEDYQLHGVISRNILTHENVTENLESPVLKSKLEELPE
FT                   APTTNGSTKTHLKMRVKARPPGQIRGMVHTDEM"
FT   CDS             complement(join(25591237..25591427,25591556..25591652,
FT                   25591818..25591902,25591989..25592057,25592151..25592257,
FT                   25592390..25592485,25595438..25595559,25595717..25595951,
FT                   25596228..25596338))
FT                   /codon_start=1
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /product="cAMP responsive element binding protein 3-like 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22223.1 transcript_id=mCT181535.0
FT                   protein_id=mCP104457.0 isoform=CRA_a"
FT                   /protein_id="EDL15153.1"
FT                   /translation="MELGCPELLEPPEDIFSTGSFLELGFNGPASKVPVTRGLQKSEPD
FT                   DFLNLFIDPNMIHCSETSPGRDSGVSEDPGSPAQQASSSPALYEVVYDSGTLQGTQREA
FT                   GPTFGLISIQIDQWTPALMVPDACTVSGLPSDSHRHILPRVSTRAPAPPAAMPSCQHHL
FT                   FLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYLDGLE
FT                   SRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKLTAQTSSRAAQTSTCVLILLFSL
FT                   ALIILPSFSPFQGQSEARPEDYQLHGVISRNILTHENVTENLESPVLKSKLEELPEAPT
FT                   TNGSTKTHLKMRVKARPPGQIRGMVHTDEM"
FT   CDS             complement(join(25591237..25591427,25591556..25591652,
FT                   25591818..25591902,25591989..25592057,25592151..25592257,
FT                   25592390..25592485,25595438..25595559,25595717..25595951,
FT                   25596228..25596338))
FT                   /codon_start=1
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /product="cAMP responsive element binding protein 3-like 4,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22223.1 transcript_id=mCT21180.1
FT                   protein_id=mCP17237.2 isoform=CRA_a"
FT                   /protein_id="EDL15156.1"
FT                   /translation="MELGCPELLEPPEDIFSTGSFLELGFNGPASKVPVTRGLQKSEPD
FT                   DFLNLFIDPNMIHCSETSPGRDSGVSEDPGSPAQQASSSPALYEVVYDSGTLQGTQREA
FT                   GPTFGLISIQIDQWTPALMVPDACTVSGLPSDSHRHILPRVSTRAPAPPAAMPSCQHHL
FT                   FLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRKIRNKQSAQDSRRRKKEYLDGLE
FT                   SRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKLTAQTSSRAAQTSTCVLILLFSL
FT                   ALIILPSFSPFQGQSEARPEDYQLHGVISRNILTHENVTENLESPVLKSKLEELPEAPT
FT                   TNGSTKTHLKMRVKARPPGQIRGMVHTDEM"
FT   CDS             complement(join(25591237..25591427,25591556..25591652,
FT                   25591818..25591902,25591989..25592057,25592151..25592257,
FT                   25592390..25592485,25595438..25595559,25595717..>25595951))
FT                   /codon_start=1
FT                   /gene="Creb3l4"
FT                   /locus_tag="mCG_22223"
FT                   /product="cAMP responsive element binding protein 3-like 4,
FT                   isoform CRA_c"
FT                   /note="gene_id=mCG22223.1 transcript_id=mCT190967.0
FT                   protein_id=mCP111905.0 isoform=CRA_c"
FT                   /protein_id="EDL15155.1"
FT                   /translation="GLQKSEPDDFLNLFIDPNMIHCSETSPGRDSGVSEDPGSPAQQAS
FT                   SSPALYEVVYDSGTLQGTQREAGPTFGLISIQIDQWTPALMVPDACTVSGLPSDSHRHI
FT                   LPRVSTRAPAPPAAMPSCQHHLFLTDEEKQLLAQEGITLPSHLPLTKAEERILKKIRRK
FT                   IRNKQSAQDSRRRKKEYLDGLESRVAACSEQNQKLQRKVQELERQNIFLMEQVRQLQKL
FT                   TAQTSSRAAQTSTCVLILLFSLALIILPSFSPFQGQSEARPEDYQLHGVISRNILTHEN
FT                   VTENLESPVLKSKLEELPEAPTTNGSTKTHLKMRVKARPPGQIRGMVHTDEM"
FT   gene            25601369..25607129
FT                   /gene="Slc39a1"
FT                   /locus_tag="mCG_22240"
FT                   /note="gene_id=mCG22240.2"
FT   mRNA            join(25601369..25601391,25602064..25602295,
FT                   25603384..25603514,25605745..25607129)
FT                   /gene="Slc39a1"
FT                   /locus_tag="mCG_22240"
FT                   /product="solute carrier family 39 (zinc transporter),
FT                   member 1"
FT                   /note="gene_id=mCG22240.2 transcript_id=mCT21197.2 created
FT                   on 09-APR-2003"
FT   CDS             join(25602109..25602295,25603384..25603514,
FT                   25605745..25606401)
FT                   /codon_start=1
FT                   /gene="Slc39a1"
FT                   /locus_tag="mCG_22240"
FT                   /product="solute carrier family 39 (zinc transporter),
FT                   member 1"
FT                   /note="gene_id=mCG22240.2 transcript_id=mCT21197.2
FT                   protein_id=mCP17249.2"
FT                   /db_xref="GOA:Q9QZ03"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="MGI:MGI:1353474"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9QZ03"
FT                   /protein_id="EDL15152.1"
FT                   /translation="MGPWGEPELLVWRPEAVASEPSVPVGLEVKLGALVLLLLLTLICS
FT                   LVPVCVLRRSGANHEASASGQKALSLVSCFAGGVFLATCLLDLLPDYLAAIDEALEALH
FT                   VTLQFPLQEFILAMGFFLVLVMEQITLAYKEQTSPPHPEETRALLGTVNGGPQHWHDGP
FT                   GIPQAGGTPAAPSALRACVLVFSLALHSVFEGLAVGLQRDRARAMELCLALLLHKGILA
FT                   VSLSLRLLQSHLRVQVVAGCGILFSCMTPLGIGLGAALAESAGPLHQLAQSVLEGMAAG
FT                   TFLYITFLEILPQELATSEQRILKVILLLAGFALLTGLLFVQI"
FT   gene            25608367..25618207
FT                   /gene="Crtc2"
FT                   /locus_tag="mCG_22212"
FT                   /note="gene_id=mCG22212.1"
FT   mRNA            join(25608367..25608637,25611196..25611297,
FT                   25611374..25611492,25612538..25612607,25613235..25613303,
FT                   25613467..25613573,25613664..25613693,25613814..25613908,
FT                   25614035..25614084,25614207..25614451,25615033..25615184,
FT                   25617252..25617438,25617561..25618207)
FT                   /gene="Crtc2"
FT                   /locus_tag="mCG_22212"
FT                   /product="CREB regulated transcription coactivator 2,
FT                   transcript variant mCT21168"
FT                   /note="gene_id=mCG22212.1 transcript_id=mCT21168.2 created
FT                   on 23-SEP-2002"
FT   mRNA            join(<25608420..25608637,25613467..25613573,
FT                   25613664..25613693,25613844..25613908,25614035..25614084,
FT                   25614207..25614451,25614778..25615184,25616532..25616795,
FT                   25617252..25617438,25617561..25618198)
FT                   /gene="Crtc2"
FT                   /locus_tag="mCG_22212"
FT                   /product="CREB regulated transcription coactivator 2,
FT                   transcript variant mCT190919"
FT                   /note="gene_id=mCG22212.1 transcript_id=mCT190919.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<25608618..25608637,25613467..25613573,
FT                   25613664..25613693,25613844..25613908,25614035..25614084,
FT                   25614207..25614451,25614778..25615184,25616532..25616795,
FT                   25617252..25617438,25617561..25617781)
FT                   /codon_start=1
FT                   /gene="Crtc2"
FT                   /locus_tag="mCG_22212"
FT                   /product="CREB regulated transcription coactivator 2,
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22212.1 transcript_id=mCT190919.0
FT                   protein_id=mCP111901.0 isoform=CRA_a"
FT                   /protein_id="EDL15150.1"
FT                   /translation="WTSAPHGTSSDSALHTSVMNPNPQDTYPGPTPPSVLPSRRGGGFL
FT                   DGEMDAKVPAIEENVVDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPV
FT                   LPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETVYPSLSGGNSTTNLTHTMTHLGISGGL
FT                   GLGPSYDVPGLHSPLSHPSLQSSLSNPNLQASLSSPQPQLQGSHSHPSLPASSLAHHAL
FT                   PTTSLGHPSLSAPALSSSSSSSSTSSPVLSAPPYPASTPGASPRHRRVPLSPLSLPAGP
FT                   ADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLPTDQRLPPYPYSPPSLVIPTHPP
FT                   TPKSLQQLPSQACLVQPSGGQPPGRQPHYGALYPPGSSGHGQQPYHRPINDFSLGNLEQ
FT                   FNMESPSTSLVLDPPAFSEGPGFLGSEGSMSGPQDPHVLNHQNLTHCSRHGSGPNIILT
FT                   GDSSPGFSKEIAAALAGVPGFEVSASGLELGLGLEDELRMEPLGLEGLTMLSDPCALLP
FT                   DPAVEDSFRSDRLQ"
FT   CDS             join(25611242..25611297,25611374..25611492,
FT                   25612538..25612607,25613235..25613303,25613467..25613573,
FT                   25613664..25613693,25613814..25613908,25614035..25614084,
FT                   25614207..25614451,25615033..25615184,25617252..25617438,
FT                   25617561..25617781)
FT                   /codon_start=1
FT                   /gene="Crtc2"
FT                   /locus_tag="mCG_22212"
FT                   /product="CREB regulated transcription coactivator 2,
FT                   isoform CRA_b"
FT                   /note="gene_id=mCG22212.1 transcript_id=mCT21168.2
FT                   protein_id=mCP17274.2 isoform=CRA_b"
FT                   /protein_id="EDL15151.1"
FT                   /translation="MVVLCPMLTRLAVAWLSSRAPFTHLWIHLGALGTMGWWNGYNEMP
FT                   AEWCPHSADTPATFIYIDSSPYSPAYLSPPPESGWRRMMPWGNLPAEKGQLFRLPSALN
FT                   RTSSDSALHTSVMNPNPQDTYPGPTPPSVLPSRRGGGFLDGEMDAKALPSPVFLFQVPA
FT                   IEENVVDDKHLLKPWDAKKLSSSSSRPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGS
FT                   LPDLTNLHFPPPLPTPLDPEETVYPSLSGGNSTTNLTHTMTHLGISGGLGLGPSYDVPA
FT                   STPGASPRHRRVPLSPLSLPAGPADARRSQQQLPKQFSPTMSPTLSSITQLEQFNMESP
FT                   STSLVLDPPAFSEGPGFLGSEGSMSGPQDPHVLNHQNLTHCSRHGSGPNIILTGDSSPG
FT                   FSKEIAAALAGVPGFEVSASGLELGLGLEDELRMEPLGLEGLTMLSDPCALLPDPAVED
FT                   SFRSDRLQ"
FT   gene            <25621517..25634735
FT                   /gene="Dennd4b"
FT                   /locus_tag="mCG_22230"
FT                   /note="gene_id=mCG22230.3"
FT   mRNA            join(<25621517..25621833,25622324..25622576,
FT                   25623315..25623559,25624136..25624202,25624294..25624352,
FT                   25624528..25624672,25624934..25625085,25625215..25625339,
FT                   25625648..25625863,25626336..25626481,25626795..25626934,
FT                   25627017..25627143,25627884..25628090,25628369..25628497,
FT                   25629526..25629724,25630303..25630470,25630960..25631348,
FT                   25631501..25631623,25631815..25631984,25632068..25632209,
FT                   25632391..25632627,25633240..25633366,25633458..25633623,
FT                   25633700..25633764,25633857..25634735)
FT                   /gene="Dennd4b"
FT                   /locus_tag="mCG_22230"
FT                   /product="DENN/MADD domain containing 4B, transcript
FT                   variant mCT21186"
FT                   /note="gene_id=mCG22230.3 transcript_id=mCT21186.3 created
FT                   on 17-JUN-2003"
FT   CDS             join(25621517..25621833,25622324..25622576,
FT                   25623315..25623559,25624136..25624202,25624294..25624352,
FT                   25624528..25624672,25624934..25625085,25625215..25625339,
FT                   25625648..25625863,25626336..25626481,25626795..25626934,
FT                   25627017..25627143,25627884..25628090,25628369..25628497,
FT                   25629526..25629724,25630303..25630470,25630960..25631348,
FT                   25631501..25631623,25631815..25631984,25632068..25632209,
FT                   25632391..25632627,25633240..25633366,25633458..25633623,
FT                   25633700..25633764,25633857..25634002)
FT                   /codon_start=1
FT                   /gene="Dennd4b"
FT                   /locus_tag="mCG_22230"
FT                   /product="DENN/MADD domain containing 4B, isoform CRA_b"
FT                   /note="gene_id=mCG22230.3 transcript_id=mCT21186.3
FT                   protein_id=mCP17216.3 isoform=CRA_b"
FT                   /protein_id="EDL15149.1"
FT                   /translation="MAEERPPRLVDYFVVAGLAGNGAPIPEEKWVPEPTGPLRPPRPAE
FT                   PITDVAVIARALGEEVPQGYTCIQTSAGGHPLELSAGLLGGTQPVICYRRGRDKPPLVE
FT                   LGVLYEGKERPKLGFQVLDTTPYSHSANLAPPGPGHPRTYLMYRRAAEGAGLHALGITD
FT                   LCLVLPSKGEGTPHTYCRLPRNLNPGMVYGAALQFYEAFPRARLSERQARALGLMSAVE
FT                   RGRALGGRAVRSRRAIAVLSRWPAFPAFRAFLTFLYRYSVSGPHRLPLEAHISHFIHNV
FT                   PFPSPQRPRILVQMSPYDNLLLCQPVSSPLPLSGASFLQLLQNLGPELAITLLLAVLTE
FT                   HKLLVHSLRPDLLTSVCEALVSCPYIPLCPLVLADVLSAPVPFIVGIHSSYFDLHDPPA
FT                   DVICVDLDTNTLFQKEEKKPLSARTLPRRPYKLLLATLTSLYQQLDQSEKLVGLGAYTG
FT                   PEEEASLEFLLTDYEAVCGRRTRLEREVQGAFLRFMACLLKGYRNFLRPLTQAPSEGSR
FT                   DVDNLFYLQGFLKSRERSSHKLYSQLLHTQMFSQFIEECSFGSARHAALEFFDSCVDKV
FT                   HPEQEKPEPTPLVELEELSGSELTVFITPPEEPPVLEGSESTPQYCYDGFPELKAELFE
FT                   SPQEQQGALPVPGPSRSAPSSPAPRRTKQEMKVAQRMAQKSATVPELWARCLLGHCYGL
FT                   WFLCLPAYVRSVPSRVRALHTAYHVLREMENRKVVLPDEVCYRVLMQLCSHYGQPVLSV
FT                   RVMLEMRRAGIVPNTITYGYYNKAVLESKWPSGTPGGRLRWAKLRNVVLGAAQFRQPLK
FT                   DRRQQQQQQQQQQQQKQQVAEQQKSGSSQTEPYLERPSPTRPLQRQTTWAGRSLREPSS
FT                   PMGRLVKSGSLGSARGTQPTVEAGVAHMIEALGVLEPRGSPVPWQDGSLSDLSLTGEEM
FT                   APGGSPGGSGSALSAQSTEALEGISGRGSKTSGCQEEVGTPRKGLGARLQQLLTPSRRA
FT                   SASRIPPPELPSDLPPAARRSPMDSLLWPRERPGSTASESSASLGSEWDISESSLSSLS
FT                   LRRSSERLSDTPGAFQPPSLEILMSSCSLCHACDSLVYDEEIMAGWAPDDSNLNTTCPF
FT                   CACHFVPLLSVQTLDSRPSAPSPKSSLAGASGCKDAPAPGGPGPVLSDRRFCLALDQPQ
FT                   LCNGHMGSASRRVENGAWAYLSPLVLRKELESLVENEGSEVLALPELPAAHPIIFWNLL
FT                   WYFQRLRLPSVLPGLVLASCNGPPPSQLSQGPSPWLTPDPASVHVHLLWDVLTPDPNSC
FT                   PPLYVLWRVHSQIPQRVVWPGPVPSCLSLALLESVLRHVGLNEVHKAVGLLLETLGPPP
FT                   TGLHLQRGIYREILFLTMAALGKDHVDIVAFDKKYKSAFNKLASSMGKEELRQRRAQMP
FT                   TPKAIDCRKCFGAPLEC"
FT   mRNA            join(<25621542..25621833,25622324..25622576,
FT                   25622829..25622898,25623336..25623559,25624136..25624202,
FT                   25624294..25624352,25624528..25624672,25624910..25625085,
FT                   25625219..25625315,25625648..25625863,25626336..25626481,
FT                   25626795..25626934,25627017..25627143,25627884..25628090,
FT                   25628369..25628497,25629526..25629687,25630303..25630470,
FT                   25630960..25631348,25631501..25631623,25631815..25631984,
FT                   25632068..25632209,25632391..25632627,25633240..25633366,
FT                   25633458..25633623,25633700..25633764,25633857..25634062)
FT                   /gene="Dennd4b"
FT                   /locus_tag="mCG_22230"
FT                   /product="DENN/MADD domain containing 4B, transcript
FT                   variant mCT190924"
FT                   /note="gene_id=mCG22230.3 transcript_id=mCT190924.0 created
FT                   on 08-MAR-2004"
FT   CDS             join(<25628090..25628090,25628369..25628497,
FT                   25629526..25629687,25630303..25630470,25630960..25631348,
FT                   25631501..25631623,25631815..25631984,25632068..25632209,
FT                   25632391..25632627,25633240..25633366,25633458..25633623,
FT                   25633700..25633764,25633857..25634002)
FT                   /codon_start=1
FT                   /gene="Dennd4b"
FT                   /locus_tag="mCG_22230"
FT                   /product="DENN/MADD domain containing 4B, isoform CRA_a"
FT                   /note="gene_id=mCG22230.3 transcript_id=mCT190924.0
FT                   protein_id=mCP111910.0 isoform=CRA_a"
FT                   /protein_id="EDL15148.1"
FT                   /translation="GVLPRADAALLTLWAARSVCASHARDATGRHCAQHHHLRLLQQGS
FT                   AGKQMAIWYSGWTPTLGQAPECCPGGCSVPPALKGPKAATAAAAAAAAAEATEPYLERP
FT                   SPTRPLQRQTTWAGRSLREPSSPMGRLVKSGSLGSARGTQPTVEAGVAHMIEALGVLEP
FT                   RGSPVPWQDGSLSDLSLTGEEMAPGGSPGGSGSALSAQSTEALEGISGRGSKTSGCQEE
FT                   VGTPRKGLGARLQQLLTPSRRASASRIPPPELPSDLPPAARRSPMDSLLWPRERPGSTA
FT                   SESSASLGSEWDISESSLSSLSLRRSSERLSDTPGAFQPPSLEILMSSCSLCHACDSLV
FT                   YDEEIMAGWAPDDSNLNTTCPFCACHFVPLLSVQTLDSRPSAPSPKSSLAGASGCKDAP
FT                   APGGPGPVLSDRRFCLALDQPQLCNGHMGSASRRVENGAWAYLSPLVLRKELESLVENE
FT                   GSEVLALPELPAAHPIIFWNLLWYFQRLRLPSVLPGLVLASCNGPPPSQLSQGPSPWLT
FT                   PDPASVHVHLLWDVLTPDPNSCPPLYVLWRVHSQIPQRVVWPGPVPSCLSLALLESVLR
FT                   HVGLNEVHKAVGLLLETLGPPPTGLHLQRGIYREILFLTMAALGKDHVDIVAFDKKYKS
FT                   AFNKLASSMGKEELRQRRAQMPTPKAIDCRKCFGAPLEC"
FT   gene            25678131..25712260
FT                   /gene="Gatad2b"
FT                   /locus_tag="mCG_22250"
FT                   /note="gene_id=mCG22250.2"
FT   mRNA            join(25678131..25678163,25695603..25695949,
FT                   25702448..25702577,25703236..25703367,25705285..25705455,
FT                   25705695..25706010,25708189..25708391,25709556..25709666,
FT                   25710012..25710129,25711758..25712260)
FT                   /gene="Gatad2b"
FT                   /locus_tag="mCG_22250"
FT                   /product="GATA zinc finger domain containing 2B"
FT                   /note="gene_id=mCG22250.2 transcript_id=mCT21206.2 created
FT                   on 25-OCT-2002"
FT   CDS             join(25695612..25695949,25702448..25702577,
FT                   25703236..25703367,25705285..25705455,25705695..25706010,
FT                   25708189..25708391,25709556..25709666,25710012..25710129,
FT                   25711758..25711891)
FT                   /codon_start=1
FT                   /gene="Gatad2b"
FT                   /locus_tag="mCG_22250"
FT                   /product="GATA zinc finger domain containing 2B"
FT                   /note="gene_id=mCG22250.2 transcript_id=mCT21206.2
FT                   protein_id=mCP17220.2"
FT                   /protein_id="EDL15147.1"
FT                   /translation="MDRMTEDALRLNLLKRSLDPADERDDVLAKRLKMEGHEAMERLKM
FT                   LALLKRKDLANLEVPHELPTKQDGSGVKGYEEKLNGNLRPHGDNNRTAGRPGKENINDE
FT                   PVDMSARRSEPDRGRLTPSPDIIVLSDNEASSPRSSSRMEERLKAANLEMFKGKGMEER
FT                   QQLIKQLRDELRLEEARLVLLKKLRQSQLQKENVVQKGHSVIRSATNTTLPHMLMSQRV
FT                   IAPNPAQLQGQRGPPKPGIVRTTTPNMNPAISYQPQSSSSVPCQRTTSSAIYMNLASHI
FT                   QPGTVNRVSSPLPSPSAMSDAANSQAAAKLALRKQLEKTLLEIPPPKPPAPLLHFLPSA
FT                   ANSEFIYMVGLEEVVQSVIDSQGKNCASLLRVEPFVCAQCRTDFTPHWKQEKNGKILCE
FT                   QCMTSNQKKALKAEHTNRLKNAFVKALQQEQEIEQRLQQQAALSPTTAPAVSSVSKQET
FT                   IMRHHTLRQAPQPQSSLQRGIPTSARSMLSNFAQAPQLSVPGGLLGMPGVNIAYLNTGI
FT                   GGHKAPSLADRQREYLLDMIPPRSISQSISGQK"
FT   gene            complement(25738921..>25743627)
FT                   /locus_tag="mCG_22222"
FT                   /note="gene_id=mCG22222.2"
FT   mRNA            complement(join(25738921..25739222,25739939..25740069,
FT                   25740169..25740266,25740437..25740635,25740753..25740843,
FT                   25740944..25741138,25741325..25741449,25742017..25742175,
FT                   25742379..25742588,25742861..25743627))
FT                   /locus_tag="mCG_22222"
FT                   /product="mCG22222, transcript variant mCT21179"
FT                   /note="gene_id=mCG22222.2 transcript_id=mCT21179.2 created
FT                   on 23-SEP-2002"
FT   mRNA            complement(join(25738929..25739222,25739939..25740069,
FT                   25740169..25740266,25740437..25741138,25741325..25741449,
FT                   25742017..25742175,25742379..25742588,25742861..>25743627))
FT                   /locus_tag="mCG_22222"
FT                   /product="mCG22222, transcript variant mCT190964"
FT                   /note="gene_id=mCG22222.2 transcript_id=mCT190964.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25738930..25739222,25739939..25740069,
FT                   25740169..25740266,25740437..25740635,25740753..25740843,
FT                   25740944..25741138,25741325..25741449,25742017..25742175,
FT                   25742379..25742610,25742861..>25743355))
FT                   /locus_tag="mCG_22222"
FT                   /product="mCG22222, transcript variant mCT190963"
FT                   /note="gene_id=mCG22222.2 transcript_id=mCT190963.0 created
FT                   on 08-MAR-2004"
FT   CDS             complement(join(25739046..25739222,25739939..25740069,
FT                   25740169..25740266,25740437..25740635,25740753..25740843,
FT                   25740944..25741138,25741325..25741449,25742017..25742175,
FT                   25742379..25742588,25742861..25743479))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22222"
FT                   /product="mCG22222, isoform CRA_c"
FT                   /note="gene_id=mCG22222.2 transcript_id=mCT21179.2
FT                   protein_id=mCP17266.2 isoform=CRA_c"
FT                   /db_xref="GOA:G3X8Y7"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="MGI:MGI:1347358"
FT                   /db_xref="UniProtKB/TrEMBL:G3X8Y7"
FT                   /protein_id="EDL15146.1"
FT                   /translation="MAALLLLLPLLLLLPLLLKLDVWPQLRWLPADLAFTVRALRCKRA
FT                   LRARALAAAAADPESSESGCSLAWRLAYLAREQPTHTFLIHGAQRFSYAEAERESNRIA
FT                   RAFLRARGWTGGRRGSGRGSTEEGARVAPPAGDAAARGTTAPPLAPGATVALLLPAGPD
FT                   FLWIWFGLAKAGLRTAFVPTALRRGPLLHCLRSCGASALVLATEFLESLEPDLPALRAM
FT                   GLHLWATGPETNVAGISNLLSEAADQVDEPVPGYLSAPQNIMDTCLYIFTSGTTGLPKA
FT                   ARISHLKVLQCQGFYHLCGVHQEDVIYLALPLYHMSGSLLGIVGCLGIGATVVLKPKFS
FT                   ASQFWDDCQKHRVTVFQYIGELCRYLVNQPPSKAECDHKVRLAVGSGLRPDTWERFLRR
FT                   FGPLQILETYGMTEGNVATFNYTGRQGAVGRASWLYKHIFPFSLIRYDVMTGEPIRNAQ
FT                   GHCMTTSPGEPGLLVAPVSQQSPFLGYAGAPELAKDKLLKDVFWSGDVFFNTGDLLVCD
FT                   EQGFLHFHDRTGDTFRWKGENVATTEVAEVLETLDFLQEVNIYGVTVPGHEGRAGMAAL
FT                   ALRPPQALNLVQLYSHVSENLPPYARPRFLRLQESLATTETFKQQKVRMANEGFDPSVL
FT                   SDPLYVLDQDIGAYLPLTPARYSALLSGDLRI"
FT   CDS             complement(join(25739046..25739222,25739939..25740069,
FT                   25740169..25740266,25740437..25740635,25740753..25740843,
FT                   25740944..25741138,25741325..25741449,25742017..25742175,
FT                   25742379..25742610,25742861..>25743355))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22222"
FT                   /product="mCG22222, isoform CRA_a"
FT                   /note="gene_id=mCG22222.2 transcript_id=mCT190963.0
FT                   protein_id=mCP111902.0 isoform=CRA_a"
FT                   /protein_id="EDL15144.1"
FT                   /translation="AKGPFEHARWPQRPPTPKALRAGAVWPGVSRTWPGSSRHTPSSST
FT                   ARSALATRRLSARATGLLAPFCAHGAGPGAAEARAGAALRKAHAWRLRLEMRLLEGRPR
FT                   PLWHPGRPWRCSSQRARISFGFGSDWPKLACARPLCPPLYAEDPCCTASAAAVRVRSCW
FT                   PQLGLPTLVEFLESLEPDLPALRAMGLHLWATGPETNVAGISNLLSEAADQVDEPVPGY
FT                   LSAPQNIMDTCLYIFTSGTTGLPKAARISHLKVLQCQGFYHLCGVHQEDVIYLALPLYH
FT                   MSGSLLGIVGCLGIGATVVLKPKFSASQFWDDCQKHRVTVFQYIGELCRYLVNQPPSKA
FT                   ECDHKVRLAVGSGLRPDTWERFLRRFGPLQILETYGMTEGNVATFNYTGRQGAVGRASW
FT                   LYKHIFPFSLIRYDVMTGEPIRNAQGHCMTTSPGEPGLLVAPVSQQSPFLGYAGAPELA
FT                   KDKLLKDVFWSGDVFFNTGDLLVCDEQGFLHFHDRTGDTFRWKGENVATTEVAEVLETL
FT                   DFLQEVNIYGVTVPGHEGRAGMAALALRPPQALNLVQLYSHVSENLPPYARPRFLRLQE
FT                   SLATTETFKQQKVRMANEGFDPSVLSDPLYVLDQDIGAYLPLTPARYSALLSGDLRI"
FT   CDS             complement(join(25740665..25741138,25741325..25741449,
FT                   25742017..25742175,25742379..25742588,25742861..>25743626))
FT                   /codon_start=1
FT                   /locus_tag="mCG_22222"
FT                   /product="mCG22222, isoform CRA_b"
FT                   /note="gene_id=mCG22222.2 transcript_id=mCT190964.0
FT                   protein_id=mCP111903.0 isoform=CRA_b"
FT                   /protein_id="EDL15145.1"
FT                   /translation="GWEGRVPAHARHVPGKKGCPSRTKAGLVFQEGPPGVCVSCWDGLE
FT                   EKGTMAALLLLLPLLLLLPLLLKLDVWPQLRWLPADLAFTVRALRCKRALRARALAAAA
FT                   ADPESSESGCSLAWRLAYLAREQPTHTFLIHGAQRFSYAEAERESNRIARAFLRARGWT
FT                   GGRRGSGRGSTEEGARVAPPAGDAAARGTTAPPLAPGATVALLLPAGPDFLWIWFGLAK
FT                   AGLRTAFVPTALRRGPLLHCLRSCGASALVLATEFLESLEPDLPALRAMGLHLWATGPE
FT                   TNVAGISNLLSEAADQVDEPVPGYLSAPQNIMDTCLYIFTSGTTGLPKAARISHLKVLQ
FT                   CQGFYHLCGVHQEDVIYLALPLYHMSGSLLGIVGCLGIGATVVLKPKFSASQFWDDCQK
FT                   HRVTVFQYIGELCRYLVNQPPSKAECDHKVRLAVGSGLRPDTWERFLRRFGPLQILETY
FT                   GMTEGNVATFNYTGRQGAVGRASWLYKVRDRVDRRTPGAEGGMARAGAPGANDAVWLSL
FT                   PAHLPLLLDSIRCHDRGAYSECPGALHDHISRFVLGGVQSWQTRLNLAPEVGAEPRGSG
FT                   K"
FT   gene            complement(25745084..25787355)
FT                   /gene="Ints3"
FT                   /locus_tag="mCG_22238"
FT                   /note="gene_id=mCG22238.2"
FT   mRNA            complement(join(25745084..25745804,25745911..25746067,
FT                   25746227..25746299,25746490..25746590,25746795..25746962,
FT                   25747445..25747493,25747773..25747886,25748022..25748097,
FT                   25748837..25748905,25750077..25750230,25754003..25754122,
FT                   25754294..25754338,25754767..25754870,25755104..25755158,
FT                   25755542..25755671,25756007..25756126,25756778..25756884,
FT                   25757205..25757296,25757684..25757763,25758213..25758300,
FT                   25759873..25760064,25762199..25762296,25763695..25763824,
FT                   25764898..25765042,25767227..25767293,25768855..25768939,
FT                   25769190..25769303,25775495..25775578,25777760..25777843,
FT                   25786640..>25787007))
FT                   /gene="Ints3"
FT                   /locus_tag="mCG_22238"
FT                   /product="integrator complex subunit 3, transcript variant
FT                   mCT190938"
FT                   /note="gene_id=mCG22238.2 transcript_id=mCT190938.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25745087..25745610,25745692..25745804,
FT                   25745911..25746067,25746227..25746299,25746490..25746590,
FT                   25746795..25746962,25747445..25747493,25747773..25747886,
FT                   25748022..25748097,25748837..25748905,25750077..25750230,
FT                   25754003..25754122,25754294..25754338,25754767..25754870,
FT                   25755104..25755158,25755542..25755671,25756007..25756126,
FT                   25756778..25756884,25757205..25757296,25757684..25757763,
FT                   25758213..25758300,25759873..25760064,25762199..25762296,
FT                   25763695..25763824,25764898..25765042,25767227..25767293,
FT                   25768855..25768939,25769190..25769303,25775495..25775578,
FT                   25777760..25777843,25786640..>25787139))
FT                   /gene="Ints3"
FT                   /locus_tag="mCG_22238"
FT                   /product="integrator complex subunit 3, transcript variant
FT                   mCT190937"
FT                   /note="gene_id=mCG22238.2 transcript_id=mCT190937.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25745088..25745411,25745457..25745600,
FT                   25745911..25746067,25746227..25746299,25746490..25746590,
FT                   25746795..25746962,25747445..25747493,25747773..25747886,
FT                   25748022..25748097,25748837..25748905,25750077..25750230,
FT                   25754003..25754122,25754767..25754870,25755104..25755158,
FT                   25755542..25755671,25756007..25756189,25756778..25756884,
FT                   25757205..25757296,25757684..25757763,25758213..25758300,
FT                   25759873..25760064,25762199..25762296,25763695..25763824,
FT                   25764898..25765042,25767227..25767293,25768855..25768939,
FT                   25769190..25769303,25775495..25775578,25777760..25777843,
FT                   25786640..25787355))
FT                   /gene="Ints3"
FT                   /locus_tag="mCG_22238"
FT                   /product="integrator complex subunit 3, transcript variant
FT                   mCT21195"
FT                   /note="gene_id=mCG22238.2 transcript_id=mCT21195.1 created
FT                   on 24-OCT-2002"
FT   CDS             complement(join(25745121..25745411,25745457..25745600,
FT                   25745911..25746067,25746227..25746299,25746490..25746590,
FT                   25746795..25746962,25747445..25747493,25747773..25747886,
FT                   25748022..25748097,25748837..25748905,25750077..25750230,
FT                   25754003..25754122,25754767..25754870,25755104..25755158,
FT                   25755542..25755671,25756007..25756189,25756778..25756884,
FT                   25757205..25757296,25757684..25757763,25758213..25758300,
FT                   25759873..25760064,25762199..25762296,25763695..25763824,
FT                   25764898..25765042,25767227..25767293,25768855..25768939,
FT                   25769190..25769303,25775495..25775578,25777760..25777843,
FT                   25786640..25786786))
FT                   /codon_start=1
FT                   /gene="Ints3"
FT                   /locus_tag="mCG_22238"
FT                   /product="integrator complex subunit 3, isoform CRA_b"
FT                   /note="gene_id=mCG22238.2 transcript_id=mCT21195.1
FT                   protein_id=mCP17211.2 isoform=CRA_b"
FT                   /protein_id="EDL15143.1"
FT                   /translation="MELQKGKGTVAAAASGAAGGGGGGAGAGAPGGGRLLLSTSLDAKD
FT                   ELEERLERCMSIVTSMTAGVSEREANDALNAYVCKGPPQHEEICLGLFTLVLTEPAQAQ
FT                   KCYRDLALVSRDGMNIVLNKINQLLMEKYLKLQDTCRTQLVWLVRELVKSGVLGADGVC
FT                   MTFMKQIAGGDVTAKNIWLAESVLDILTEQREWVLKSSILIAMAVYTYLRLIVDHHGTA
FT                   QLQTLRQKEVDFCISLLRERFMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALS
FT                   PQFTGILQLLQSRTSRKFLACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPD
FT                   SQSLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWL
FT                   FFSPEKDSIMNIEPAILVMHHSMKPHPAITATLLDFMCRIIPNFYPPLEGHVRQGVFSS
FT                   LNHIVEKRVLAHLAPLFDNPKLDKELRSMLREKFPEFCSSPSPPVEEALSILGNPGGYQ
FT                   ESFFLYSQVKIEEPVSMEMDNHLSDKDESCYDNAEAAFSDDEEDLNSKGKKREFRFHPI
FT                   KETVVEEPVDVTPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQEIVDQVLEEDFDSEQL
FT                   SVLASCLQELFKAHFRGEVLPEEVTEENLCQMQEDNSSFSLLLDLLSELYQKQPKIGYH
FT                   LLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLCHLTPSIYTE
FT                   FPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQ
FT                   YCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPCH
FT                   PDDQFTTSILRHWCMKHDELLAEHIKALLIKNNSLPRKRQSLRSSSSKLAQLTLEQILE
FT                   HLDNLRLNLANTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPP
FT                   KSRRKAALSSPRSRKNATQPPNAEEESGSSSASQPEAVQKQIMVEVLCRRLLPKSPKSH
FT                   LDRERSDEEAAGQRSWGDSRCCSVDGGHYTSVKWASDLVWAVPIWADATAFRKEPNGSV
FT                   RGSCCTWDAWVGPALALQAEPEPRGVLEASSSELSDGLIFCGSVFAFSFGKDNRVLNCF
FT                   "
FT   CDS             complement(join(25745727..25745804,25745911..25746067,
FT                   25746227..25746299,25746490..25746590,25746795..25746962,
FT                   25747445..25747493,25747773..25747886,25748022..25748097,
FT                   25748837..25748905,25750077..25750230,25754003..25754122,
FT                   25754294..25754338,25754767..25754870,25755104..25755158,
FT                   25755542..25755671,25756007..25756126,25756778..25756884,
FT                   25757205..25757296,25757684..25757763,25758213..25758300,
FT                   25759873..25760064,25762199..25762296,25763695..25763824,
FT                   25764898..25765042,25767227..25767293,25768855..25768939,
FT                   25769190..25769303,25775495..25775578,25777760..25777843,
FT                   25786640..>25786831))
FT                   /codon_start=1
FT                   /gene="Ints3"
FT                   /locus_tag="mCG_22238"
FT                   /product="integrator complex subunit 3, isoform CRA_a"
FT                   /note="gene_id=mCG22238.2 transcript_id=mCT190937.0
FT                   protein_id=mCP111915.0 isoform=CRA_a"
FT                   /protein_id="EDL15141.1"
FT                   /translation="HPSTPLTSSGLLAAAMELQKGKGTVAAAASGAAGGGGGGAGAGAP
FT                   GGGRLLLSTSLDAKDELEERLERCMSIVTSMTAGVSEREANDALNAYVCKGPPQHEEIC
FT                   LGLFTLVLTEPAQAQKCYRDLALVSRDGMNIVLNKINQLLMEKYLKLQDTCRTQLVWLV
FT                   RELVKSGVLGADGVCMTFMKQIAGGDVTAKNIWLAESVLDILTEQREWVLKSSILIAMA
FT                   VYTYLRLIVDHHGTAQLQTLRQKEVDFCISLLRERFMECLMIGRDLVRLLQNVARIPEF
FT                   ELLWKDIIHNPQALSPQFTGILQLLQSRTSRKFLACRLTPDMETKLLFMTSRVRFGQQK
FT                   RYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSN
FT                   VAASNAKLALFYDWLFFSPEKDSIMNIEPAILVMHHSMKPHPAITATLLDFMCRIIPNF
FT                   YPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNPKLDKELRSMLREKFPEFCSSPSPP
FT                   VEVKIEEPVSMEMDNHLSDKDESCYDNAEAAFSDDEEDLNSKGKKREFRFHPIKETVVE
FT                   EPVDVTPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQEIVDQVLEEDFDSEQLSVLASC
FT                   LQELFKAHFRGEVLPEEVTEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELY
FT                   QKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLC
FT                   HLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQ
FT                   SLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMV
FT                   KMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKALLIKNNSLPRKRQSLRSSSSKLA
FT                   QLTLEQILEHLDNLRLNLANTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEE
FT                   YEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGS
FT                   SAVGSDSD"
FT   CDS             complement(join(25745727..25745804,25745911..25746067,
FT                   25746227..25746299,25746490..25746590,25746795..25746962,
FT                   25747445..25747493,25747773..25747886,25748022..25748097,
FT                   25748837..25748905,25750077..25750230,25754003..25754122,
FT                   25754294..25754338,25754767..25754870,25755104..25755158,
FT                   25755542..25755671,25756007..25756126,25756778..25756884,
FT                   25757205..25757296,25757684..25757763,25758213..25758300,
FT                   25759873..25760064,25762199..25762296,25763695..25763824,
FT                   25764898..25765042,25767227..25767293,25768855..25768939,
FT                   25769190..25769303,25775495..25775578,25777760..25777843,
FT                   25786640..>25786831))
FT                   /codon_start=1
FT                   /gene="Ints3"
FT                   /locus_tag="mCG_22238"
FT                   /product="integrator complex subunit 3, isoform CRA_a"
FT                   /note="gene_id=mCG22238.2 transcript_id=mCT190938.0
FT                   protein_id=mCP111916.0 isoform=CRA_a"
FT                   /protein_id="EDL15142.1"
FT                   /translation="HPSTPLTSSGLLAAAMELQKGKGTVAAAASGAAGGGGGGAGAGAP
FT                   GGGRLLLSTSLDAKDELEERLERCMSIVTSMTAGVSEREANDALNAYVCKGPPQHEEIC
FT                   LGLFTLVLTEPAQAQKCYRDLALVSRDGMNIVLNKINQLLMEKYLKLQDTCRTQLVWLV
FT                   RELVKSGVLGADGVCMTFMKQIAGGDVTAKNIWLAESVLDILTEQREWVLKSSILIAMA
FT                   VYTYLRLIVDHHGTAQLQTLRQKEVDFCISLLRERFMECLMIGRDLVRLLQNVARIPEF
FT                   ELLWKDIIHNPQALSPQFTGILQLLQSRTSRKFLACRLTPDMETKLLFMTSRVRFGQQK
FT                   RYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHPSNEVLSSDILPRWAIIGWLLTTCTSN
FT                   VAASNAKLALFYDWLFFSPEKDSIMNIEPAILVMHHSMKPHPAITATLLDFMCRIIPNF
FT                   YPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNPKLDKELRSMLREKFPEFCSSPSPP
FT                   VEVKIEEPVSMEMDNHLSDKDESCYDNAEAAFSDDEEDLNSKGKKREFRFHPIKETVVE
FT                   EPVDVTPYLDQLDESLRDKVLQLQKGSDTEAQCEVMQEIVDQVLEEDFDSEQLSVLASC
FT                   LQELFKAHFRGEVLPEEVTEESLEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELY
FT                   QKQPKIGYHLLYYLRASKAAAGKMNLYESFAQATQLGDLHTCLMMDMKACQEDDVRLLC
FT                   HLTPSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQ
FT                   SLDWETFEQYCAWQLFLAHNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMV
FT                   KMVLSRPCHPDDQFTTSILRHWCMKHDELLAEHIKALLIKNNSLPRKRQSLRSSSSKLA
FT                   QLTLEQILEHLDNLRLNLANTKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEE
FT                   YEDSSTKPPKSRRKAALSSPRSRKNATQPPNAEEESGSSSASEEEDTKPKPTKRKRKGS
FT                   SAVGSDSD"
FT   gene            complement(25804954..25820352)
FT                   /gene="Npr1"
FT                   /locus_tag="mCG_22234"
FT                   /note="gene_id=mCG22234.2"
FT   mRNA            complement(join(25804954..25805040,25805164..25805255,
FT                   25808678..25808776,25808952..25809126,25809720..25809788,
FT                   25809915..25810038,25810182..25810328,25810928..25811096,
FT                   25811340..25811495,25812091..25812247,25812341..25812412,
FT                   25812651..25812755,25813064..25813141,25813342..25813416,
FT                   25813952..25814072,25815109..25815193,25815384..25815519,
FT                   25816185..25816276,25816587..25816722,25817154..25817267,
FT                   25817830..25818029,25818815..25819783,25820264..25820352))
FT                   /gene="Npr1"
FT                   /locus_tag="mCG_22234"
FT                   /product="natriuretic peptide receptor 1"
FT                   /note="gene_id=mCG22234.2 transcript_id=mCT21191.2 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(25804978..25805040,25805164..25805255,
FT                   25808678..25808776,25808952..25809126,25809720..25809788,
FT                   25809915..25810038,25810182..25810328,25810928..25811096,
FT                   25811340..25811495,25812091..25812247,25812341..25812412,
FT                   25812651..25812755,25813064..25813141,25813342..25813416,
FT                   25813952..25814072,25815109..25815193,25815384..25815519,
FT                   25816185..25816276,25816587..25816722,25817154..25817267,
FT                   25817830..25818029,25818815..25819523))
FT                   /codon_start=1
FT                   /gene="Npr1"
FT                   /locus_tag="mCG_22234"
FT                   /product="natriuretic peptide receptor 1"
FT                   /note="gene_id=mCG22234.2 transcript_id=mCT21191.2
FT                   protein_id=mCP17269.1"
FT                   /db_xref="GOA:Q2TAY4"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR001170"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR001828"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018297"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="MGI:MGI:97371"
FT                   /db_xref="UniProtKB/TrEMBL:Q2TAY4"
FT                   /protein_id="EDL15140.1"
FT                   /translation="MPGSRRVRPRLRALLLLPPLLLLRSGHASDLTVAVVLPLTNTSYP
FT                   WSWARVGPAVELALGRVKARPDLLPGWTVRMVLGSSENAAGVCSDTAAPLAAVDLKWEH
FT                   SPAVFLGPGCVYSAAPVGRFTAHWRVPLLTAGAPALGIGVKDEYALTTRTGPSHVKLGD
FT                   FVTALHRRLGWEHQALVLYADRLGDDRPCFFIVEGLYMRVRERLNITVNHQEFVEGDPD
FT                   HYTKLLRTVQRKGRVIYICSSPDAFRNLMLLALDAGLTGEDYVFFHLDVFGQSLQGAQG
FT                   PVPRKPWERDDGQDRRARQAFQAAKIITYKEPDNPEYLEFLKQLKLLADKKFNFTMEDG
FT                   LKNIIPASFHDGLLLYVQAVTETLAQGGTVTDGENITQRMWNRSFQGVTGYLKIDRNGD
FT                   RDTDFSLWDMDPETGAFRVVLNFNGTSQELMAVSEHRLYWPLGYPPPDIPKCGFDNEDP
FT                   ACNQDHFSTLEVLALVGSLSLVSFLIVSFFIYRKMQLEKELVSELWRVRWEDLQPSSLE
FT                   RHLRSAGSRLTLSGRGSNYGSLLTTEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRKV
FT                   LFELKHMRDVQNEHLTRFVGACTDPPNICILTEYCPRGSLQDILENESITLDWMFRYSL
FT                   TNDIVKGMLFLHNGAIGSHGNLKSSNCVVDGRFVLKITDYGLESFRDPEPEQGHTLFAK
FT                   KLWTAPELLRMASPPARGSQAGDVYSFGIILQEIALRSGVFYVEGLDLSPKEIIERVTR
FT                   GEQPPFRPSMDLQSHLEELGQLMQRCWAEDPQERPPFQQIRLALRKFNKENSSNILDNL
FT                   LSRMEQYANNLEELVEERTQAYLEEKRKAEALLYQILPHSVAEQLKRGETVQAEAFDSV
FT                   TIYFSDIVGFTALSAESTPMQVVTLLNDLYTCFDAVIDNFDVYKVETIGDAYMVVSGLP
FT                   VRNGQLHAREVARMALALLDAVRSFRIRHRPQEQLRLRIGIHTGPVCAGVVGLKMPRYC
FT                   LFGDTVNTASRMESNGEALRIHLSSETKAVLEEFDGFELELRGDVEMKGKGKVRTYWLL
FT                   GERGCSTRG"
FT   gene            25830363..25841896
FT                   /gene="Ilf2"
FT                   /locus_tag="mCG_121102"
FT                   /note="gene_id=mCG121102.0"
FT   mRNA            join(25830363..25830452,25831212..25831271,
FT                   25831527..25831569,25834811..25834915,25835200..25835277,
FT                   25835571..25835673,25836954..25837019,25838619..25838735,
FT                   25839855..25839933,25840350..25840437,25841016..25841077,
FT                   25841148..25841262,25841392..25841482,25841624..25841896)
FT                   /gene="Ilf2"
FT                   /locus_tag="mCG_121102"
FT                   /product="interleukin enhancer binding factor 2"
FT                   /note="gene_id=mCG121102.0 transcript_id=mCT122298.0
FT                   created on 01-AUG-2002"
FT   CDS             join(25830448..25830452,25831212..25831271,
FT                   25831527..25831569,25834811..25834915,25835200..25835277,
FT                   25835571..25835673,25836954..25837019,25838619..25838735,
FT                   25839855..25839933,25840350..25840437,25841016..25841077,
FT                   25841148..25841262,25841392..25841482,25841624..25841784)
FT                   /codon_start=1
FT                   /gene="Ilf2"
FT                   /locus_tag="mCG_121102"
FT                   /product="interleukin enhancer binding factor 2"
FT                   /note="gene_id=mCG121102.0 transcript_id=mCT122298.0
FT                   protein_id=mCP65665.1"
FT                   /protein_id="EDL15139.1"
FT                   /translation="MRGDRGRGRGGRFGSRGGPGGGFRPFVPHIPFDFYLCEMAFPRVK
FT                   PAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQ
FT                   VGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETG
FT                   FEISSSDATVKILITTVPPNLRKLDPELHLDIKVLQSALAAIRHARWFEENASQSTVKV
FT                   LIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFL
FT                   PGSVGITDPCESGNFRVHTVMTLEQQDMVCYTAQTLVRILSHGGFRKILGQEGDASYLA
FT                   SEISTWDGVIVTPSEKAYEKPPEKKEGEEEEENTEEPPQGEEEESMETQE"
FT   gene            complement(25842535..>25845180)
FT                   /gene="Snapap"
FT                   /locus_tag="mCG_22237"
FT                   /note="gene_id=mCG22237.3"
FT   mRNA            complement(join(25842535..25843757,25844318..25844436,
FT                   25844996..>25845158))
FT                   /gene="Snapap"
FT                   /locus_tag="mCG_22237"
FT                   /product="SNAP-associated protein, transcript variant
FT                   mCT190936"
FT                   /note="gene_id=mCG22237.3 transcript_id=mCT190936.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25842538..25843757,25844318..25844436,
FT                   25844712..25844758,25845001..>25845180))
FT                   /gene="Snapap"
FT                   /locus_tag="mCG_22237"
FT                   /product="SNAP-associated protein, transcript variant
FT                   mCT190935"
FT                   /note="gene_id=mCG22237.3 transcript_id=mCT190935.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25842544..25843757,25844318..25844436,
FT                   25844712..25844758,25844996..>25845138))
FT                   /gene="Snapap"
FT                   /locus_tag="mCG_22237"
FT                   /product="SNAP-associated protein, transcript variant
FT                   mCT21193"
FT                   /note="gene_id=mCG22237.3 transcript_id=mCT21193.1 created
FT                   on 07-AUG-2002"
FT   CDS             complement(join(25843656..25843757,25844318..25844436,
FT                   25844712..25844758,25845001..>25845158))
FT                   /codon_start=1
FT                   /gene="Snapap"
FT                   /locus_tag="mCG_22237"
FT                   /product="SNAP-associated protein, isoform CRA_a"
FT                   /note="gene_id=mCG22237.3 transcript_id=mCT190935.0
FT                   protein_id=mCP111913.0 isoform=CRA_a"
FT                   /protein_id="EDL15136.1"
FT                   /translation="GRQGSSRWPRLVPLLCQGPGPQWRGPQAATSLPRGSWSSCDPRCS
FT                   SSTLTCTRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNIL
FT                   QNAQERLRRLNHSVAKETARRRAMLDSGVYPPGSPSK"
FT   CDS             complement(join(25843656..25843757,25844318..25844436,
FT                   25844996..>25845158))
FT                   /codon_start=1
FT                   /gene="Snapap"
FT                   /locus_tag="mCG_22237"
FT                   /product="SNAP-associated protein, isoform CRA_b"
FT                   /note="gene_id=mCG22237.3 transcript_id=mCT190936.0
FT                   protein_id=mCP111914.0 isoform=CRA_b"
FT                   /protein_id="EDL15137.1"
FT                   /translation="GRQGSSRWPRLVPLLCQGPGPQWRGPQAATSLPRGSWSSCDPRCS
FT                   SSTLTCTRSELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQERLRRLNHSV
FT                   AKETARRRAMLDSGVYPPGSPSK"
FT   CDS             complement(join(25843656..25843757,25844318..25844436,
FT                   25844712..25844758,25844996..25845138))
FT                   /codon_start=1
FT                   /gene="Snapap"
FT                   /locus_tag="mCG_22237"
FT                   /product="SNAP-associated protein, isoform CRA_c"
FT                   /note="gene_id=mCG22237.3 transcript_id=mCT21193.1
FT                   protein_id=mCP17229.1 isoform=CRA_c"
FT                   /protein_id="EDL15138.1"
FT                   /translation="MAAAGSAAVSGAGTPVAGPTGRDLFAEGLLEFLRPAVQQLDSHVH
FT                   AVRESQVELREQIDNLATELCRINEDQKVALDLDPYVKKLLNARRRVVLVNNILQNAQE
FT                   RLRRLNHSVAKETARRRAMLDSGVYPPGSPSK"
FT   gene            complement(25853122..>25863652)
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /note="gene_id=mCG22235.3"
FT   mRNA            complement(join(25853122..25854271,25857260..25857443,
FT                   25860272..25860425,25861709..25861790,25863355..25863627))
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, transcript variant
FT                   mCT181543"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181543.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25853122..25854271,25856280..25856417,
FT                   25857260..25857446,25860272..25861422,25861709..25861790,
FT                   25863355..>25863616))
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, transcript variant
FT                   mCT190932"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT190932.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25853122..25854271,25857260..25857446,
FT                   25860272..25861790,25863355..25863614))
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, transcript variant
FT                   mCT21192"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT21192.1 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25853122..25854271,25856280..25856417,
FT                   25857260..25857446,25860272..25861790,25863355..25863609))
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, transcript variant
FT                   mCT181544"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181544.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25853859..25854271,25857260..25857443,
FT                   25860272..25861790,25863355..>25863652))
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, transcript variant
FT                   mCT190933"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT190933.0 created
FT                   on 08-MAR-2004"
FT   mRNA            complement(join(25853860..25854271,25856280..25856417,
FT                   25857260..25857446,25860272..25860425,25861709..25861790,
FT                   25863355..25863646))
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, transcript variant
FT                   mCT181542"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181542.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(25854066..25854271,25857260..25857443,
FT                   25860272..25860425,25861709..25861773))
FT                   /codon_start=1
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, isoform CRA_b"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181543.0
FT                   protein_id=mCP104466.0 isoform=CRA_b"
FT                   /protein_id="EDL15129.1"
FT                   /translation="MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQ
FT                   QLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRG
FT                   LPIIQRGLPRGGLRGGRATRTLLRGGMSLRGRGMIGRGRGGFGGRGRGRGRGRGALTRP
FT                   VLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND"
FT   CDS             complement(join(25854066..25854271,25856280..25856417,
FT                   25857260..25857446,25860272..25860425,25861709..25861773))
FT                   /codon_start=1
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, isoform CRA_a"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181542.0
FT                   protein_id=mCP104464.0 isoform=CRA_a"
FT                   /protein_id="EDL15128.1"
FT                   /translation="MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQ
FT                   QLASARNRRLAQQMENRPSVQAALKLKQKSLKQRLGKSNIQARLGRPIGALARGAIGGR
FT                   GLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGP
FT                   GRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLD
FT                   AYMSKTKGHLDAELDAYMAQTDPETND"
FT   CDS             complement(join(25854066..25854271,25857260..25857443,
FT                   25860272..>25860427))
FT                   /codon_start=1
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, isoform CRA_g"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT190933.0
FT                   protein_id=mCP111912.0 isoform=CRA_g"
FT                   /protein_id="EDL15134.1"
FT                   /translation="SFTNMLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQ
FT                   AALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRT
FT                   LLRGGMSLRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGH
FT                   LDAELDAYMAQTDPETND"
FT   CDS             complement(join(25854066..25854271,25856280..25856417,
FT                   25857260..25857446,25860272..>25860427))
FT                   /codon_start=1
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, isoform CRA_f"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT190932.0
FT                   protein_id=mCP111911.0 isoform=CRA_f"
FT                   /protein_id="EDL15133.1"
FT                   /translation="SFTNMLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQ
FT                   AALKLKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATR
FT                   TLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRG
FT                   MIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQT
FT                   DPETND"
FT   CDS             complement(join(25854066..25854271,25857260..25857446,
FT                   25860272..25860415))
FT                   /codon_start=1
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, isoform CRA_h"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT21192.1
FT                   protein_id=mCP17284.1 isoform=CRA_h"
FT                   /db_xref="InterPro:IPR025715"
FT                   /db_xref="MGI:MGI:1913761"
FT                   /db_xref="UniProtKB/TrEMBL:B7ZMS6"
FT                   /protein_id="EDL15135.1"
FT                   /translation="MLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALK
FT                   LKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLR
FT                   GGMSLRGRGMIGRGRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDA
FT                   ELDAYMAQTDPETND"
FT   CDS             complement(join(25854066..25854271,25856280..25856417,
FT                   25857260..25857446,25860272..25860415))
FT                   /codon_start=1
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, isoform CRA_c"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181544.0
FT                   protein_id=mCP104468.0 isoform=CRA_c"
FT                   /db_xref="GOA:Q9CY57"
FT                   /db_xref="InterPro:IPR025715"
FT                   /db_xref="MGI:MGI:1913761"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9CY57"
FT                   /protein_id="EDL15130.1"
FT                   /translation="MLKNKQPMPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALK
FT                   LKQKSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLR
FT                   GGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGR
FT                   GRGGFGGRGRGRGRGRGALTRPVLTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPET
FT                   ND"
FT   mRNA            complement(join(<25854198..25854271,25856280..25856417,
FT                   25857260..25857443,25860272..25860425,25861709..25861790,
FT                   25863355..25863432))
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, transcript variant
FT                   mCT181545"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181545.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(<25854198..25854271,25856280..25856417,
FT                   25857260..25857443,25860272..25860425,25861709..25861773))
FT                   /codon_start=1
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, isoform CRA_d"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181545.0
FT                   protein_id=mCP104465.0 isoform=CRA_d"
FT                   /protein_id="EDL15131.1"
FT                   /translation="MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQ
FT                   QLASARNRRLAQQMENRPSVQAALKLKQSLKQRLGKSNIQARLGRPIGALARGAIGGRG
FT                   LPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLRGGRAVAPRMGLRRGGVRGRGGPG
FT                   RGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGA"
FT   mRNA            complement(join(<25856331..25856417,25857260..25857446,
FT                   25859559..25859642,25860272..25860425,25861709..25861790,
FT                   25863355..25863640))
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, transcript variant
FT                   mCT181546"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181546.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(<25856331..25856417,25857260..25857446,
FT                   25859559..25859642,25860272..25860425,25861709..25861773))
FT                   /codon_start=1
FT                   /gene="2500003M10Rik"
FT                   /locus_tag="mCG_22235"
FT                   /product="RIKEN cDNA 2500003M10, isoform CRA_e"
FT                   /note="gene_id=mCG22235.3 transcript_id=mCT181546.0
FT                   protein_id=mCP104467.0 isoform=CRA_e"
FT                   /protein_id="EDL15132.1"
FT                   /translation="MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPMPVNIRASMQQQQ
FT                   QLASARNRRLAQQMENRPSVQAALKLKQTLYASPESGCGRICPSCGWASRGRCHATKSL
FT                   KQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLR
FT                   GQNLLRGGRAVAPRMGLRRGGVRGRGGPG"
FT   gene            complement(25865196..25868550)
FT                   /gene="S100a1"
FT                   /locus_tag="mCG_68132"
FT                   /note="gene_id=mCG68132.2"
FT   mRNA            complement(join(25865196..25865522,25866154..25866307,
FT                   25868359..25868550))
FT                   /gene="S100a1"
FT                   /locus_tag="mCG_68132"
FT                   /product="S100 calcium binding protein A1, transcript
FT                   variant mCT68318"
FT                   /note="gene_id=mCG68132.2 transcript_id=mCT68318.2 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25865196..25865522,25866137..25866307,
FT                   25868359..25868540))
FT                   /gene="S100a1"
FT                   /locus_tag="mCG_68132"
FT                   /product="S100 calcium binding protein A1, transcript
FT                   variant mCT181561"
FT                   /note="gene_id=mCG68132.2 transcript_id=mCT181561.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(25865196..25865522,25868359..25868518))
FT                   /gene="S100a1"
FT                   /locus_tag="mCG_68132"
FT                   /product="S100 calcium binding protein A1, transcript
FT                   variant mCT181562"
FT                   /note="gene_id=mCG68132.2 transcript_id=mCT181562.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(25865379..25865522,25866154..25866294))
FT                   /codon_start=1
FT                   /gene="S100a1"
FT                   /locus_tag="mCG_68132"
FT                   /product="S100 calcium binding protein A1, isoform CRA_c"
FT                   /note="gene_id=mCG68132.2 transcript_id=mCT68318.2
FT                   protein_id=mCP43361.2 isoform=CRA_c"
FT                   /db_xref="GOA:Q91V77"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028486"
FT                   /db_xref="MGI:MGI:1338917"
FT                   /db_xref="UniProtKB/TrEMBL:Q91V77"
FT                   /protein_id="EDL15127.1"
FT                   /translation="MGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGF
FT                   LDVQKDADAVDKVMKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS"
FT   CDS             complement(25865379..25865489)
FT                   /codon_start=1
FT                   /gene="S100a1"
FT                   /locus_tag="mCG_68132"
FT                   /product="S100 calcium binding protein A1, isoform CRA_b"
FT                   /note="gene_id=mCG68132.2 transcript_id=mCT181562.0
FT                   protein_id=mCP104483.0 isoform=CRA_b"
FT                   /protein_id="EDL15126.1"
FT                   /translation="MKELDENGDGEVDFKEYVVLVAALTVACNNFFWETS"
FT   CDS             complement(join(25865489..25865522,25866137..25866294))
FT                   /codon_start=1
FT                   /gene="S100a1"
FT                   /locus_tag="mCG_68132"
FT                   /product="S100 calcium binding protein A1, isoform CRA_a"
FT                   /note="gene_id=mCG68132.2 transcript_id=mCT181561.0
FT                   protein_id=mCP104484.0 isoform=CRA_a"
FT                   /db_xref="GOA:D3YUT6"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR028486"
FT                   /db_xref="MGI:MGI:1338917"
FT                   /db_xref="UniProtKB/TrEMBL:D3YUT6"
FT                   /protein_id="EDL15125.1"
FT                   /translation="MGSELESAMETLINVFHAHSGKEGDKYKLSKKELKDLLQTELSGF
FT                   LDVSTGLRSRRMQMLWTR"
FT   gene            25868596..25879442
FT                   /gene="S100a13"
FT                   /locus_tag="mCG_22233"
FT                   /note="gene_id=mCG22233.2"
FT   mRNA            join(25868596..25868623,25868916..25869177,
FT                   25870008..25870200,25879216..25879442)
FT                   /gene="S100a13"
FT                   /locus_tag="mCG_22233"
FT                   /product="S100 calcium binding protein A13"
FT                   /note="gene_id=mCG22233.2 transcript_id=mCT21189.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(25870048..25870200,25879216..25879359)
FT                   /codon_start=1
FT                   /gene="S100a13"
FT                   /locus_tag="mCG_22233"
FT                   /product="S100 calcium binding protein A13"
FT                   /note="gene_id=mCG22233.2 transcript_id=mCT21189.1
FT                   protein_id=mCP17267.1"
FT                   /db_xref="GOA:Q545H7"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR028487"
FT                   /db_xref="MGI:MGI:109581"
FT                   /db_xref="UniProtKB/TrEMBL:Q545H7"
FT                   /protein_id="EDL15124.1"
FT                   /translation="MAAETLTELEAAIETVVSTFFTFAGREGRKGSLNINEFKELATQQ
FT                   LPHLLKDVGSLDEKMKTLDVNQDSELRFSEYWRLIGELAKEVRKEKALGIRKK"
FT   gene            25881731..25883696
FT                   /gene="S100a14"
FT                   /locus_tag="mCG_22224"
FT                   /note="gene_id=mCG22224.1"
FT   mRNA            join(25881731..25881762,25882035..25882156,
FT                   25882577..25882723,25882941..25883696)
FT                   /gene="S100a14"
FT                   /locus_tag="mCG_22224"
FT                   /product="S100 calcium binding protein A14"
FT                   /note="gene_id=mCG22224.1 transcript_id=mCT21178.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(25882127..25882156,25882577..25882723,
FT                   25882941..25883078)
FT                   /codon_start=1
FT                   /gene="S100a14"
FT                   /locus_tag="mCG_22224"
FT                   /product="S100 calcium binding protein A14"
FT                   /note="gene_id=mCG22224.1 transcript_id=mCT21178.1
FT                   protein_id=mCP17264.2"
FT                   /protein_id="EDL15123.1"
FT                   /translation="MGQCRSANAEDAQEFSDVERAIETLIKNFHKYSVAGKKETLTPAE
FT                   LRDLVTQQLPHLMPSNCGLEEKIANLGNCNDSKLEFGSFWELIGEAAKSVKMERPVTRS
FT                   "
FT   gene            25892184..25898015
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /note="gene_id=mCG22247.1"
FT   mRNA            join(25892184..25892280,25896856..25897034,
FT                   25897227..25898015)
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /product="S100 calcium binding protein A16, transcript
FT                   variant mCT21203"
FT                   /note="gene_id=mCG22247.1 transcript_id=mCT21203.1 created
FT                   on 14-NOV-2002"
FT   mRNA            join(25893750..25893884,25896856..25897034,
FT                   25897227..25898014)
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /product="S100 calcium binding protein A16, transcript
FT                   variant mCT175869"
FT                   /note="gene_id=mCG22247.1 transcript_id=mCT175869.0 created
FT                   on 14-NOV-2002"
FT   mRNA            join(25894150..25894327,25896856..25897034,
FT                   25897227..25898014)
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /product="S100 calcium binding protein A16, transcript
FT                   variant mCT174887"
FT                   /note="gene_id=mCG22247.1 transcript_id=mCT174887.0 created
FT                   on 14-NOV-2002"
FT   mRNA            join(25896115..25896179,25896856..25897034,
FT                   25897227..25898014)
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /product="S100 calcium binding protein A16, transcript
FT                   variant mCT175870"
FT                   /note="gene_id=mCG22247.1 transcript_id=mCT175870.0 created
FT                   on 14-NOV-2002"
FT   CDS             join(25896882..25897034,25897227..25897448)
FT                   /codon_start=1
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /product="S100 calcium binding protein A16, isoform CRA_a"
FT                   /note="gene_id=mCG22247.1 transcript_id=mCT174887.0
FT                   protein_id=mCP97806.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D708"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028485"
FT                   /db_xref="MGI:MGI:1915110"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D708"
FT                   /protein_id="EDL15119.1"
FT                   /translation="MADCYTELEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLQRE
FT                   LNHMLTDTGNRKAADKLIQNLDANHDGRICFDEYWTMIGGITSPMANLIRQQECQQESQ
FT                   QECQQESQQESQQESQQGSS"
FT   CDS             join(25896882..25897034,25897227..25897448)
FT                   /codon_start=1
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /product="S100 calcium binding protein A16, isoform CRA_a"
FT                   /note="gene_id=mCG22247.1 transcript_id=mCT175869.0
FT                   protein_id=mCP98792.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D708"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028485"
FT                   /db_xref="MGI:MGI:1915110"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D708"
FT                   /protein_id="EDL15120.1"
FT                   /translation="MADCYTELEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLQRE
FT                   LNHMLTDTGNRKAADKLIQNLDANHDGRICFDEYWTMIGGITSPMANLIRQQECQQESQ
FT                   QECQQESQQESQQESQQGSS"
FT   CDS             join(25896882..25897034,25897227..25897448)
FT                   /codon_start=1
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /product="S100 calcium binding protein A16, isoform CRA_a"
FT                   /note="gene_id=mCG22247.1 transcript_id=mCT175870.0
FT                   protein_id=mCP98791.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D708"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028485"
FT                   /db_xref="MGI:MGI:1915110"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D708"
FT                   /protein_id="EDL15121.1"
FT                   /translation="MADCYTELEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLQRE
FT                   LNHMLTDTGNRKAADKLIQNLDANHDGRICFDEYWTMIGGITSPMANLIRQQECQQESQ
FT                   QECQQESQQESQQESQQGSS"
FT   CDS             join(25896882..25897034,25897227..25897448)
FT                   /codon_start=1
FT                   /gene="S100a16"
FT                   /locus_tag="mCG_22247"
FT                   /product="S100 calcium binding protein A16, isoform CRA_a"
FT                   /note="gene_id=mCG22247.1 transcript_id=mCT21203.1
FT                   protein_id=mCP17270.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q9D708"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028485"
FT                   /db_xref="MGI:MGI:1915110"
FT                   /db_xref="UniProtKB/TrEMBL:Q9D708"
FT                   /protein_id="EDL15122.1"
FT                   /translation="MADCYTELEKAVVVLVENFYKYVSKHSLVKNKISKSSFRKMLQRE
FT                   LNHMLTDTGNRKAADKLIQNLDANHDGRICFDEYWTMIGGITSPMANLIRQQECQQESQ
FT                   QECQQESQQESQQESQQGSS"
FT   gene            25944724..25960425
FT                   /gene="S100a3"
FT                   /locus_tag="mCG_142616"
FT                   /note="gene_id=mCG142616.0"
FT   mRNA            join(25944724..25944752,25959503..25959648,
FT                   25959914..25960425)
FT                   /gene="S100a3"
FT                   /locus_tag="mCG_142616"
FT                   /product="S100 calcium binding protein A3, transcript
FT                   variant mCT181196"
FT                   /note="gene_id=mCG142616.0 transcript_id=mCT181196.0
FT                   created on 19-MAR-2003"
FT   mRNA            join(25957938..25957991,25959503..25959648,
FT                   25959914..25960425)
FT                   /gene="S100a3"
FT                   /locus_tag="mCG_142616"
FT                   /product="S100 calcium binding protein A3, transcript
FT                   variant mCT161006"
FT                   /note="gene_id=mCG142616.0 transcript_id=mCT161006.0
FT                   created on 19-MAR-2003"
FT   CDS             join(25959508..25959648,25959914..25960078)
FT                   /codon_start=1
FT                   /gene="S100a3"
FT                   /locus_tag="mCG_142616"
FT                   /product="S100 calcium binding protein A3, isoform CRA_a"
FT                   /note="gene_id=mCG142616.0 transcript_id=mCT161006.0
FT                   protein_id=mCP90006.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q496W1"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR028488"
FT                   /db_xref="MGI:MGI:1338849"
FT                   /db_xref="UniProtKB/TrEMBL:Q496W1"
FT                   /protein_id="EDL15117.1"
FT                   /translation="MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTW
FT                   TPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ"
FT   CDS             join(25959508..25959648,25959914..25960078)
FT                   /codon_start=1
FT                   /gene="S100a3"
FT                   /locus_tag="mCG_142616"
FT                   /product="S100 calcium binding protein A3, isoform CRA_a"
FT                   /note="gene_id=mCG142616.0 transcript_id=mCT181196.0
FT                   protein_id=mCP104118.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q496W1"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR028488"
FT                   /db_xref="MGI:MGI:1338849"
FT                   /db_xref="UniProtKB/TrEMBL:Q496W1"
FT                   /protein_id="EDL15118.1"
FT                   /translation="MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTW
FT                   TPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ"
FT   gene            25961490..25963765
FT                   /gene="S100a4"
FT                   /locus_tag="mCG_1040509"
FT                   /note="gene_id=mCG1040509.2"
FT   mRNA            join(25961490..25961529,25962720..25962875,
FT                   25963463..25963765)
FT                   /gene="S100a4"
FT                   /locus_tag="mCG_1040509"
FT                   /product="S100 calcium binding protein A4"
FT                   /note="gene_id=mCG1040509.2 transcript_id=mCT122312.1
FT                   created on 19-MAR-2003"
FT   CDS             join(25962735..25962875,25963463..25963627)
FT                   /codon_start=1
FT                   /gene="S100a4"
FT                   /locus_tag="mCG_1040509"
FT                   /product="S100 calcium binding protein A4"
FT                   /note="gene_id=mCG1040509.2 transcript_id=mCT122312.1
FT                   protein_id=mCP65683.1"
FT                   /db_xref="GOA:Q545V2"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028496"
FT                   /db_xref="MGI:MGI:1330282"
FT                   /db_xref="UniProtKB/TrEMBL:Q545V2"
FT                   /protein_id="EDL15116.1"
FT                   /translation="MARPLEEALDVIVSTFHKYSGKEGDKFKLNKTELKELLTRELPSF
FT                   LGKRTDEAAFQKVMSNLDSNRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK"
FT   gene            25967527..25969497
FT                   /gene="S100a5"
FT                   /locus_tag="mCG_22218"
FT                   /note="gene_id=mCG22218.0"
FT   mRNA            join(25967527..25967682,25969232..25969497)
FT                   /gene="S100a5"
FT                   /locus_tag="mCG_22218"
FT                   /product="S100 calcium binding protein A5"
FT                   /note="gene_id=mCG22218.0 transcript_id=mCT21174.0 created
FT                   on 07-AUG-2002"
FT   CDS             join(25967545..25967682,25969232..25969375)
FT                   /codon_start=1
FT                   /gene="S100a5"
FT                   /locus_tag="mCG_22218"
FT                   /product="S100 calcium binding protein A5"
FT                   /note="gene_id=mCG22218.0 transcript_id=mCT21174.0
FT                   protein_id=mCP17256.1"
FT                   /db_xref="GOA:Q149U2"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028497"
FT                   /db_xref="MGI:MGI:1338915"
FT                   /db_xref="UniProtKB/TrEMBL:Q149U2"
FT                   /protein_id="EDL15115.1"
FT                   /translation="METPLEKALTTMVTTFHKYSGREGSKLTLSRKELKELIKTELSLA
FT                   EKMKESSIDNLMKSLDKNSDQEIDFKEYSVFLTTLCMAYNDFFLEDNK"
FT   gene            25970603..25972135
FT                   /gene="S100a6"
FT                   /locus_tag="mCG_22216"
FT                   /note="gene_id=mCG22216.2"
FT   mRNA            join(25970603..25970947,25971464..25971625,
FT                   25971912..25972135)
FT                   /gene="S100a6"
FT                   /locus_tag="mCG_22216"
FT                   /product="S100 calcium binding protein A6 (calcyclin)"
FT                   /note="gene_id=mCG22216.2 transcript_id=mCT21170.2 created
FT                   on 07-AUG-2002"
FT   CDS             join(25971488..25971625,25971912..25972043)
FT                   /codon_start=1
FT                   /gene="S100a6"
FT                   /locus_tag="mCG_22216"
FT                   /product="S100 calcium binding protein A6 (calcyclin)"
FT                   /note="gene_id=mCG22216.2 transcript_id=mCT21170.2
FT                   protein_id=mCP17246.1"
FT                   /db_xref="GOA:Q545I9"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="MGI:MGI:1339467"
FT                   /db_xref="UniProtKB/TrEMBL:Q545I9"
FT                   /protein_id="EDL15114.1"
FT                   /translation="MACPLDQAIGLLVAIFHKYSGKEGDKHTLSKKELKELIQKELTIG
FT                   SKLQDAEIARLMDDLDRNKDQEVNFQEYVAFLGALALIYNEALK"
FT   gene            26012000..26015612
FT                   /gene="S100a15"
FT                   /locus_tag="mCG_22231"
FT                   /note="gene_id=mCG22231.1"
FT   mRNA            join(26012000..26012097,26013194..26013413,
FT                   26015397..26015612)
FT                   /gene="S100a15"
FT                   /locus_tag="mCG_22231"
FT                   /product="S100 calcium binding protein A15, transcript
FT                   variant mCT181541"
FT                   /note="gene_id=mCG22231.1 transcript_id=mCT181541.0 created
FT                   on 27-MAR-2003"
FT   mRNA            join(26012001..26012097,26013233..26013413,
FT                   26015397..26015576)
FT                   /gene="S100a15"
FT                   /locus_tag="mCG_22231"
FT                   /product="S100 calcium binding protein A15, transcript
FT                   variant mCT21187"
FT                   /note="gene_id=mCG22231.1 transcript_id=mCT21187.2 created
FT                   on 27-MAR-2003"
FT   CDS             join(26013264..26013413,26015397..26015573)
FT                   /codon_start=1
FT                   /gene="S100a15"
FT                   /locus_tag="mCG_22231"
FT                   /product="S100 calcium binding protein A15, isoform CRA_a"
FT                   /note="gene_id=mCG22231.1 transcript_id=mCT181541.0
FT                   protein_id=mCP104463.0 isoform=CRA_a"
FT                   /protein_id="EDL15112.1"
FT                   /translation="MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPR
FT                   FMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTE
FT                   HSLY"
FT   CDS             join(26013264..26013413,26015397..26015573)
FT                   /codon_start=1
FT                   /gene="S100a15"
FT                   /locus_tag="mCG_22231"
FT                   /product="S100 calcium binding protein A15, isoform CRA_a"
FT                   /note="gene_id=mCG22231.1 transcript_id=mCT21187.2
FT                   protein_id=mCP17241.2 isoform=CRA_a"
FT                   /protein_id="EDL15113.1"
FT                   /translation="MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPR
FT                   FMDTLGRRQPYYITELFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTE
FT                   HSLY"
FT   gene            26026798..26027762
FT                   /gene="S100a8"
FT                   /locus_tag="mCG_22246"
FT                   /note="gene_id=mCG22246.1"
FT   mRNA            join(26026798..26026829,26027246..26027409,
FT                   26027566..26027762)
FT                   /gene="S100a8"
FT                   /locus_tag="mCG_22246"
FT                   /product="S100 calcium binding protein A8 (calgranulin A)"
FT                   /note="gene_id=mCG22246.1 transcript_id=mCT21202.1 created
FT                   on 07-AUG-2002"
FT   CDS             join(26027269..26027409,26027566..26027694)
FT                   /codon_start=1
FT                   /gene="S100a8"
FT                   /locus_tag="mCG_22246"
FT                   /product="S100 calcium binding protein A8 (calgranulin A)"
FT                   /note="gene_id=mCG22246.1 transcript_id=mCT21202.1
FT                   protein_id=mCP17278.2"
FT                   /db_xref="GOA:Q53X15"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR028474"
FT                   /db_xref="MGI:MGI:88244"
FT                   /db_xref="UniProtKB/TrEMBL:Q53X15"
FT                   /protein_id="EDL15111.1"
FT                   /translation="MPSELEKALSNLIDVYHNYSNIQGNHHALYKNDFKKMVTTECPQF
FT                   VQNINIENLFRELDINSDNAINFEEFLAMVIKVGVASHKDSHKE"
FT   gene            complement(26050354..26053393)
FT                   /gene="S100a9"
FT                   /locus_tag="mCG_22214"
FT                   /note="gene_id=mCG22214.2"
FT   mRNA            complement(join(26050354..26050655,26052834..26052998,
FT                   26053369..26053393))
FT                   /gene="S100a9"
FT                   /locus_tag="mCG_22214"
FT                   /product="S100 calcium binding protein A9 (calgranulin B),
FT                   transcript variant mCT181533"
FT                   /note="gene_id=mCG22214.2 transcript_id=mCT181533.0 created
FT                   on 25-MAR-2003"
FT   mRNA            complement(join(26050354..26050655,26052834..26052995,
FT                   26053369..26053392))
FT                   /gene="S100a9"
FT                   /locus_tag="mCG_22214"
FT                   /product="S100 calcium binding protein A9 (calgranulin B),
FT                   transcript variant mCT21169"
FT                   /note="gene_id=mCG22214.2 transcript_id=mCT21169.0 created
FT                   on 25-MAR-2003"
FT   CDS             complement(join(26050467..26050655,26052834..26052986))
FT                   /codon_start=1
FT                   /gene="S100a9"
FT                   /locus_tag="mCG_22214"
FT                   /product="S100 calcium binding protein A9 (calgranulin B),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22214.2 transcript_id=mCT181533.0
FT                   protein_id=mCP104455.0 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UP42"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR028475"
FT                   /db_xref="MGI:MGI:1338947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UP42"
FT                   /protein_id="EDL15109.1"
FT                   /translation="MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQ
FT                   LATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHG
FT                   HSHGKGCGK"
FT   CDS             complement(join(26050467..26050655,26052834..26052986))
FT                   /codon_start=1
FT                   /gene="S100a9"
FT                   /locus_tag="mCG_22214"
FT                   /product="S100 calcium binding protein A9 (calgranulin B),
FT                   isoform CRA_a"
FT                   /note="gene_id=mCG22214.2 transcript_id=mCT21169.0
FT                   protein_id=mCP17244.1 isoform=CRA_a"
FT                   /db_xref="GOA:Q3UP42"
FT                   /db_xref="InterPro:IPR001751"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="InterPro:IPR028475"
FT                   /db_xref="MGI:MGI:1338947"
FT                   /db_xref="UniProtKB/TrEMBL:Q3UP42"
FT                   /protein_id="EDL15110.1"
FT                   /translation="MANKAPSQMERSITTIIDTFHQYSRKEGHPDTLSKKEFRQMVEAQ
FT                   LATFMKKEKRNEALINDIMEDLDTNQDNQLSFEECMMLMAKLIFACHEKLHENNPRGHG
FT                   HSHGKGCGK"
FT   gene            complement(26080110..26081232)
FT                   /pseudo
FT                   /locus_tag="mCG_1032210"
FT                   /note="gene_id=mCG1032210.1"
FT   mRNA            complement(26080110..26081232)
FT                   /pseudo
FT                   /locus_tag="mCG_1032210"
FT                   /note="gene_id=mCG1032210.1 transcript_id=mCT149914.1
FT                   created on 27-MAR-2003"
FT   gene            26084666..>26098231
FT                   /gene="Pglyrp4"
FT                   /locus_tag="mCG_22227"
FT                   /note="gene_id=mCG22227.2"
FT   mRNA            join(26084666..26084714,26085613..26085720,
FT                   26086341..26086539,26088429..26088547,26090627..26090779,
FT                   26093237..26093420,26096768..26096886,26098053..>26098231)
FT                   /gene="Pglyrp4"
FT                   /locus_tag="mCG_22227"
FT                   /product="peptidoglycan recognition protein 4"
FT                   /note="gene_id=mCG22227.2 transcript_id=mCT21183.2 created
FT                   on 28-OCT-2002"
FT   CDS             join(26086352..26086539,26088429..26088547,
FT                   26090627..26090779,26093237..26093420,26096768..26096886,
FT                   26098053..26098231)
FT                   /codon_start=1
FT                   /gene="Pglyrp4"
FT                   /locus_tag="mCG_22227"
FT                   /product="peptidoglycan recognition protein 4"
FT                   /note="gene_id=mCG22227.2 transcript_id=mCT21183.2
FT                   protein_id=mCP17221.2"
FT                   /protein_id="EDL15108.1"
FT                   /translation="MVSREEWGAEAIGCSSKLSRPVDVLVIHHIPGLECHNKTVCSQKL
FT                   RELQAYHIHNSWCDVAYNFLVGDDGRVYEGVGWNVQGSHDQGYKNISLGVAFFGTQEGH
FT                   SPSPVALSAMKGLISYAVKKGHLSSKYIQPLLAKSEDCLVPPQKGKQKKVPRSVWGARD
FT                   SHCSRMTLPAKYAIILHTAGRTCSQPDECRLLVRDLQSFFMNRLNACDIGYNFLVGQDG
FT                   GVYEGVGWNNQGSKTDSYNDISLSITFMGTFTGSPPNAAALEAAQDLIRCAVVKGYLTP
FT                   NYLLMGHSDVSNTLSPGQALYNIIKTWPHFKH"
FT   gene            26116474..26119191
FT                   /pseudo
FT                   /locus_tag="mCG_49821"
FT                   /note="gene_id=mCG49821.2"
FT   mRNA            26116474..26119191
FT                   /pseudo
FT                   /locus_tag="mCG_49821"
FT                   /note="gene_id=mCG49821.2 transcript_id=mCT50004.2 created
FT                   on 09-APR-2003"
FT   gene            complement(26135308..>26137372)
FT                   /locus_tag="mCG_18965"
FT                   /note="gene_id=mCG18965.2"
FT   mRNA            complement(join(26135308..26135647,26137228..>26137372))
FT                   /locus_tag="mCG_18965"
FT                   /product="mCG18965"
FT                   /note="gene_id=mCG18965.2 transcript_id=mCT15690.2 created
FT                   on 28-OCT-2002"
FT   CDS             complement(join(26135423..26135647,26137228..>26137371))
FT                   /codon_start=1
FT                   /locus_tag="mCG_18965"
FT                   /product="mCG18965"
FT                   /note="gene_id=mCG18965.2 transcript_id=mCT15690.2
FT                   protein_id=mCP15028.1"
FT                   /protein_id="EDL15107.1"
FT                   /translation="LKGHRWNKPWENIIKIFHQHSAKEEDPDTLSQKEFKDLVNDDMPN
FT                   SFKKEKKDQKAMKYMMEDFDTNEDATLSFDEFVELIRKVLFKRHEASHEQASAHGHGHS
FT                   PRHGAGIRKNDNGHCYSN"
FT   gene            complement(26364451..26371900)
FT                   /pseudo
FT                   /locus_tag="mCG_63003"
FT                   /note="gene_id=mCG63003.2"
FT   mRNA            complement(join(26364451..26365460,26371464..26371900))
FT                   /pseudo
FT                   /locus_tag="mCG_63003"
FT                   /note="gene_id=mCG63003.2 transcript_id=mCT63186.2 created
FT                   on 27-MAR-2003"
FT   gene            complement(26443210..26445873)
FT                   /locus_tag="mCG_121122"
FT                   /note="gene_id=mCG121122.1"
FT   mRNA            complement(join(26443210..26443522,26445328..26445477,
FT                   26445843..26445873))
FT                   /locus_tag="mCG_121122"
FT                   /product="mCG121122"
FT                   /note="gene_id=mCG121122.1 transcript_id=mCT122319.1
FT                   created on 28-OCT-2002"
FT   CDS             complement(join(26443388..26443522,26445328..26445471))
FT                   /codon_start=1
FT                   /locus_tag="mCG_121122"
FT                   /product="mCG121122"
FT                   /note="gene_id=mCG121122.1 transcript_id=mCT122319.1
FT                   protein_id=mCP65441.1"
FT                   /db_xref="GOA:G3UWB8"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013787"
FT                   /db_xref="MGI:MGI:2684973"
FT                   /db_xref="UniProtKB/TrEMBL:G3UWB8"
FT                   /protein_id="EDL15106.1"
FT                   /translation="MDQGLTPSEHKIMMLYRNFTNYALGTTVILGEKEFRKLVRSEFPN
FT                   FLQEVQETPLSILLDEPKDRSFEEALNVIGRMGMVYYKKMNNNAFER"
FT   gene            <27372422..>27391438
FT                   /gene="Pglyrp3"
FT                   /locus_tag="mCG_15631"
FT                   /note="gene_id=mCG15631.2"
FT   mRNA            join(<27372422..27372594,27374456..27374575,
FT                   27382480..27382681,27385555..27385673,27386349..27386471,
FT                   27387867..27388065,27390507..27390625,27391260..>27391438)
FT                   /gene="Pglyrp3"
FT                   /locus_tag="mCG_15631"
FT                   /product="peptidoglycan recognition protein 3"
FT                   /note="gene_id=mCG15631.2 transcript_id=mCT19030.2 created
FT                   on 21-OCT-2002"
FT   CDS             join(<27372525..27372594,27374456..27374575,
FT                   27382480..27382681,27385555..27385673,27386349..27386471,
FT                   27387867..27388065,27390507..27390625,27391260..27391438)
FT                   /codon_start=1
FT                   /gene="Pglyrp3"
FT                   /locus_tag="mCG_15631"
FT                   /product="peptidoglycan recognition protein 3"
FT                   /note="gene_id=mCG15631.2 transcript_id=mCT19030.2
FT                   protein_id=mCP15706.2"
FT                   /protein_id="EDL15104.1"
FT                   /translation="YREKGFQSTLLGWDISKSSGISELFSRTCALQDCQSDSMLVSWDH
FT                   PKMLPRLLGFLALSLLACGNPTIVSRKEWGASSLTCRVPLSLPVPYLIIEQVTRMQCQD
FT                   QITCSQVVRVLQSQYVHNKGWCDIAFNFLVGDDGKVYEGVGWYVQGLHTQGYNNVSLGI
FT                   AFFGSKIATEDLIFFAIQNGYLSPKYIQPFLLKEETCLVPQHSEIPKKACPNITPRSAW
FT                   EARETHCPQMNLPAKFVIIIHTAGKSCNESADCLVRVRDTQSFHIDNQDFCDIAYHFLV
FT                   GQDGEVYEGVGWNIEGSHTYGYNDIALGIAFMGNFVEKPPNEASLKAAQSLIQCAVAKG
FT                   YLTSNYLLMGHSDVSNILSPGQALYNIIKTWPHFKH"
FT   gene            27384370..27384908
FT                   /locus_tag="mCG_15627"
FT                   /note="gene_id=mCG15627.1"
FT   mRNA            27384370..27384908
FT                   /locus_tag="mCG_15627"
FT                   /product="mCG15627"
FT                   /note="gene_id=mCG15627.1 transcript_id=mCT18790.1 created
FT                   on 21-OCT-2002"
FT   CDS             27384442..27384786
FT                   /codon_start=1
FT                   /locus_tag="mCG_15627"
FT                   /product="mCG15627"
FT                   /note="gene_id=mCG15627.1 transcript_id=mCT18790.1
FT                   protein_id=mCP15702.1"
FT                   /protein_id="EDL15105.1"
FT                   /translation="MPMFIVNTNVPCASVPEGFLSELTQQLAQATSKPAQYIAVHVVPD
FT                   KLMTFSCRNDPCALCSLHSIGKIGGAQNRNYSKLLCGLLADRLHISRDRVYINYYMNSA
FT                   NVGWNGSTFA"
FT   gene            complement(27440161..27443019)
FT                   /gene="Lor"
FT                   /locus_tag="mCG_15628"
FT                   /note="gene_id=mCG15628.1"
FT   mRNA            complement(join(27440161..27441879,27442973..27443019))
FT                   /gene="Lor"
FT                   /locus_tag="mCG_15628"
FT                   /product="loricrin"
FT                   /note="gene_id=mCG15628.1 transcript_id=mCT18791.1 created
FT                   on 01-APR-2003"
FT   CDS             complement(27440396..27441856)
FT                   /codon_start=1
FT                   /gene="Lor"
FT                   /locus_tag="mCG_15628"
FT                   /product="loricrin"
FT                   /note="gene_id=mCG15628.1 transcript_id=mCT18791.1
FT                   protein_id=mCP15703.2"
FT                   /protein_id="EDL15103.1"
FT                   /translation="MSHQKKQPTPCPPVGCGKTSGGGGGGGGGGGGGYYSGGGSGCGGG
FT                   SSGGGSSCGGGGGGSYGGGSSCGGGGGSGGGVKYSGGGGGSSCGGGYSGGGGGSSCGGG
FT                   YSGGGGGSSCGGGYSGGGGGSSCGGGSYSGGGSSCGGGGGSGGGVKYSGGGGGGGSSCG
FT                   GGSSGGGGGGSSCGGGSGGGGSYCGGSSGGGSSGGCGGGSGGGKYSGGGGGSSCGGGYS
FT                   GGGGSSGGSSCGGGYSGGGGSSCGGGGGYSGGGGSSCGGGSSGGGGGGSSQQYQCQSYG
FT                   GGSSGGSSCGGRYSGGGGSSCGGGYSGGGGSSCGGGSSGGGSSCGGSGGGGYSGGGGGS
FT                   CGGGSSGGGGGYYSSQQTSQTSCAPQQSYGGGSSGGGGSCGGGSSGGGGGGGCYSSGGG
FT                   GSSGGCGGGYSGGGGGCGGGSSGGSGGGCGGGSSGGSGGGCGGGYSGGGGGGSSCGGGS
FT                   SGGGSGGGKGVPVCHQTQQKQAPTWPCK"
FT   gene            complement(27462461..>27502607)
FT                   /locus_tag="mCG_145236"
FT                   /note="gene_id=mCG145236.0"
FT   mRNA            complement(join(27462461..27462609,27464088..27464191,
FT                   27464610..27464733,27465317..27465463,27470654..27470724,
FT                   27502523..>27502607))
FT                   /locus_tag="mCG_145236"
FT                   /product="mCG145236"
FT                   /note="gene_id=mCG145236.0 transcript_id=mCT184660.0
FT                   created on 05-JUN-2003"
FT   CDS             complement(join(27464147..27464191,27464610..27464733,
FT                   27465317..>27465396))
FT                   /codon_start=1
FT                   /locus_tag="mCG_145236"
FT                   /product="mCG145236"
FT                   /note="gene_id=mCG145236.0 transcript_id=mCT184660.0
FT                   protein_id=mCP105803.0"
FT                   /protein_id="EDL15102.1"
FT                   /translation="TRDCEDPCSSKKLQGLIQTMQSLGIHGLWLPQTSQDPWAPCGKKP
FT                   CRARWGHLFHYSPLHPSILPAEQGDSGSRQKNSLNSL"
FT   assembly_gap    6746..6765
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    13254..13854
FT                   /estimated_length=601
FT                   /gap_type="unknown"
FT   assembly_gap    15257..17483
FT                   /estimated_length=2227
FT                   /gap_type="unknown"
FT   assembly_gap    33772..35253
FT                   /estimated_length=1482
FT                   /gap_type="unknown"
FT   assembly_gap    88580..89017
FT                   /estimated_length=438
FT                   /gap_type="unknown"
FT   assembly_gap    94372..95338
FT                   /estimated_length=967
FT                   /gap_type="unknown"
FT   assembly_gap    99039..100953
FT                   /estimated_length=1915
FT                   /gap_type="unknown"
FT   assembly_gap    102023..104439
FT                   /estimated_length=2417
FT                   /gap_type="unknown"
FT   assembly_gap    105553..105832
FT                   /estimated_length=280
FT                   /gap_type="unknown"
FT   assembly_gap    107149..107168
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    111502..146114
FT                   /estimated_length=34613
FT                   /gap_type="unknown"
FT   assembly_gap    153431..156186
FT                   /estimated_length=2756
FT                   /gap_type="unknown"
FT   assembly_gap    157715..158594
FT                   /estimated_length=880
FT                   /gap_type="unknown"
FT   assembly_gap    159527..159635
FT                   /estimated_length=109
FT                   /gap_type="unknown"
FT   assembly_gap    162735..165337
FT                   /estimated_length=2603
FT                   /gap_type="unknown"
FT   assembly_gap    167410..169090
FT                   /estimated_length=1681
FT                   /gap_type="unknown"
FT   assembly_gap    193180..193199
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    222569..222588
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    278378..279757
FT                   /estimated_length=1380
FT                   /gap_type="unknown"
FT   assembly_gap    375403..375986
FT                   /estimated_length=584
FT                   /gap_type="unknown"
FT   assembly_gap    385941..386455
FT                   /estimated_length=515
FT                   /gap_type="unknown"
FT   assembly_gap    418194..418213
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    419809..419828
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    424426..424630
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    437021..437040
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    441003..441022
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    442943..442962
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    471324..471343
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    472455..472478
FT                   /estimated_length=24
FT                   /gap_type="unknown"
FT   assembly_gap    500410..500429
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    517437..517465
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    551339..551415
FT                   /estimated_length=77
FT                   /gap_type="unknown"
FT   assembly_gap    585857..586035
FT                   /estimated_length=179
FT                   /gap_type="unknown"
FT   assembly_gap    592217..592236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    593374..593393
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    623498..623617
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    646277..646296
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    649842..649890
FT                   /estimated_length=49
FT                   /gap_type="unknown"
FT   assembly_gap    663051..663070
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    677339..677920
FT                   /estimated_length=582
FT                   /gap_type="unknown"
FT   assembly_gap    680589..680608
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    703709..704020
FT                   /estimated_length=312
FT                   /gap_type="unknown"
FT   assembly_gap    717340..717537
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    728951..729850
FT                   /estimated_length=900
FT                   /gap_type="unknown"
FT   assembly_gap    731156..731175
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    732748..732767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    734044..734758
FT                   /estimated_length=715
FT                   /gap_type="unknown"
FT   assembly_gap    735937..736679
FT                   /estimated_length=743
FT                   /gap_type="unknown"
FT   assembly_gap    737870..737889
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    739403..739422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    740983..742112
FT                   /estimated_length=1130
FT                   /gap_type="unknown"
FT   assembly_gap    763084..763224
FT                   /estimated_length=141
FT                   /gap_type="unknown"
FT   assembly_gap    824415..824469
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    832414..832500
FT                   /estimated_length=87
FT                   /gap_type="unknown"
FT   assembly_gap    844811..844920
FT                   /estimated_length=110
FT                   /gap_type="unknown"
FT   assembly_gap    918312..918331
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    920041..920587
FT                   /estimated_length=547
FT                   /gap_type="unknown"
FT   assembly_gap    921399..921445
FT                   /estimated_length=47
FT                   /gap_type="unknown"
FT   assembly_gap    930018..930049
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    978043..978062
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    990664..990683
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1018933..1018952
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1025527..1025546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1036757..1036776
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1082951..1083180
FT                   /estimated_length=230
FT                   /gap_type="unknown"
FT   assembly_gap    1095125..1095144
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1096182..1096201
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1102562..1102581
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1118177..1118196
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1131329..1131348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1156143..1156310
FT                   /estimated_length=168
FT                   /gap_type="unknown"
FT   assembly_gap    1164916..1165610
FT                   /estimated_length=695
FT                   /gap_type="unknown"
FT   assembly_gap    1212974..1212993
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1223248..1223403
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    1333147..1333344
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    1336614..1336633
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1349422..1349490
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    1359698..1359771
FT                   /estimated_length=74
FT                   /gap_type="unknown"
FT   assembly_gap    1372844..1372924
FT                   /estimated_length=81
FT                   /gap_type="unknown"
FT   assembly_gap    1384925..1385106
FT                   /estimated_length=182
FT                   /gap_type="unknown"
FT   assembly_gap    1389578..1389721
FT                   /estimated_length=144
FT                   /gap_type="unknown"
FT   assembly_gap    1396831..1397074
FT                   /estimated_length=244
FT                   /gap_type="unknown"
FT   assembly_gap    1454390..1454579
FT                   /estimated_length=190
FT                   /gap_type="unknown"
FT   assembly_gap    1477684..1477798
FT                   /estimated_length=115
FT                   /gap_type="unknown"
FT   assembly_gap    1498416..1498460
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    1500461..1500480
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1526739..1531558
FT                   /estimated_length=4820
FT                   /gap_type="unknown"
FT   assembly_gap    1554526..1554627
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    1566307..1566326
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1607850..1607998
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    1610419..1610438
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1613941..1613960
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1623965..1623984
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1640489..1640508
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1644140..1644159
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1645240..1645259
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1646638..1646657
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1665586..1665698
FT                   /estimated_length=113
FT                   /gap_type="unknown"
FT   assembly_gap    1686600..1691110
FT                   /estimated_length=4511
FT                   /gap_type="unknown"
FT   assembly_gap    1709217..1709236
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1718091..1718182
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    1727778..1730711
FT                   /estimated_length=2934
FT                   /gap_type="unknown"
FT   assembly_gap    1740059..1740128
FT                   /estimated_length=70
FT                   /gap_type="unknown"
FT   assembly_gap    1749710..1749729
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1769783..1769816
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    1777264..1777283
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1830127..1830185
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    1842453..1842557
FT                   /estimated_length=105
FT                   /gap_type="unknown"
FT   assembly_gap    1844156..1844201
FT                   /estimated_length=46
FT                   /gap_type="unknown"
FT   assembly_gap    1980577..1980596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    1999768..1999860
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    2021475..2022316
FT                   /estimated_length=842
FT                   /gap_type="unknown"
FT   assembly_gap    2028569..2028668
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    2049564..2049740
FT                   /estimated_length=177
FT                   /gap_type="unknown"
FT   assembly_gap    2086784..2092009
FT                   /estimated_length=5226
FT                   /gap_type="unknown"
FT   assembly_gap    2129852..2131938
FT                   /estimated_length=2087
FT                   /gap_type="unknown"
FT   assembly_gap    2137278..2137320
FT                   /estimated_length=43
FT                   /gap_type="unknown"
FT   assembly_gap    2142042..2142132
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    2163895..2167178
FT                   /estimated_length=3284
FT                   /gap_type="unknown"
FT   assembly_gap    2173717..2173772
FT                   /estimated_length=56
FT                   /gap_type="unknown"
FT   assembly_gap    2262550..2263914
FT                   /estimated_length=1365
FT                   /gap_type="unknown"
FT   assembly_gap    2265279..2266005
FT                   /estimated_length=727
FT                   /gap_type="unknown"
FT   assembly_gap    2271452..2271471
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2285866..2286116
FT                   /estimated_length=251
FT                   /gap_type="unknown"
FT   assembly_gap    2291493..2294701
FT                   /estimated_length=3209
FT                   /gap_type="unknown"
FT   assembly_gap    2303649..2303863
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    2310625..2312045
FT                   /estimated_length=1421
FT                   /gap_type="unknown"
FT   assembly_gap    2355111..2361807
FT                   /estimated_length=6697
FT                   /gap_type="unknown"
FT   assembly_gap    2366820..2371945
FT                   /estimated_length=5126
FT                   /gap_type="unknown"
FT   assembly_gap    2398899..2398918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2423082..2423101
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2433711..2433868
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    2497997..2498016
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2504158..2504922
FT                   /estimated_length=765
FT                   /gap_type="unknown"
FT   assembly_gap    2548522..2549874
FT                   /estimated_length=1353
FT                   /gap_type="unknown"
FT   assembly_gap    2563044..2563063
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2605360..2611884
FT                   /estimated_length=6525
FT                   /gap_type="unknown"
FT   assembly_gap    2629716..2629735
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2747221..2747240
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2815772..2815791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2819195..2819289
FT                   /estimated_length=95
FT                   /gap_type="unknown"
FT   assembly_gap    2824186..2824205
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2825259..2825385
FT                   /estimated_length=127
FT                   /gap_type="unknown"
FT   assembly_gap    2864864..2865102
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    2871300..2871319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2937060..2937215
FT                   /estimated_length=156
FT                   /gap_type="unknown"
FT   assembly_gap    2940271..2940372
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    2968971..2968990
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2973200..2973219
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    2978765..2980011
FT                   /estimated_length=1247
FT                   /gap_type="unknown"
FT   assembly_gap    3008350..3008638
FT                   /estimated_length=289
FT                   /gap_type="unknown"
FT   assembly_gap    3017150..3017176
FT                   /estimated_length=27
FT                   /gap_type="unknown"
FT   assembly_gap    3020097..3020116
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3047661..3047714
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    3061069..3061088
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3077973..3077992
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3080257..3080588
FT                   /estimated_length=332
FT                   /gap_type="unknown"
FT   assembly_gap    3123268..3126175
FT                   /estimated_length=2908
FT                   /gap_type="unknown"
FT   assembly_gap    3137690..3137709
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3143462..3143563
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    3183589..3183738
FT                   /estimated_length=150
FT                   /gap_type="unknown"
FT   assembly_gap    3230822..3234371
FT                   /estimated_length=3550
FT                   /gap_type="unknown"
FT   assembly_gap    3279323..3279525
FT                   /estimated_length=203
FT                   /gap_type="unknown"
FT   assembly_gap    3281986..3282005
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3304380..3304399
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3346474..3346635
FT                   /estimated_length=162
FT                   /gap_type="unknown"
FT   assembly_gap    3366821..3367120
FT                   /estimated_length=300
FT                   /gap_type="unknown"
FT   assembly_gap    3378899..3378918
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3485606..3485625
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3510444..3510483
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    3563634..3563653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3606974..3608965
FT                   /estimated_length=1992
FT                   /gap_type="unknown"
FT   assembly_gap    3664661..3667699
FT                   /estimated_length=3039
FT                   /gap_type="unknown"
FT   assembly_gap    3690286..3690471
FT                   /estimated_length=186
FT                   /gap_type="unknown"
FT   assembly_gap    3695287..3695444
FT                   /estimated_length=158
FT                   /gap_type="unknown"
FT   assembly_gap    3706674..3706923
FT                   /estimated_length=250
FT                   /gap_type="unknown"
FT   assembly_gap    3715847..3715866
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3720867..3721025
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    3767910..3768446
FT                   /estimated_length=537
FT                   /gap_type="unknown"
FT   assembly_gap    3846446..3846465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    3902195..3902455
FT                   /estimated_length=261
FT                   /gap_type="unknown"
FT   assembly_gap    3967878..3971214
FT                   /estimated_length=3337
FT                   /gap_type="unknown"
FT   assembly_gap    3981690..3981821
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    4004046..4004240
FT                   /estimated_length=195
FT                   /gap_type="unknown"
FT   assembly_gap    4011387..4011728
FT                   /estimated_length=342
FT                   /gap_type="unknown"
FT   assembly_gap    4019364..4019383
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4084774..4084793
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4103704..4103856
FT                   /estimated_length=153
FT                   /gap_type="unknown"
FT   assembly_gap    4125445..4125544
FT                   /estimated_length=100
FT                   /gap_type="unknown"
FT   assembly_gap    4150611..4167041
FT                   /estimated_length=16431
FT                   /gap_type="unknown"
FT   assembly_gap    4191012..4191031
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4260519..4260538
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4271867..4272027
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    4302807..4302826
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4337551..4337608
FT                   /estimated_length=58
FT                   /gap_type="unknown"
FT   assembly_gap    4349303..4349322
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4372534..4372553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4407013..4408015
FT                   /estimated_length=1003
FT                   /gap_type="unknown"
FT   assembly_gap    4426574..4426593
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4440593..4440612
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4456454..4460633
FT                   /estimated_length=4180
FT                   /gap_type="unknown"
FT   assembly_gap    4461907..4461926
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4466636..4466655
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4468268..4468410
FT                   /estimated_length=143
FT                   /gap_type="unknown"
FT   assembly_gap    4475839..4476156
FT                   /estimated_length=318
FT                   /gap_type="unknown"
FT   assembly_gap    4500034..4500053
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4559808..4560066
FT                   /estimated_length=259
FT                   /gap_type="unknown"
FT   assembly_gap    4567608..4567627
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4576308..4576512
FT                   /estimated_length=205
FT                   /gap_type="unknown"
FT   assembly_gap    4579995..4584981
FT                   /estimated_length=4987
FT                   /gap_type="unknown"
FT   assembly_gap    4592048..4592099
FT                   /estimated_length=52
FT                   /gap_type="unknown"
FT   assembly_gap    4602175..4602194
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4606274..4606471
FT                   /estimated_length=198
FT                   /gap_type="unknown"
FT   assembly_gap    4627034..4627247
FT                   /estimated_length=214
FT                   /gap_type="unknown"
FT   assembly_gap    4630411..4630430
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4640218..4641404
FT                   /estimated_length=1187
FT                   /gap_type="unknown"
FT   assembly_gap    4643541..4643560
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4644837..4654616
FT                   /estimated_length=9780
FT                   /gap_type="unknown"
FT   assembly_gap    4660338..4660392
FT                   /estimated_length=55
FT                   /gap_type="unknown"
FT   assembly_gap    4661224..4661252
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    4676902..4676946
FT                   /estimated_length=45
FT                   /gap_type="unknown"
FT   assembly_gap    4677838..4677869
FT                   /estimated_length=32
FT                   /gap_type="unknown"
FT   assembly_gap    4706520..4706866
FT                   /estimated_length=347
FT                   /gap_type="unknown"
FT   assembly_gap    4709538..4709557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4732252..4732271
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4733828..4733847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4767955..4768801
FT                   /estimated_length=847
FT                   /gap_type="unknown"
FT   assembly_gap    4769848..4770088
FT                   /estimated_length=241
FT                   /gap_type="unknown"
FT   assembly_gap    4775489..4776041
FT                   /estimated_length=553
FT                   /gap_type="unknown"
FT   assembly_gap    4815556..4815575
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4821817..4822166
FT                   /estimated_length=350
FT                   /gap_type="unknown"
FT   assembly_gap    4848582..4848601
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4902825..4902892
FT                   /estimated_length=68
FT                   /gap_type="unknown"
FT   assembly_gap    4921423..4921486
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    4930617..4930636
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4935762..4935789
FT                   /estimated_length=28
FT                   /gap_type="unknown"
FT   assembly_gap    4938862..4938881
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    4957500..4957631
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    4961241..4961320
FT                   /estimated_length=80
FT                   /gap_type="unknown"
FT   assembly_gap    4987543..4987703
FT                   /estimated_length=161
FT                   /gap_type="unknown"
FT   assembly_gap    4992650..4992669
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5019781..5019800
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5023970..5024221
FT                   /estimated_length=252
FT                   /gap_type="unknown"
FT   assembly_gap    5031094..5031409
FT                   /estimated_length=316
FT                   /gap_type="unknown"
FT   assembly_gap    5043023..5043042
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5070719..5070752
FT                   /estimated_length=34
FT                   /gap_type="unknown"
FT   assembly_gap    5085642..5086624
FT                   /estimated_length=983
FT                   /gap_type="unknown"
FT   assembly_gap    5087839..5087858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5114625..5114726
FT                   /estimated_length=102
FT                   /gap_type="unknown"
FT   assembly_gap    5131502..5131521
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5132597..5132616
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5134106..5134125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5184223..5184304
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    5203452..5203515
FT                   /estimated_length=64
FT                   /gap_type="unknown"
FT   assembly_gap    5220005..5220266
FT                   /estimated_length=262
FT                   /gap_type="unknown"
FT   assembly_gap    5255828..5255847
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5259995..5260397
FT                   /estimated_length=403
FT                   /gap_type="unknown"
FT   assembly_gap    5263765..5263784
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5271599..5271618
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5275180..5275258
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    5313599..5313821
FT                   /estimated_length=223
FT                   /gap_type="unknown"
FT   assembly_gap    5326173..5326264
FT                   /estimated_length=92
FT                   /gap_type="unknown"
FT   assembly_gap    5329128..5329147
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5334457..5334476
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5335632..5336038
FT                   /estimated_length=407
FT                   /gap_type="unknown"
FT   assembly_gap    5337792..5337976
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    5339223..5339450
FT                   /estimated_length=228
FT                   /gap_type="unknown"
FT   assembly_gap    5348953..5349200
FT                   /estimated_length=248
FT                   /gap_type="unknown"
FT   assembly_gap    5357014..5357580
FT                   /estimated_length=567
FT                   /gap_type="unknown"
FT   assembly_gap    5359195..5359214
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5360703..5360722
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5362102..5363019
FT                   /estimated_length=918
FT                   /gap_type="unknown"
FT   assembly_gap    5365533..5365605
FT                   /estimated_length=73
FT                   /gap_type="unknown"
FT   assembly_gap    5367211..5367486
FT                   /estimated_length=276
FT                   /gap_type="unknown"
FT   assembly_gap    5368773..5373028
FT                   /estimated_length=4256
FT                   /gap_type="unknown"
FT   assembly_gap    5379496..5379624
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    5382373..5383699
FT                   /estimated_length=1327
FT                   /gap_type="unknown"
FT   assembly_gap    5394926..5394945
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5417976..5417995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5419094..5419113
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5422450..5422469
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5423721..5423740
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5465334..5465942
FT                   /estimated_length=609
FT                   /gap_type="unknown"
FT   assembly_gap    5468946..5472672
FT                   /estimated_length=3727
FT                   /gap_type="unknown"
FT   assembly_gap    5486045..5487104
FT                   /estimated_length=1060
FT                   /gap_type="unknown"
FT   assembly_gap    5490075..5490490
FT                   /estimated_length=416
FT                   /gap_type="unknown"
FT   assembly_gap    5496946..5496965
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5509977..5510184
FT                   /estimated_length=208
FT                   /gap_type="unknown"
FT   assembly_gap    5513491..5513591
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5527341..5527729
FT                   /estimated_length=389
FT                   /gap_type="unknown"
FT   assembly_gap    5546639..5546739
FT                   /estimated_length=101
FT                   /gap_type="unknown"
FT   assembly_gap    5568455..5568474
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5570840..5570859
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5585797..5585840
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    5587151..5587170
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5591708..5591727
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5592982..5593001
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5594934..5595331
FT                   /estimated_length=398
FT                   /gap_type="unknown"
FT   assembly_gap    5596906..5596925
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5627095..5627214
FT                   /estimated_length=120
FT                   /gap_type="unknown"
FT   assembly_gap    5631842..5632842
FT                   /estimated_length=1001
FT                   /gap_type="unknown"
FT   assembly_gap    5643400..5643419
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5672038..5672462
FT                   /estimated_length=425
FT                   /gap_type="unknown"
FT   assembly_gap    5700399..5700418
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5703316..5703335
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5734440..5735392
FT                   /estimated_length=953
FT                   /gap_type="unknown"
FT   assembly_gap    5747302..5747969
FT                   /estimated_length=668
FT                   /gap_type="unknown"
FT   assembly_gap    5757292..5757376
FT                   /estimated_length=85
FT                   /gap_type="unknown"
FT   assembly_gap    5775221..5776016
FT                   /estimated_length=796
FT                   /gap_type="unknown"
FT   assembly_gap    5790249..5790268
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5811403..5811422
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5832653..5832672
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5839577..5840278
FT                   /estimated_length=702
FT                   /gap_type="unknown"
FT   assembly_gap    5866449..5866468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5874244..5874283
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    5915772..5915791
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5920681..5920700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    5926495..5926651
FT                   /estimated_length=157
FT                   /gap_type="unknown"
FT   assembly_gap    5981897..5981916
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6006636..6006944
FT                   /estimated_length=309
FT                   /gap_type="unknown"
FT   assembly_gap    6021836..6021864
FT                   /estimated_length=29
FT                   /gap_type="unknown"
FT   assembly_gap    6031171..6031329
FT                   /estimated_length=159
FT                   /gap_type="unknown"
FT   assembly_gap    6033176..6033324
FT                   /estimated_length=149
FT                   /gap_type="unknown"
FT   assembly_gap    6046794..6050452
FT                   /estimated_length=3659
FT                   /gap_type="unknown"
FT   assembly_gap    6070933..6071011
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    6109022..6109041
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6113776..6113795
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6138204..6138223
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6140494..6140559
FT                   /estimated_length=66
FT                   /gap_type="unknown"
FT   assembly_gap    6142392..6143064
FT                   /estimated_length=673
FT                   /gap_type="unknown"
FT   assembly_gap    6144534..6144553
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6176081..6176100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6186327..6187255
FT                   /estimated_length=929
FT                   /gap_type="unknown"
FT   assembly_gap    6208080..6208099
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6221594..6221613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6243329..6243348
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6247579..6249628
FT                   /estimated_length=2050
FT                   /gap_type="unknown"
FT   assembly_gap    6251000..6251876
FT                   /estimated_length=877
FT                   /gap_type="unknown"
FT   assembly_gap    6279163..6279182
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6330015..6330054
FT                   /estimated_length=40
FT                   /gap_type="unknown"
FT   assembly_gap    6333742..6334287
FT                   /estimated_length=546
FT                   /gap_type="unknown"
FT   assembly_gap    6417211..6417230
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6418594..6418613
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6421651..6421670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6425505..6425524
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6456783..6456802
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6466280..6466628
FT                   /estimated_length=349
FT                   /gap_type="unknown"
FT   assembly_gap    6480711..6480730
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6483872..6483891
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6485357..6485376
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6486823..6487376
FT                   /estimated_length=554
FT                   /gap_type="unknown"
FT   assembly_gap    6488694..6489815
FT                   /estimated_length=1122
FT                   /gap_type="unknown"
FT   assembly_gap    6492006..6492025
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6513473..6513492
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6515841..6516368
FT                   /estimated_length=528
FT                   /gap_type="unknown"
FT   assembly_gap    6529235..6529254
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6530834..6530853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6538057..6538076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6542591..6548177
FT                   /estimated_length=5587
FT                   /gap_type="unknown"
FT   assembly_gap    6550976..6550995
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6555272..6559494
FT                   /estimated_length=4223
FT                   /gap_type="unknown"
FT   assembly_gap    6563448..6567456
FT                   /estimated_length=4009
FT                   /gap_type="unknown"
FT   assembly_gap    6572889..6572908
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6574237..6574256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6578910..6579162
FT                   /estimated_length=253
FT                   /gap_type="unknown"
FT   assembly_gap    6580355..6580374
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6582691..6590544
FT                   /estimated_length=7854
FT                   /gap_type="unknown"
FT   assembly_gap    6591744..6599804
FT                   /estimated_length=8061
FT                   /gap_type="unknown"
FT   assembly_gap    6601674..6601693
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6603029..6610461
FT                   /estimated_length=7433
FT                   /gap_type="unknown"
FT   assembly_gap    6612506..6612525
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6620973..6624628
FT                   /estimated_length=3656
FT                   /gap_type="unknown"
FT   assembly_gap    6626681..6626700
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6644225..6644244
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6645924..6646285
FT                   /estimated_length=362
FT                   /gap_type="unknown"
FT   assembly_gap    6647580..6647599
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6648984..6649003
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6682397..6682487
FT                   /estimated_length=91
FT                   /gap_type="unknown"
FT   assembly_gap    6684651..6684670
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6703942..6703961
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6708879..6708898
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6736826..6737395
FT                   /estimated_length=570
FT                   /gap_type="unknown"
FT   assembly_gap    6741678..6741844
FT                   /estimated_length=167
FT                   /gap_type="unknown"
FT   assembly_gap    6743268..6743287
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6749958..6749977
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6762929..6763258
FT                   /estimated_length=330
FT                   /gap_type="unknown"
FT   assembly_gap    6767412..6768672
FT                   /estimated_length=1261
FT                   /gap_type="unknown"
FT   assembly_gap    6838452..6838490
FT                   /estimated_length=39
FT                   /gap_type="unknown"
FT   assembly_gap    6857029..6857048
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6865449..6865468
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6872855..6872947
FT                   /estimated_length=93
FT                   /gap_type="unknown"
FT   assembly_gap    6880092..6882710
FT                   /estimated_length=2619
FT                   /gap_type="unknown"
FT   assembly_gap    6884017..6884164
FT                   /estimated_length=148
FT                   /gap_type="unknown"
FT   assembly_gap    6895832..6896679
FT                   /estimated_length=848
FT                   /gap_type="unknown"
FT   assembly_gap    6897430..6897580
FT                   /estimated_length=151
FT                   /gap_type="unknown"
FT   assembly_gap    6910446..6910465
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6915383..6915751
FT                   /estimated_length=369
FT                   /gap_type="unknown"
FT   assembly_gap    6932370..6935189
FT                   /estimated_length=2820
FT                   /gap_type="unknown"
FT   assembly_gap    6942725..6942744
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6943839..6943858
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6945200..6950190
FT                   /estimated_length=4991
FT                   /gap_type="unknown"
FT   assembly_gap    6954326..6954345
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6975730..6976331
FT                   /estimated_length=602
FT                   /gap_type="unknown"
FT   assembly_gap    6978124..6978143
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6995060..6995079
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    6997091..6997415
FT                   /estimated_length=325
FT                   /gap_type="unknown"
FT   assembly_gap    7016325..7016344
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7027994..7028013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7086469..7086512
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    7105983..7106002
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7139527..7139546
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7160890..7161149
FT                   /estimated_length=260
FT                   /gap_type="unknown"
FT   assembly_gap    7182553..7182631
FT                   /estimated_length=79
FT                   /gap_type="unknown"
FT   assembly_gap    7221816..7221835
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7223453..7223575
FT                   /estimated_length=123
FT                   /gap_type="unknown"
FT   assembly_gap    7232197..7232304
FT                   /estimated_length=108
FT                   /gap_type="unknown"
FT   assembly_gap    7253218..7253237
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7282107..7282126
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7292796..7292815
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7293882..7293901
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7294988..7295007
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7296013..7296032
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7298072..7298363
FT                   /estimated_length=292
FT                   /gap_type="unknown"
FT   assembly_gap    7302824..7302843
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7308087..7308106
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7312542..7312561
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7370743..7370801
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    7381657..7381894
FT                   /estimated_length=238
FT                   /gap_type="unknown"
FT   assembly_gap    7383300..7383319
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7385088..7385107
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7386145..7386164
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7411990..7412009
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7457552..7457571
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7466908..7470149
FT                   /estimated_length=3242
FT                   /gap_type="unknown"
FT   assembly_gap    7471418..7471437
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7472615..7472634
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7482551..7482787
FT                   /estimated_length=237
FT                   /gap_type="unknown"
FT   assembly_gap    7493840..7493869
FT                   /estimated_length=30
FT                   /gap_type="unknown"
FT   assembly_gap    7502734..7502753
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7529322..7529341
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7537850..7538114
FT                   /estimated_length=265
FT                   /gap_type="unknown"
FT   assembly_gap    7549548..7549567
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7593453..7594568
FT                   /estimated_length=1116
FT                   /gap_type="unknown"
FT   assembly_gap    7607050..7607336
FT                   /estimated_length=287
FT                   /gap_type="unknown"
FT   assembly_gap    7616471..7616552
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    7648092..7648111
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7660048..7660067
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7661237..7661256
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7715227..7720213
FT                   /estimated_length=4987
FT                   /gap_type="unknown"
FT   assembly_gap    7802213..7802309
FT                   /estimated_length=97
FT                   /gap_type="unknown"
FT   assembly_gap    7805385..7805404
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7853686..7854838
FT                   /estimated_length=1153
FT                   /gap_type="unknown"
FT   assembly_gap    7864377..7864396
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7883036..7883117
FT                   /estimated_length=82
FT                   /gap_type="unknown"
FT   assembly_gap    7884957..7884976
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7904729..7904748
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7909802..7909823
FT                   /estimated_length=22
FT                   /gap_type="unknown"
FT   assembly_gap    7942712..7942984
FT                   /estimated_length=273
FT                   /gap_type="unknown"
FT   assembly_gap    7969290..7969309
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    7986998..7987017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8064741..8064760
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8084406..8084425
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8088493..8089570
FT                   /estimated_length=1078
FT                   /gap_type="unknown"
FT   assembly_gap    8092847..8093240
FT                   /estimated_length=394
FT                   /gap_type="unknown"
FT   assembly_gap    8132561..8133008
FT                   /estimated_length=448
FT                   /gap_type="unknown"
FT   assembly_gap    8137030..8137049
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8192869..8192888
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8201423..8201442
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8217607..8217626
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8222992..8223050
FT                   /estimated_length=59
FT                   /gap_type="unknown"
FT   assembly_gap    8224994..8225013
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8247802..8247821
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8270214..8270233
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8278980..8279617
FT                   /estimated_length=638
FT                   /gap_type="unknown"
FT   assembly_gap    8280754..8280773
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8303520..8303539
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8330008..8330027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8334106..8334125
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8344806..8345932
FT                   /estimated_length=1127
FT                   /gap_type="unknown"
FT   assembly_gap    8412223..8412242
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8438025..8438044
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8442529..8442548
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8445634..8445653
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8447697..8450479
FT                   /estimated_length=2783
FT                   /gap_type="unknown"
FT   assembly_gap    8451963..8454524
FT                   /estimated_length=2562
FT                   /gap_type="unknown"
FT   assembly_gap    8473412..8473431
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8481588..8481607
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8483879..8484433
FT                   /estimated_length=555
FT                   /gap_type="unknown"
FT   assembly_gap    8486427..8486641
FT                   /estimated_length=215
FT                   /gap_type="unknown"
FT   assembly_gap    8499762..8499803
FT                   /estimated_length=42
FT                   /gap_type="unknown"
FT   assembly_gap    8548831..8549175
FT                   /estimated_length=345
FT                   /gap_type="unknown"
FT   assembly_gap    8551584..8551603
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8581456..8581587
FT                   /estimated_length=132
FT                   /gap_type="unknown"
FT   assembly_gap    8583983..8584111
FT                   /estimated_length=129
FT                   /gap_type="unknown"
FT   assembly_gap    8617360..8617379
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8680247..8680266
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8694532..8694551
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8724819..8725063
FT                   /estimated_length=245
FT                   /gap_type="unknown"
FT   assembly_gap    8725953..8726156
FT                   /estimated_length=204
FT                   /gap_type="unknown"
FT   assembly_gap    8728901..8729134
FT                   /estimated_length=234
FT                   /gap_type="unknown"
FT   assembly_gap    8734134..8734153
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8735395..8735414
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8736430..8736449
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8739663..8739682
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8755494..8755979
FT                   /estimated_length=486
FT                   /gap_type="unknown"
FT   assembly_gap    8786419..8786749
FT                   /estimated_length=331
FT                   /gap_type="unknown"
FT   assembly_gap    8800736..8802652
FT                   /estimated_length=1917
FT                   /gap_type="unknown"
FT   assembly_gap    8808876..8809114
FT                   /estimated_length=239
FT                   /gap_type="unknown"
FT   assembly_gap    8817057..8817076
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8823017..8823036
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8826389..8827033
FT                   /estimated_length=645
FT                   /gap_type="unknown"
FT   assembly_gap    8841596..8841615
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8853792..8854128
FT                   /estimated_length=337
FT                   /gap_type="unknown"
FT   assembly_gap    8855022..8857205
FT                   /estimated_length=2184
FT                   /gap_type="unknown"
FT   assembly_gap    8873617..8874172
FT                   /estimated_length=556
FT                   /gap_type="unknown"
FT   assembly_gap    8877077..8877359
FT                   /estimated_length=283
FT                   /gap_type="unknown"
FT   assembly_gap    8878942..8879458
FT                   /estimated_length=517
FT                   /gap_type="unknown"
FT   assembly_gap    8887379..8887398
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8888507..8888526
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8908390..8908409
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8910515..8910534
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    8959972..8960242
FT                   /estimated_length=271
FT                   /gap_type="unknown"
FT   assembly_gap    9013705..9013748
FT                   /estimated_length=44
FT                   /gap_type="unknown"
FT   assembly_gap    9025769..9032495
FT                   /estimated_length=6727
FT                   /gap_type="unknown"
FT   assembly_gap    9093231..9096473
FT                   /estimated_length=3243
FT                   /gap_type="unknown"
FT   assembly_gap    9139008..9139027
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9160570..9160589
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9180481..9180665
FT                   /estimated_length=185
FT                   /gap_type="unknown"
FT   assembly_gap    9199989..9200042
FT                   /estimated_length=54
FT                   /gap_type="unknown"
FT   assembly_gap    9218604..9218623
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9223157..9223182
FT                   /estimated_length=26
FT                   /gap_type="unknown"
FT   assembly_gap    9267538..9267557
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9271068..9271339
FT                   /estimated_length=272
FT                   /gap_type="unknown"
FT   assembly_gap    9279929..9287115
FT                   /estimated_length=7187
FT                   /gap_type="unknown"
FT   assembly_gap    9307815..9307834
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9309913..9314477
FT                   /estimated_length=4565
FT                   /gap_type="unknown"
FT   assembly_gap    9356493..9356814
FT                   /estimated_length=322
FT                   /gap_type="unknown"
FT   assembly_gap    9363830..9363898
FT                   /estimated_length=69
FT                   /gap_type="unknown"
FT   assembly_gap    9393873..9395185
FT                   /estimated_length=1313
FT                   /gap_type="unknown"
FT   assembly_gap    9417713..9417732
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9462089..9462490
FT                   /estimated_length=402
FT                   /gap_type="unknown"
FT   assembly_gap    9463691..9463710
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9557834..9557853
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9568533..9568552
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9602581..9602678
FT                   /estimated_length=98
FT                   /gap_type="unknown"
FT   assembly_gap    9651313..9651758
FT                   /estimated_length=446
FT                   /gap_type="unknown"
FT   assembly_gap    9707908..9708024
FT                   /estimated_length=117
FT                   /gap_type="unknown"
FT   assembly_gap    9718998..9719017
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9720441..9721664
FT                   /estimated_length=1224
FT                   /gap_type="unknown"
FT   assembly_gap    9741840..9743307
FT                   /estimated_length=1468
FT                   /gap_type="unknown"
FT   assembly_gap    9800081..9800100
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9802871..9802890
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9803945..9803964
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9806748..9806767
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9807854..9808610
FT                   /estimated_length=757
FT                   /gap_type="unknown"
FT   assembly_gap    9818864..9819292
FT                   /estimated_length=429
FT                   /gap_type="unknown"
FT   assembly_gap    9820376..9820395
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9827656..9827751
FT                   /estimated_length=96
FT                   /gap_type="unknown"
FT   assembly_gap    9851526..9851563
FT                   /estimated_length=38
FT                   /gap_type="unknown"
FT   assembly_gap    9861712..9865280
FT                   /estimated_length=3569
FT                   /gap_type="unknown"
FT   assembly_gap    9870753..9870983
FT                   /estimated_length=231
FT                   /gap_type="unknown"
FT   assembly_gap    9877626..9878062
FT                   /estimated_length=437
FT                   /gap_type="unknown"
FT   assembly_gap    9881401..9885325
FT                   /estimated_length=3925
FT                   /gap_type="unknown"
FT   assembly_gap    9893831..9896032
FT                   /estimated_length=2202
FT                   /gap_type="unknown"
FT   assembly_gap    9910342..9910361
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9915202..9915221
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9937537..9937557
FT                   /estimated_length=21
FT                   /gap_type="unknown"
FT   assembly_gap    9941577..9941596
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9952910..9952929
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    9955873..9957668
FT                   /estimated_length=1796
FT                   /gap_type="unknown"
FT   assembly_gap    9978658..9982947
FT                   /estimated_length=4290
FT                   /gap_type="unknown"
FT   assembly_gap    9987578..9987597
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10000117..10000136
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10011152..10011222
FT                   /estimated_length=71
FT                   /gap_type="unknown"
FT   assembly_gap    10019397..10019416
FT                   /estimated_length=20
FT                   /gap_type="unknown"
FT   assembly_gap    10079634..10079992
FT                   /estimated_length=359
FT                   /gap_type="unknown"
FT